WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pteropus vampyrus ABRP00000000.2 (ABRP02) 196 46 61 3 48 24 4 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pteropus vampyrus V0 trav ABRP02120698.1 8825 SSVAQTVTQPQPEMSVQETETVTLACTYDTSESTYYLFWYKQPPSGEMIFIIRQESYKQQNAMHDRFSVNFQKATKHFSLRISDSQLEDAAMYFCAFMK
Pteropus vampyrus V1 trav ABRP02120701.1 9604 VSGKNGVEQSPQYLSAQEGEFITINCSYSKGMTTLHWLRQNPGGGIVSLFILSLQMKKEGRISAKINTKESHSSLHITASQPRDSAIYFCAM
Pteropus vampyrus V2 trav ABRP02120706.1 43472 GSCRTEITQSSDTVAMTGTDVKFQCQYDIRDGNYDSVYWYLQRTHQRLTYIYHVFQGTVKLEHYRLSVERELSSSTLTILHVQPRDKAIYYCALR
Pteropus vampyrus V3 trdv ABRP02120706.1 49740 VLLDINLEPDTKTLTVRVGEPVTFFCRVTGADLKSYQMSWYKKNEDNSLTLVYKLSNNSDHNLIRSNFKGKIDALKSQYILDIQKATAKDAGIYYCGSN
Pteropus vampyrus V4 trdv ABRP02120708.1 11381 AMSVHVLVPQDQVVTVSVGESVTFRCSMKGGSITSFYLSWYRKTQGNTMTFIHREENIYGPGFQDRFRGKIDVSNNQAVLEILKVSEEDEGSYYCASD
Pteropus vampyrus V5 igkv ABRP02131572.1 19431 TTGEIVMTQSPASLSLSTRERATFNCRASQSVSNYLAWYQQKPEEAPRLLIYRASTRASGIPARFSGSGSGTEFTLTISNLEPEDFATYYCQQYNSGY
Pteropus vampyrus V6 igkv ABRP02131575.1 10220 SNGNTMLTQSPNLLSVSLRESASIICTANQSVSDYLTWYQQKPGQAPKILIYDADNLYSGVSNRFSGIQSGTKFILTISKIEPDDAASYYCQQGYTVP
Pteropus vampyrus V7 igkv ABRP02131578.1 3363 TRTEIIVTQSPALLSAAPGDKVTITCKASQDIDDDMNWYQQKPGETPMLIIREATTRLSGVPSRFTGSGYGTDFTLTINNMETEDAAYYFCQQDDNL
Pteropus vampyrus V8 trbv ABRP02141069.1 11407 VRAQTIHQRPPTKVQVVGSPLSLECTVKGTSNPNLYWYRQALGGALQLLFYSYSVNQTESEAPQNLTASRPQDGLFILSSKKLLLSDSGFYLCAWS
Pteropus vampyrus V9 trav ABRP02157147.1 734 TTGQGVQQPSELVAMEGASVQVNCIYQTSGFNALFWYQQDDGRAPIFLSYNVLDGLEKRGHFFSFLSCSETYSYLLLKELQMKDSAFYLCAVR
Pteropus vampyrus V11 iglv ABRP02163427.1 1615 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWHQQTPGQAPRMLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCNLDMGSYT
Pteropus vampyrus V12 iglv ABRP02163433.1 2423 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSYGVQWYQQLLGTAPKLLIYYDNSRASGVPDRFSGSKSGNSGSLTISELQAEDEADYYCSSWDDQSQC
Pteropus vampyrus V13 iglv ABRP02163439.1 44 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGYYVQWYQQLPGTAPKTLIYDNNKRPSGVPDRFSGSKSGSSASLTIRGLQAADEADYYCQTYDSSLDA
Pteropus vampyrus V14 iglv ABRP02164143.1 592 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRGRYVSWYQQLPGLAPKLLIYGDSDRASGIPDRFSGSKSGSSASLTISGLQAEDEADYYCHTYDYSLSA
Pteropus vampyrus V15 iglv ABRP02164147.1 3515 ANSQSVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTAGQAPRRLIYNTNSRPSDIPGRFSGSISGNKAALTITGAQPEDEADYYCNLGMGSYT
