WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Odobenus rosmarus divergens ANOP00000000.1 (ANOP01) 107 21 14 5 48 10 4 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Odobenus rosmarus divergens V143 trdv ANOP01019355.1 148360 KGVLCDQVTQSPPDQTVASGSTVTLLCTYSTTQSNPDLYWYRIRPDHSFQFILYRDNTQSKNADFTQGRFSVLHHQSWRTFHLVISPVQPEDSASYYCSMD
Odobenus rosmarus divergens V263 ighv ANOP01040811.1 3102 LVKPGGSPRLSCAASGFTFSSYYMSWVCQAPGKGLQWVAGISSSGRSTYYTDSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCASDSEGTSV
Odobenus rosmarus divergens V264 ighv ANOP01040811.1 7286 VQCDVQLVESGGDLVKPGGSLRLSCAASGFTFSAYGMGWVRQPPGKGLQWVSSNDNGGSSTRYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCVR
Odobenus rosmarus divergens V265 ighv ANOP01040838.1 2492 VQCDVQLVESGGDLVKPGGSLRLSCADSGFIFSDYAMSWVRQTPGKGLQFVTAISSSGRSTYYANSVKGRFTISRDNSKKTLYLQMNSLRAEDMAVYYCVK
Odobenus rosmarus divergens V266 ighv ANOP01040839.1 441 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLQWVAWISYDESSTRYANSVKGRFTTSRDNGKNMLYLQMNSLRAEDMAVYYCAS
Odobenus rosmarus divergens V272 iglv ANOP01041874.1 6357 SWAQSVLTQPPSVSGALGQKVTISCTGSSSNMGYVSWYQQLPGKAPRTIIYGNSNRPSGVPDRFSGSKSGSSATLTITGLQAEDEAEYYCASGDSSLS
Odobenus rosmarus divergens V273 iglv ANOP01041892.1 1597 SWAQSVLTQPPSVSGALGQTVTISCTGSSSNIGGAYYAVSWYQQLPGKAPSTIIYSNSNRPSGVPDRFSGSKSGSSATLTITGLQAEDEAEYYCASGDESLS
Odobenus rosmarus divergens V274 iglv ANOP01041911.1 232 SWAQSVLTQPASVSGALGQTVTISCSSISGSYVSWYQQLPGKAPRTIIYGNNKRPSGVPDRFSGSKSGNSATLTITGLQAEDEAEYYCASGDSSNY
Odobenus rosmarus divergens V298 trav ANOP01045959.1 47324 PHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLVPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Odobenus rosmarus divergens V310 ighv ANOP01048550.1 114 VQCEVQLVESGEDLVKPGGSLRLSCAASGFTFSSTYMSWVHQAPGKGLQWVAFISYDGGSTGYADSVKGRFTISRDNDKNTLYLQMNSLRAEDTAVYYCAI
Odobenus rosmarus divergens V311 ighv ANOP01048555.1 2798 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSRSSMNWVRQAPGKGLQWVAYISYDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V312 ighv ANOP01048557.1 18473 VQSEVQLVGSGGDLVKLGWSLRLSCAASGFTFSSYCMHWVHQAPGKGPQWVTDISNDGSSTRYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Odobenus rosmarus divergens V313 ighv ANOP01048561.1 6543 VQCELYLMDSGGDLVKPGSSLRLSCTASGFTFGSYAMCWVRQAPGKGLQVDACISSGGSYIYSTNSMKGRFTISSNNSENMLYLQMNSLRAEDTAMYYCAN
Odobenus rosmarus divergens V314 ighv ANOP01048563.1 5436 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQFVAAISSSGGWTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V315 ighv ANOP01048566.1 3315 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSNGMSWVRQAPGKGLQWVAGISSDGSSTGYADSVKGRFTISRDNGKNTLYLPMNSLRAEDTAVYYCAN