Pteropus vampyrus V16 iglv ABRP02164153.1 1908 ANSQTVVTQEPSLSVTPGGTVTLTCGLSSGSVSTSIYPAWHQQTPGRAPRTLIYHTNSRPSEIPGRFSGSISGNKAALTITGAQPEDEADYYCSLSQSTA
Pteropus vampyrus V17 iglv ABRP02164156.1 1644 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDYGVQWYQQLPGAAPKLLIYGNSNRESGVPDRFSGSESGNSASLTISGLQVEDEADYYCQAYDDSLD
Pteropus vampyrus V18 iglv ABRP02164163.1 1699 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGDYVQWYQQLPETAPKTLIYGASSRPSGVPDRFSGSRSGNSASLTISGLQAEDEADYYCSAWDSSLN
Pteropus vampyrus V19 iglv ABRP02164172.1 64 SWAQSALTQPSSVSGALGQTVTISCAGSSNDIGSYNDVSWYQQRSGMTPKLLIYKVNTRPSGIPDRFSGSKSGTKASLTISGLQPEDEADYYCCSYRSG
Pteropus vampyrus V20 iglv ABRP02164172.1 6086 SWAQSALTQPSSVSGALGQTVTISCAGSRNDIGSYNYVSWYQQRSGTTPKLLIYNVNTRPSGIPDHFSGSKSGNTALLIISRLQPEDEADYHCFSYAGS
Pteropus vampyrus V21 iglv ABRP02164176.1 6329 SAASSNVSQPPAVSVAIGQTARITCQGESVKKYYPDWFQQKPGQAPVLVIYDENKRPSGIPDRFSGPLSADTSTLTISGIQAEDEADYYCSVWDDSDK
Pteropus vampyrus V22 trav ABRP02164807.1 2780 DARAQTVTQPDSHITVSEGASLELRCKYEYGATPRLFWYVQYPSEGLQLLLKYYSGDTLVKGDKDFVAELNEFSFNLKKSSARLSDSAVYFCAVS
Pteropus vampyrus V23 trav ABRP02164826.1 1134 SSIAQKVTQGHRAMLVQEKEAVTLDCRYDTSDSSYSLVWYKQLSSGTMILLIRQNSYNQRNATEGRYSLNFQKANNFCNLVITAAQLEDTALYFCALSE
Pteropus vampyrus V24 trdv ABRP02164827.1 1101 SSIAQKVTQGHQAMLVQEKEAVTLDCRYDTSDSSYSLFWYKQLSSGAMILLVRQDSYNQRNATEGRYSLNFQKANNFGNLIISAAQLEDSALYFCVLSE
Pteropus vampyrus V25 trav ABRP02164831.1 13090 SSIAQKVTQGQWAMLVQEKEAVTLDCRYDTSFTSYTLFWYKQPSSGGMIFLIRQDSYNKQNATEGRYSLNFQKAKNSINLVISAAQLEDSALYFCALSE
Pteropus vampyrus V26 trav ABRP02164831.1 17591 QTRGASVSQMGGQVTLSEGASLNVSCTYSASGYPALFWYVQYPGEGPQLLLKAQKANEKGIKKGFEAAYHQEANSFHLEKASVQESDSAMYYCALS
Pteropus vampyrus V27 ighv ABRP02166145.1 1235 VLSEEELKQWGLQQLKPSQTLSLTCADYKVSLTSSGYCWNWIRQPPGKGLEWMGSICYNGNTYYSPSLKSRTSISRDTSKNQFSLQLNSATIEDTAVYYCAR
Pteropus vampyrus V28 ighv ABRP02166164.1 367 VLSQVHLQETGPGLMKPSQTLSLTCTVSGFSLTSNDVHWTRQAPGKGLEWVGDIWSGGSTHYNPSLKSRLSITRDTSKSQVFLKLNSVTSKDTAVYYCAR
Pteropus vampyrus V29 ighv ABRP02166167.1 1548 VQCEVQLVESGGDMVRPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYISYGSSYIYYAASVKGRFTFSRDNAKNTLYLQMSSLKPEDTAVYYCA
Pteropus vampyrus V30 ighv ABRP02166169.1 1029 VQCEAQLVESGGDVVRPGGVSATPCAASGFTFSSYDMSWVRQAPGKGLEWVSSISSGSSYIYYAASVKGRFTISRDNAKNTLYLQMSSLKAEDTAVYYCVR
Pteropus vampyrus V31 ighv ABRP02166170.1 3915 VHAQVQLVQSGAEVRKPGASVKISCKASGYTFNDYNMHWVRQAPGQGLEWMGDVNPNNGGTDYAQKFKGRVTITADKSTSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V32 ighv ABRP02166171.1 15319 VQCEVQLVESGGDVVRPGGSLRLSCVASGLTFSSYHMSWVRQAPGKGLDCVATIWNDGSQKYYADSVKGRFTISRDNAKNTLHLQMSSLKPEDTAVYYCAR