Odobenus rosmarus divergens V334 igkv ANOP01051341.1 179513 STGDIVLTQSPASLTMSPGQRATISCKACQKVSDIWGITHYMTWYQQKSGQHPKVLIYKASSRESGVPGRFSGGGSGTDFSLTIDPVEAGDTANYYCLQSKEAP
Odobenus rosmarus divergens V342 trbv ANOP01052845.1 10399 SMDTGVTQIPKHLVAETGRKMTLKCKQNLGHNAMYWYKQSVEKAPKLMFAYRFKELIQNETVSSRFSLQRPNTSQLDLHVSSLEPEDSAVYLCASSQ
Odobenus rosmarus divergens V343 trbv ANOP01052845.1 21333 STDTGVTQIPKHLVTETGMKVTLECKQNLGHNVMYWYKQSAQKPPKLMFAYNYYELVENETVSSRFSLQRPDTSQLDLHVSSLEPEDSAVYLCASSQ
Odobenus rosmarus divergens V344 trbv ANOP01052846.1 8817 PVESVVTQTPRHLIKTRGQKATLRCSPVSGHQSVYWYQQVLGQGPRFLIQYYNREERDKGDIPARFSAQQFSDYSSQLDVDLLELGDSALYLCASS
Odobenus rosmarus divergens V345 trbv ANOP01052846.1 38308 HMDAGITQSPRYEIVRTGKNVTLRCNQTENYDYMYWYRQDLGHGLRLIYYSISTGSIDKGEVSDGYNASRSNTEDFQLILLSVASSQTSVYFCANSY
Odobenus rosmarus divergens V346 trbv ANOP01052846.1 59030 FTDAGVIQTPRHKVTKVGQEVTLRCKPIPGHGGLYWYRWTSGQGPKLLIYFNNQAPVDDSGMPKKRFSAEMTDKSISTLKIKPTELEDSDTYLCASSV
Odobenus rosmarus divergens V347 trbv ANOP01052848.1 3329 HMGAMVIQSPRYQVTWVGRPVNLSCSQDLNHYSMYWYQQKLSQAPKLLLYYYGTDLNREADTSDNFQSSRPNTSFCSLSILLPSPGDSALYLCASSK
Odobenus rosmarus divergens V348 trbv ANOP01052848.1 7308 TLDAEVTQTPGHLVKGKGQKAEMHCVPIKGHRYVFWYQQIPAKEFKFLTSFQDDIISDKTGMPEKRFLAVCPRNSPCSLEIKSTELQDSAVYFCASSE
Odobenus rosmarus divergens V350 trbv ANOP01052851.1 3162 SMDADITQTPRNGIIKTGKSILLECSKTKGHNSMYWYRQDPGLGLRLICYSYNNDINEGEVSSGYRASREVLAKFSLFMGTAIPNQTALYFCASSD
Odobenus rosmarus divergens V351 trbv ANOP01052852.1 12877 PMEAGVTQTPRYFITGTGRQLTLHCSQDMNHDAMYWYRQDPGLGLKLIYYSRNVEFVEDGDVPHGYTVLRKEKNFPLTLKSAGTNQTSLYLCASSI
Odobenus rosmarus divergens V352 trbv ANOP01052852.1 22130 LVDAQVTQTPKHLIKQVGAKVVIECSQNMDHERMFWYRQDPGLGLQLLHWSRNVDDIEQGDIPFGYSVSRQRKKAFPLTLESASTNQTSVYLCASSE
Odobenus rosmarus divergens V373 iglv ANOP01058449.1 4839 SWAQSVLTQLPSVSGALGQTVTISCTGSSSNIGGAYYGVSWYQQLPGKAPRAIIYDNNNQPSGVPDRFSGSKSGSSATLTITGLQAEDEAEYYCASWDKSLK
Odobenus rosmarus divergens V405 ighv ANOP01066458.1 667 VHSQVQLVQSDAEVRKPGASVKVSCKASGYTFTSYAMNWVRQAPGKSLQYMGWINTNTGNPTYAQGFSGRFVFSMDTSVSTAYLQISSLNSEDTAVYYCA
Odobenus rosmarus divergens V406 ighv ANOP01066493.1 3027 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVAAISSSGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCTS
Odobenus rosmarus divergens V408 iglv ANOP01066582.1 6873 SWAQSVLTQPPSVSGALGQTVTISCTGSSSNIGRGNYVSWIQQLPGKTPKTVIYGASSRPSGVPARFSGSRSGNSATLTITGLQAEDEAEYYCASGDSSLS
Odobenus rosmarus divergens V417 trav ANOP01069467.1 2461 LSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASNYFPWYKQELGKGPQLLIDIRSSMATKEDQRLTVFLNKMAKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V524 iglv ANOP01015458.1 948 SWAQSVLTQPSSVSGALGQTVTISCTGSSSNIGGAYYGVSWYQQLPGKAPTTIIYSNNKRPSGVPDRFSGSKSGSSATLTITGLQAEDEAEYYCASGDSSLK
Odobenus rosmarus divergens V530 iglv ANOP01016297.1 28443 SQPGLAQPDALLVFPGQVAQLSCMLSPHHATVGEYGVSWYQQQAGSAPRYLLYYRSEDDYHRPPDIPARFSAATDAAHNACILTISPVQPEDDADYYCSVG
Odobenus rosmarus divergens V531 iglv ANOP01016318.1 48122 SMASYVLTQPSSMSVNLGQTASITCRGDNIGNKYTSWHQQKPGQAPVTIIYKDNKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCLAGASSAD
Odobenus rosmarus divergens V532 iglv ANOP01016318.1 29747 SMASSGLTQSPSVSVSLGQTATITCSGDTLSEYYTQWYQQKPGQAPVTVIYEDSKRPSGIPGRFSGSNSGNTATLTISRARAEDEADYYCQMWDSSAD
Odobenus rosmarus divergens V533 iglv ANOP01016318.1 17886 SMASYVLTQPSSMSVNLGQTASITCGGDNIGSKSASWYQQKPGQAPVTIIYSDSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCLAGASSAD
Odobenus rosmarus divergens V534 iglv ANOP01016331.1 22847 TSSEAVVTQEPSLTVSPGETVSLTCASSYGAVSNLHYPVWFQQKPGQSPMTLIYNADNKPSWTPARFSGSLLGGKAVLTLTGAQPEDEAEYYCFLQYGDG
Odobenus rosmarus divergens V535 iglv ANOP01016331.1 16909 ATSQAMVTQETSLSMSPRGTVTITCGSSTRAVTTSNHVSWVQQKPYQVPQGLISSTSNLNPGVPARFSSSLVRQKAALTITGAQTEDEAQYYCALYSNY
Odobenus rosmarus divergens V536 iglv ANOP01016332.1 22382 SWAQSVLTQPASVSKALNQTVTISCTGSSSNIGSNSVSWYQQEKPGKAPRAIIYGNSNRPSGVLDRFSGSKTGSSATLTITGLQAEDEAEYYCASWDDSLS
Odobenus rosmarus divergens V537 iglv ANOP01016333.1 1311 SWAQSVLTQPPSVSGALGQTVTISCTGSSSNIGGGYVSWHQQLPGKAPKTVIYWDDSRPSGVPDRFSGSKSGSSATLTITGLQAEDEAEYYCASSDSSYS
Odobenus rosmarus divergens V553 trav ANOP01019357.1 19396 GSCRTEIIQSSDLAAMIGTDVTFQCQYNILDGNYDSVYWYLQRADQRLTYINHISQGTMESEHYLLSVNRELSSSALTIKHVQPKDKATYYCAF
Odobenus rosmarus divergens V554 trdv ANOP01019357.1 13035 VSLDILLEPDTKTLTVLVGESATLCCSVSGGDLKNYQVSWYKMKEDNSLTLVYRPSNNTNDNLRSNFKGNTNASKSQLDIQRTTVEDTGTYYCTCD
Odobenus rosmarus divergens V555 trav ANOP01019358.1 63966 GTSGNSVQQTDQITVLEGASVTMNCIYTSTRYPTLFWYIQYPNKALQFLQKETMENSKNFGARNIKDKNSPIMKSTVQMSDSAVYYCLLRDAHSAK
Odobenus rosmarus divergens V556 trav ANOP01019358.1 60528 VRVRTGVEHHPRYLTAQEGDSVTTNCSYFRGMTTVHWLQQNPGGGIVSLFILSLETKKEERVRATVNAEELHSPLYITASRPRDSATYLCAVG
Odobenus rosmarus divergens V557 trdv ANOP01019358.1 26497 SSNTDKVRQSPSVMNEEEGQSVTLDCSFTLNFNYYVMNWYHQPPHGKMTQIITMYSDSNSHRQGRYALSFQKGNKVLKLTITGLIPEDTGTYFCAIGEA