Pteropus vampyrus V33 iglv ABRP02166515.1 1291 VNSLTVVTQEPLLSVSPGGTVTLTCGLSSGSVSTGNYPAWHQQTPGRAPRTLIYNTNGRPSGIPGRFSRSISGNKAALTITGAQPEDEADYYCLL
Pteropus vampyrus V34 trav ABRP02166807.1 363 GTCGDSVNQTEGSITLPEAAFLTLKCTYQTSYAPYLFWYVQYQNKEPELLLKSSSDNQINVRGFQASLDKKDSSFHLKKPSVQMSDAAVYYCVLG
Pteropus vampyrus V35 trav ABRP02166808.1 157 GTCGDSVNQTEGSITLPEAAFLTLKCTYQTSYPPILFWYVQYPNKELELLLKSSSDNQINVRGFRASLDKKDSSFHLKKPSVQMSDAAVYYCVLG
Pteropus vampyrus V36 trav ABRP02166811.1 641 SSMTQKVTQTQSAIAVMENEAATLDCVYETSSYSYYLFWYKQPPSGEMTYLIQQDSYNEQSTTQGRYSLNFQKSARSVNLTITASQVGDSAVYFCALRE
Pteropus vampyrus V37 trav ABRP02166823.1 1138 MSGEDQVEQSPQTRKVQEGDGVSLICSYTVSSFKGLQWYNQYPGKGPKHLFTLYTVGKKQEKKRLTATLLQKESSLHITATKPEDSATYLCAVE
Pteropus vampyrus V38 ighv ABRP02167628.1 4811 VQCDVQLVESGGDVVRPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSSISSSGGSTYYAASVKGRFTISRDNAKNTLYLQMSSLKPEDTAVYYCAR
Pteropus vampyrus V39 ighv ABRP02167628.1 7630 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTEYYMNWVRQAPGQGLEWMGRVNPNDGSTSYAQKFKGRVIITADKSTSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V40 ighv ABRP02167628.1 11500 VQCEVQLVESGGDVVRPGGSLRHSCVASGFTFSSYDMTWVRQAPGKGLEWVSSINSDGSSTYYAASVKGRFTISRDNAKNTLYLQMSSLKPEDTAVYYCTT
Pteropus vampyrus V41 trbv ABRP02167748.1 1000 PTNAGVTQTPRDKVTKMGQEITLSCKPISSHSYLYWYRQTSGQGLELLIYFNNQAPMDDKGVSNARFSAAMPNESFSTLKIQATVPEDSATYLCASSL
Pteropus vampyrus V42 trbv ABRP02167752.1 1226 ATDAQVTQLPGHKVTKRGQEVTLSCEPISGHDALFWYRQTSGQGLELLIYFSNQAPIDDKGLPNARFSAVMPSKSNSTLKIEATEPEDSATYLCASSL
Pteropus vampyrus V43 trbv ABRP02167753.1 592 PMGAMVTQNPKYQVTRVGKPVTLNCFQDLNHDAMYWYQQKLSQAPKLLFSYYETQFNNETDASDNFQPSRTNTSHCSLDVRAPGLGDSATYLCASSR
Pteropus vampyrus V44 trbv ABRP02167755.1 3638 PSSASVTQDPRHLVTGSGQEATLRCSPEEGHPYVYWYRQLPGEELKFMIYLHKERIIDESGMPKERFSAKFPEDGPNLFKIQQAEPGDSAVYFCASSL
Pteropus vampyrus V45 trbv ABRP02167756.1 1773 PTSASVTQKPRHLVTGSGQEATLSCSPEEGHPYVYWYRQLPGEELKFMISLQKEQIIDESGMPKERFSAKFPEDGPNVFKIQLAEPGDSAVYFCASSL
Pteropus vampyrus V46 iglv ABRP02167873.1 576 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDNYVNWYQQLPETAPKLLIYYDSDRASGVPDRFSGSKSGSSASLTISGLQAEDEADYYCHTYDNSLSA
Pteropus vampyrus V47 iglv ABRP02167876.1 282 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTAGRAPRMLIYETNKRPSGIPGHFSGSISGNKAALTITGAQPEDEADYYCNLYMGSDI