Odobenus rosmarus divergens V558 trdv ANOP01019364.1 61021 SSMAEKVIQTQKTVIMQEGLAATIYCKYETSWSNYYTLYWYKQPPSREMVFVIYQDENKPNAKQGRFSVNFQKAAKSISLTISPLKLTDSAVYFCALGS
Odobenus rosmarus divergens V559 trav ANOP01019364.1 57115 IMSDAKTTQTNAMESTEEEPVHLPCNHSTISGNEYIHWYRQIPNQGPEYMIHGLKGTVTNGMATLIITTARESSTLILPRVTLGHAAVYYCMVRE
Odobenus rosmarus divergens V560 trav ANOP01019364.1 51613 VSSQELEQSPQFLIIQEGGDFTINCSSSEPVYALHWYRQKNSEGLISLMILWKNGEEKNHEEITATLDEKKQQSSLHITASQSSHSGTYLCAAE
Odobenus rosmarus divergens V561 trav ANOP01019364.1 38612 VSSEDKVIQSPPSLIAHEGDNSTLSCSYKVTNFQSLFWFKQEEKTPTFLLRLISGGTEKSGRLKGTLDKKELLSTLHITTTQLGDSATYLCAVE
Odobenus rosmarus divergens V562 trdv ANOP01019364.1 11985 SSTAQTVTQTQPDTSVRETETGTLHCTYDTSDSDYYLFWYKQPPSGEMILIIRQEAYKQENATKDRFSVNFQKAKKSFSLGISDSRLEDAAMYFCALIG
Odobenus rosmarus divergens V563 trav ANOP01019365.1 70682 GTGAQSVTQPDAHVTVPEESPLELRCNYSSLRPYLYWYVQYPNQGLQLLLQYVSGNTKVQGIKGFKAELKDRETSFHLKKPSAHWSDSAVYFCAVS
Odobenus rosmarus divergens V564 trav ANOP01019365.1 43561 VGSVLNVEQNPPWLHVQEGENTNFTCRFPSSSFYSLQWYRWEPAKSPTFLFSVTLNGDEKKKGRVKTTLNTQEGYSSLYIEGSQPEDAVIYLCAM
Odobenus rosmarus divergens V565 trav ANOP01019365.1 36465 INGQEIKQNPQFLLLQEGEDFTIYCNSSITLNSLQWYKQRPGGGPVLLITLLKGGEVKQERLTARFGETRKDSSLHMEPSQTADAGTYFCVGHSALR
Odobenus rosmarus divergens V566 trav ANOP01019365.1 16223 ENTQQLEQSPRFLSIQEGENFTAYCNSTSTFSSFQWYRQKPGEGPVHLMTLSKGGEMKKHKSLTAWFGEARKDSSLLVVAAQPGDASIYLCAG
Odobenus rosmarus divergens V567 trav ANOP01019365.1 9653 VRVQMKVEQSPRVLILQEGRNASMICNYSTSMTSVQWFQQSPEGRFTSLSYIASGTQQKGRLKFTVNIKERNSHLYITDSQPWDSVTYFCAVG
Odobenus rosmarus divergens V568 trav ANOP01019365.1 4538 VNSQQKGDQLQVKQTPSLNVQEGKTSILNCDYNNDLFDYFPWYKKYPAKNPEFLISILSVTHKNEDGRFTVFLNKSAKHLSLHIAGSQPGDSALYLCAAS
Odobenus rosmarus divergens V569 trav ANOP01019368.1 31816 GTTGDTVTQTEGSVTLREGTPLTLNCTYESSYSVFVFWYVQYQNKEPELLLKSSSENQRVEHHGFQADLKSDKSFHLEKRSVQMSDSAVYYCVLG
Odobenus rosmarus divergens V570 trav ANOP01019368.1 11608 LSGEDHVEQSPQTLRLQEGDSVSLNCSYTVSYSKGLQWYRQDPRQGLEVLFLLYSVGDKKQKETLKATLLKEGSSLHIEASKPEYSATYLCAVE
Odobenus rosmarus divergens V571 trav ANOP01019368.1 2122 VSSKQEVKQIPEALNICEQDSVVLNCSYTDGALYSLQWFRQDPGKGLTFLLLIQSNQRELTSGRIKVSLDTSARQSTLYIAASQPSDSATYLCAV
Odobenus rosmarus divergens V572 trav ANOP01019369.1 130910 QTHGDSVTQTEGQVTLLEEASLTVNCTYSASGSLTLFWYVQYPGEGPELLLKALRDKEKGSKKGFEATYDRDSKSFHLEKGSVQASDSAVYYCALS
Odobenus rosmarus divergens V573 trav ANOP01019369.1 122284 VRGLEVEQSPSALSLQEGASSTLKCNFSSTVNNVQWFRQNPGGGGLTRLFYIISGMKQSGRLNCTVNAKERSSTLHLTDSQLEDTATYLCAVE