Pteropus vampyrus V48 iglv ABRP02167887.1 1551 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGGYWIGWFQQKAGSPPRYLLSFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGVQAEDEAYYYCSV
Pteropus vampyrus V49 trbv ABRP02168145.1 1467 AADAQVTQLPRHKVTKRGQEVTLSCEPISGHDALFWYRQTSGQGLELLIYFRNQAPIDDKGLPNARFSAAMPSKSNSTLKIQATEPEDSATYLCASSL
Pteropus vampyrus V50 trbv ABRP02168148.1 287 SADVGVTQSPRHLIKGQGGEAVLKCRPISGHNRVSWYQQARGQGPQFLIQYYEKSERDRGNIPDRFSAQQFSDYSSKLNVSSLQLADSATYLCASSL
Pteropus vampyrus V51 trbv ABRP02168152.1 1532 PMGAMVTQNPKDQVTRVGKPVTLNCFQDLNHDAMYWYQQKLSQAPKLLFYYYDTQFNNETDASDNFQPSRTNTSHCSLDVRSPGLGDSATYLCASSR
Pteropus vampyrus V52 ighv ABRP02168537.1 941 VQCEVQLVESGGDVVRPGGSLRLSCVASGFTFSSYWMIWFRQAPGKGPEWVGEINADSSTTNYGSSVKGRFTISRDNAKNTLYLQMSSLKAEDTALYYCV
Pteropus vampyrus V53 ighv ABRP02168543.1 3922 VHTQVQLMQSGAEVRNPGASVKVSCKASGYTFTDYYMLWVQQAPGQGREWMGRVNPNNGGTDYAQKFKGRVTMTADKSTSTAYMELSSLRPEDTATYYCA
Pteropus vampyrus V54 ighv ABRP02168544.1 4101 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYDMTWVRQAPGKGLEWVSSISSSGSSTNYADSVKGRFTISRDNAKNTLYLQMSSLKPEDTALYYCTT
Pteropus vampyrus V55 ighv ABRP02168544.1 7469 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTRNGVHWTRQAPGKGLEWVGDIWSGGSTYYNPSLKSRLSITRDTSNSQVFLKLNSVTSEDTAMYYCAG
Pteropus vampyrus V56 ighv ABRP02168549.1 786 ALSQLQLQESGPGLVKPSQTLSLTCAVSGGSVTSSYYWNWIRQRPGKGLEWMGYWTGSTSYNPAFQGRISITADTSRNQFSLQLNSVTSEDTAVYYCAR
Pteropus vampyrus V57 ighv ABRP02168772.1 924 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYWMHWVRQVPGKGLEWVSLISNDGSSTYYAASVKGRFTISRDNAKNTLYLHMSSLKAEDSLKAVYYCAR
Pteropus vampyrus V58 ighv ABRP02168773.1 390 VLSQVQLQETGPRLVKPSQTLSLTCTVSGFSLTSNAVHWTRQAPGKGLEWVGGIWSDGSSYYNPALKSRLSITRDTSKSQVFLKLNSVTSEDTAVYYCAR
Pteropus vampyrus V59 ighv ABRP02168778.1 4513 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSFWMHWIGQAPGKGLEWVSYISGDGSSTYYAASVKGRFTISRDNAKNTLYLQMSSLKPEDTALYYCA
Pteropus vampyrus V60 ighv ABRP02168781.1 1514 VQCEVQLVESGGDMVQPGGSLRLSCAASGFTFSSYSMYWVRQAPGKGLEWVSSINSDGSSTYYAASVKGRFTISRDNAKNTLYLQMSSVKPEDTAVYYCAK
Pteropus vampyrus V61 trbv ABRP02168906.1 3443 PLDTAVFQTPKYLVAQVGNAKTLRCEQKLSHDTMYWYKQDAQHGLQAMFTYNNKELIVNETVPSRFSPRSPNKAHLNLHMDSLEPGDSAVYLCASSS
Pteropus vampyrus V62 trbv ABRP02168913.1 1135 PVDSGVTQTPRHVVRARGQTAMLRCSPVSGHRSVYWYQQALGQGPQLLVQYYDGEESGKGNLPDRFSVQQPSDSRYELNMSSLELADSALYLCASSL