Odobenus rosmarus divergens V574 trav ANOP01019369.1 116305 FSQGEKVEQHPSTLSVPQGSSSVINCRYSDSASEYFPWYKQEFGKGPQLLIDIRSTMATKEDQRFTVLLNRTAKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V575 trav ANOP01019369.1 104438 VRGMEVEQSPSALSLQEGTSSTLRCNFSSAVKNVQWFWQNPGGGGLTRLFYIASGMKQSGRLNCTVNTRERSSTLYITASQLEDSATYLCAAE
Odobenus rosmarus divergens V576 trav ANOP01019369.1 99320 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSMSVYFPWYKQEFGKGPQLLIDIRSSMATKEDQRLTVFLNKMAKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V577 trav ANOP01019369.1 83112 VRGMNVEQSPSTLSLQEGASSTLRCNFSSVLNSVQWFRQNLGDGGLTSLFYITSGMKQSGRLNCTVNTRERSSTLHITASQLEDSATYLCAAE
Odobenus rosmarus divergens V578 trav ANOP01019369.1 76040 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASEYFPWYKQEFGKGPQLLIDIRSNTAKKEDQRLTVLLNKMTKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V579 trav ANOP01019369.1 61950 QTHGDSVTQTEDQVTLSEKASLTVNCTFSTTWSPTLFWYVQYPGKGPELLLKASRDKDTKHNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMN
Odobenus rosmarus divergens V580 trav ANOP01019369.1 54902 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSTFVYFPWYKQEFGKGPQLLIDIRSNMAKKEDQRLTVFFNKMAKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V581 trav ANOP01019369.1 45762 QTHGDSVTQTEGQVTLSEEAFLTINCTYSTIGYPTLFWYVQYPGEGPELLLKASRDKEKGSKKGFEATYNRDSKSFRLEKGSVQASDSAVYYCAMN
Odobenus rosmarus divergens V582 trav ANOP01019369.1 36503 QTHGDSVTQTEGQVTLSEEAFLTINCTYSTTGYPTLFWYVQHPGEGPELLLKASRDKETKHNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMS
Odobenus rosmarus divergens V583 trav ANOP01019369.1 29125 VSGKNQVEQNLPSLVILEGENCTIQCNYTVNPFSNLRWYKQGTGRGPASLIVMAYGDSKKSDGRYTATLDATSKHSSLHITDAQLSDSAFYICAVS
Odobenus rosmarus divergens V584 trav ANOP01019369.1 16495 MRSQQKGVEQSPGSLSVLEGATASLNCNYSDSASQYFMWYRQYSGKGPKLLMYMYSKGDKKEGRFWGQVDRAKQYVSLLIRDSQPSDSATYLCAV
Odobenus rosmarus divergens V585 trav ANOP01019369.1 12714 GTGAQSVTQPDAHVTVSEEDFLELRCNYSYSGTPYLYWYVQYPNQGLQLLLKYVSGNTKVQGIKGFKAEFKDRETSFHLKKPSAHWSDSAVYFCAVS
Odobenus rosmarus divergens V586 trav ANOP01019369.1 7951 GTGAQTVTQPEDFISVFEGNFVQVKCNYSYSGSPVLFWYVQYPKRGLQLLLKHISGESIKGFTASLNKDETSFHLKKQSAQEEDSATYYCALR
Odobenus rosmarus divergens V587 trav ANOP01019369.1 3803 VKSQQEEYHRVLSIQEGENATMNCSYKTSISNLWWYRQDSGRGFVWLVLIHSNEREKHSGRLQVTLNSSIKSSSLSLMASQTVDTATYICAT
Odobenus rosmarus divergens V588 trav ANOP01019370.1 5762 QTHGNSVTQTEGQVTLLEEDSLTVNCTYSTTGSPTLFWYVQYPGEGPEFLLKALRNKEKGSKKGFEATYDRDSKSFHLEKGSVQASDSAVYYCAMN
Odobenus rosmarus divergens V589 trav ANOP01019371.1 1751 VRGLEVEQSPSALSLQEGASSTLKCNFSSTADSVQWFQQNFGGGGLTRLFYIASGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAVE
Odobenus rosmarus divergens V590 trav ANOP01019372.1 26664 VRGMEVEQSPSALSLQEGASSTLKCNFSSTPDSVQWFRQNPGGGGLTSLFYIASGMKQSGRLNCTVNTRERSSTLHITVSQLEDSATYLCAAQ
Odobenus rosmarus divergens V591 trav ANOP01019372.1 22538 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSRSDYFPWYKQEFGRGPQLLIYIRSSTATKEDQRLTVLLNKTAKHLSLHIADTQPEDSAVYFCAA
Odobenus rosmarus divergens V592 trav ANOP01019372.1 16300 QTHGDSVTQTEGQVTLSEKGFLTVNCTYSGSGYPALYWYVQYPGEGPQLLLSALTDKEKGSKKGFEATYDRDSKSFHLEKGSVQASDSAVYYCAMS
Odobenus rosmarus divergens V593 trav ANOP01019372.1 8528 QTHGDSVTQTEGPVTLSEEASLTINCTYSTTGSAALFWYVQYPGEGLQLLLNAFSDKKKSKKGFEATFDSKSKSFHLEKGSVQASDSAVYYCAMS
Odobenus rosmarus divergens V594 trav ANOP01019373.1 12581 LSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASNYFPWYKQELRKGPQLLIDIRSTMATKEDQRLTVSLNKTAKHLSLHIKDTQPEDSAVYFCAA
Odobenus rosmarus divergens V595 trav ANOP01019373.1 4565 QTHGDSVTQMEGPVTLSEKASLTINCTYTTTSYPTLFWYVQYPGEGPELLLKASRDKEKGSKKGFEATYDRDSKSFHLEKGSVQASDPAVYYCAMS
Odobenus rosmarus divergens V596 trav ANOP01019374.1 56513 AEGKDQVFQPSTVSASEGSVVEISCNHSISTAYDFFWYLHFPGRAPRLLIKGSGPSQQGRYNMTYERFSSSLLILQVRVADAAIYYCALEGTE
Odobenus rosmarus divergens V597 trav ANOP01019374.1 52171 GLRAQSVSQPDQVTVAEGDPLTVNCTYSVSGNTYLFWYVQYPNQGLQFLLKYITGNNLVKGSYGFEAEFNNSQTSFHLKKPSVLRSDSAVYFCAVA
Odobenus rosmarus divergens V598 trav ANOP01019374.1 39384 GTGAQSVTQPDAHVTVSEEAALELRCNYSSLVQPYLYWYVQYPNQGLQLLLQYFSGDTLVKGIKGFEAEFRKTETSFHLRKPSAHGSDAAKYFCAVR
Odobenus rosmarus divergens V599 trav ANOP01019374.1 31547 MSKGEEVQQHPSFLTIWEGASFVINCTYTDSTSDYFFWYKQEPGKGLQLLISTLSNVVKKQEQRLTVLFNKKDKHLSLQDTATHPGDSATYFCATR
Odobenus rosmarus divergens V600 trav ANOP01019374.1 18536 TSGDTVTQTEGSVTLREGTPLTLNCTYESSYSVVVFWYVQYQNKEPELLLKSSSENQRVEHHGFQADLKSDKSFHLEKRSVQMSDSAVYYCVLG
Odobenus rosmarus divergens V601 trav ANOP01019374.1 3638 LRGMEVEQSPSALSLQEGVSSTLKCNFSSTVDSVQWFRQNPGGGGLTSLFYIASGMKQSGRLNCTVNTRERSSTLHITVSQLEDSATYLCAAQ
Odobenus rosmarus divergens V758 ighv ANOP01047341.1 4923 VQSEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQFVAAISSSGGSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V759 ighv ANOP01047360.1 1538 VQSEVQLVESGGDLVKPGGSLRLSCAASGFTFSSSSMNWVRQAPGKGLQWVAYISYDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V760 ighv ANOP01047366.1 1988 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYCMSWVRQAPGKGLQWVAGISSSGSSTYYADSVKGRFTISKDNGKNTLYLQMNSLGAEDTAVYYCAS