Pteropus vampyrus V63 ighv ABRP02169672.1 71 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTGNYMHWVRQAQGQGLEWMGRVYPNSGSTDYAQKFKGRVTITADKSSSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V64 trbv ABRP02169769.1 556 PTTASVTQDPRHLVTGSGQEATLSCSPEEGHPYVYWYRQLPGEELKFMIYLREERIMDEAGMPKERFSVQFPKEGLYVFKIQQAEPGDSAVYFCASSL
Pteropus vampyrus V65 trbv ABRP02169771.1 289 GPGLGELVTQQPSRAICRSGDSVLIKCRAEDFQTTTVYWYRQFPQQGLTLLATSNQGSSPKYEQGFTEAKFPIGHSELKYSNLTVASAQPADSGLYLCGAS
Pteropus vampyrus V66 trav ABRP02170146.1 1506 MSSKQEMNQSPEVLTVREEDSLFLNCSYTHSVVYSLQWFRQDPGKGLTSLLIQLNQREQTSGRIKAFLYKTSRHSALYIATSQLGDSATYLCAV
Pteropus vampyrus V67 trav ABRP02170155.1 1004 TAIDAEITQPNFMEYAEGRDVNLPCSHSTLRGNDYIHWYRQNPNQSPQYIIHGLRNTVNNMASLIITTNRNSSTLILPQVTLRDSAVYYCSVS
Pteropus vampyrus V68 iglv ABRP02170504.1 726 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRTLIYQTNNRPSGIPSRFSGSISGNKAALTITGAQPEDEADYYCNLYMGSDT
Pteropus vampyrus V69 trav ABRP02170610.1 246 TMGQDIQQPSELVAMEGASVQVNCTYQTSGFNGLFWYQQHDGRAPIFLSNNVLDGLEKRGHFFSFLSRSETYSYILLKELQMKDSASYLCAVR
Pteropus vampyrus V70 trav ABRP02170612.1 48185 GLRAQSVTQPDYQVTVTEGDPLTVKCTYSLSGSPYLFWYVQYPNRGLQFLLKYITGDKLVKGNFGFEAEFDKKQTSFHLKKLSALATDSAVYFCVGS
Pteropus vampyrus V71 trav ABRP02170613.1 2553 TLSLAKTTQPIFIDSYEGQEVNISCDHTNIVTNEFILWYRQFPNQGPQFLIQGYKTNTANELVSLFIPHDRKSSTLSLPWASLSDTAVYYCIVS
Pteropus vampyrus V72 trav ABRP02170614.1 2307 VSSQKVEQNPHSLSIQEGEEAILTCNYTNISPELLQWYRQDPGRGLVFLLLVRENERKREMGRLRATFDTAIKQSSFHITASQSADSATYFCAA
Pteropus vampyrus V73 trav ABRP02170616.1 2498 GTRAQTVTQPDSHITVSEGASLELRCKYEYGATPSLFWYVQYPSEGLQLLLKYSLGNTMVKGIKDFVAEFRKDESSFNLQKHVAHWSDSAEYFCAVS
Pteropus vampyrus V74 ighv ABRP02170842.1 491 VHSQVQLVQSGAEVRKPGTSVKVSCKASGYTFTDYYMLWVRQAPGQGLEWMGRVNPNNGGTDYAQKFKGRVTITADKSSSTAYMELSSLRPEDTATYYCA
Pteropus vampyrus V75 ighv ABRP02170845.1 2075 VQCEMQLVESGGDVVQPRGSLRLSCVASGFTFSSYYMYWVRQAPGKGLEWVSYISGDGSSTNYVDYVKGRFTISRDNAKNTLYLQMSSLKAEDTALYYCWR
Pteropus vampyrus V76 iglv ABRP02171166.1 218 SWAQSVLTQPSAVSGALGQSVTISCTGSSSNIGGGYYVQWHQELAGTAPKTLIYGTSSRPSGVPDRFSGSRSGNSASLTIRGLQDEDEADYYCSAWDSSLN
Pteropus vampyrus V77 iglv ABRP02171234.1 430 SWAQSVLTQPSSVSGAPGQSVTISCSNIRGSYVHWYQQLPGTAPKLLIYDNNKRPSGVPDRFSGTKSGSSASLTISGLQAADEADYYCSAYDSSLDA
Pteropus vampyrus V78 trav ABRP02171453.1 2000 RTRGDSVSQMGGQVTLSEGASLNVNCTYSATGYPILFWYIQYPGEGPQLLLKAQKANEKGRKKGFEATYHREANSFHLEKASVQESDSAMYYCALS
Pteropus vampyrus V79 trav ABRP02171453.1 9211 VIRGEKVDQHPSTLSVQEGNSPVIFCTYSDSLSNYFPWYKQEAGKGPQLIIDIRSNKNENKDGRFTVSLKKADKNLSLSIEATQPGDSAVYFCAAS
Pteropus vampyrus V80 trav ABRP02171453.1 16920 SSIAQKVTQGHRAMLVQEKEAVTLDCRYDTSDSRYSLFWYKQLSSGAMILLIRQNSYNQRNATEGRYSLNFQKANNFGNLVMSAAQLEDTALYFCALSE