Odobenus rosmarus divergens V761 ighv ANOP01047367.1 398 VQSEVQLVESGGDLVKPGGPLRLSCAASGFTFSSYYMHWVRQAPGKGLQWVAAISSGGSTYYTDSVKGRFTISKDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V781 igkv ANOP01051341.1 186620 SSGEVVMTQTPLSLPVTPGEPVSISCRASQSLQDSYGNTYLSWFRQKPGQSPQSLIYLVSNRFTGVPDRFSGSGSGTDFTLRISRVEANDTGVYYCGQS
Odobenus rosmarus divergens V782 igkv ANOP01051342.1 27936 SSGEIVMTQTPLSLPITPGEPVSISCRASQSLLHSNGYNYLHWYLQKPGQSPQLLIYLASNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQSLHVL
Odobenus rosmarus divergens V783 igkv ANOP01051345.1 24737 CRGRLVLTQTPETLAASQDSFISITCRSSEEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPFRFRGSGSGSDFSLTIHGVEAEDAGVYYCQ
Odobenus rosmarus divergens V784 igkv ANOP01051345.1 3851 SGGEVVMTQTPLSLPVTPGEPVSISCRASQSLLHSDGNTYLSWFQQKPGQSPQGLIYLVSKRYTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQLSTVS
Odobenus rosmarus divergens V788 ighv ANOP01052095.1 760 VQCDVQLVESGRDLVKPGGSRRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAGISSDGSSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAG
Odobenus rosmarus divergens V789 ighv ANOP01052100.1 3736 VQCEVHLMDSGGDLVKPGSSLRLSCAASGFTFGSYAMCWVCQAPGKGLQVDACISSGGSYIYSTNSMKGRFTISSNNSKNILYLQMNSLRAEDTALYYCAK
Odobenus rosmarus divergens V790 ighv ANOP01052107.1 4686 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSCTYMSWVRQAPGKGLQWVAGISSDGSSTKYADPVKGRITISRDNGKNTLYLQMNSLRAEDTAVYYCAS
Odobenus rosmarus divergens V824 trgv ANOP01057308.1 1457 GGAGLKLDQPALVVERLGSSPSLHCQADTSVSYIHWYLHQEGSAPKRLLYLDMSRSYVQRDFVLNANKVSAKKGRESNSCTLSVLKLEKSDEGVYYCAAWE
Odobenus rosmarus divergens V825 trgv ANOP01057310.1 18515 TNADILITQLIPSITKKQGNTAFLECQIKTSGLRNNVYIHWYRQKPDQPLKRILYISSNENVVHEQGVSEERYEARKRQSDLLASLRIHQVNEEDAGLYYCACWD
Odobenus rosmarus divergens V826 trgv ANOP01057316.1 19349 GGAGLKLDQPALVVARLRLDSSATLPCKVDTSVSYVHWYRHQEGTAPKRLLYLDMSRSFVKRDFPMKADKVNAQKGRESNSCTLSVLKLEKSDEGVYYCAAWE
Odobenus rosmarus divergens V837 trav ANOP01059871.1 26781 TSDEDFQVTQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERQLIYNFNGSQFPRVTQVENTEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Odobenus rosmarus divergens V864 ighv ANOP01066458.1 11145 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSNDMSWVHQAPGKGLKWVAWISYTGGSSYYADSVKGQFTISRDNGKNTLYLQMNSLRAKDTTMYYCGK
Odobenus rosmarus divergens V865 ighv ANOP01066509.1 8315 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSTYMNWVRQAPGKGLQWVAFISYDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAG
Odobenus rosmarus divergens V868 trgv ANOP01068103.1 15320 VLGQVKLEQPEISISRARDKSAHISCKVFTQDFNNKVIHWYRQKPDQEIEHLTYIQTSSVQVSLGGKKNKLEASKNAHTSTSTLSVNFLEQEDEAMYYCACWSR