Pteropus vampyrus V81 trdv ABRP02171630.1 1643 FSMTERVTQAETTVTRREGEAVTMDCTYETTSSYYGLYWYKQPSSGEMVFLINQYSYSSNSKRDRYSVNLQTAKKFISLTIDSLQLADSAKYFCALE
Pteropus vampyrus V82 iglv ABRP02173618.1 3715 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSNSVRWFQQFLGMAPKRLIYGNSNRDSRVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTYDDSLR
Pteropus vampyrus V83 ighv ABRP02174768.1 454 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFSSYYMNWVRQAPGQGLEWMGRVNPNNGGTDYAQKFKGRVTMTAEKSTSTAYMDLSSLRPEDTATYYCA
Pteropus vampyrus V84 ighv ABRP02178766.1 2169 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWTRQAPGKGLEWVGAIWSGGSTDYNPSLKSRLSITRDTSKSQVFLKLNSVTSEDTAVYFCA
Pteropus vampyrus V85 trav ABRP02201099.1 657 GARAQTVTQPDSHIAVSEGASLELRCKYEYDATPYLFWYVQYPSEGLQLLLKYSLGNTMVKGIKDFVAEFRKDESSFNLQKHFAHWSDSAEYFCAVS
Pteropus vampyrus V86 trav ABRP02219272.1 1360 QTRGASVSQMGGQVTLSEGASLNVSCTYSASGYPALFWYVQYPGEGPQLLLKAQKANEKGIKKGFEAAYHQEANSFHLEKASVQESDSAMYYCALS
Pteropus vampyrus V87 trav ABRP02219272.1 5686 GVRGLEVEQSPSSLLSLQEGTNSTLRCKFSDTVNYVQWFRQDPGGDLTSLFFLTSGMKTNGRLSSTMNLKERNSTLHIMASQLEDSATYLCAGQ
Pteropus vampyrus V88 trav ABRP02219272.1 12453 VIRGEKVDQRPSTLSVQEGTISVITCNYSDSASEYFPWYKQEAGKGPQLIIHIRSNKNENKDGRFTVSLKKADKQLSLRIEATQPGDAAVYFCAAS
Pteropus vampyrus V89 trav ABRP02219272.1 16540 VSSAYVLEQNPSFLSIQEREHAIINCTYQKKTFYNFHWFRQDPGKGLVSLTLTQSSQKEQADKAFKEQLGKEKWYSVLHIPASHIGDSATYFCAL
Pteropus vampyrus V90 trav ABRP02219272.1 26011 GIGAQSATQPDRHVTVSEGTSLELRCTYSTSVSPYLFWYVQYPNQGLQLLLKYISGATLVKGTKDFEAVFSKNEASFHLKKSSAHWNDSATYFCAVS
Pteropus vampyrus V91 trav ABRP02219272.1 30802 GSRAQTVTQPEDRISVFEGDSVQVKCNYLYTGSPELFWYVQHPKQGLQLLLKYTSRKSIKGFTADLNKTEASFHLKKPSAQEEDSAMYYCALS
Pteropus vampyrus V92 trdv ABRP02219517.1 2513 FSMTERVTQVQTTVTRREGEAATMDCTYEITSSYYEFYWYKQPHSGEMVFLIYQASSSPNAKQDRYSVNFQRAKKVISLTISSLQLADSAKYFCALE
Pteropus vampyrus V93 iglv ABRP02219939.1 8298 SLSQPVLTQPPSLSASPGASARLTCTLSSGSVVGGYHICWYQQKPGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCRT
Pteropus vampyrus V94 iglv ABRP02219939.1 13076 SWAQSVLTQPSSVSGARGQSVTISCTGSSSNIGGNCVQWFQQLPGTAPKSLIYCNSNRASGVPDRFSGSKSGNSVSLTIRGLQAEDEADYYCSAWDSSLSA
Pteropus vampyrus V95 iglv ABRP02219939.1 22211 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSNSVRWFQQFLGTAPKRLIYDDSNRDSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTYDDSLRA
Pteropus vampyrus V96 trav ABRP02219980.1 5709 RSSGDSVTQTQGQLTLTEGVSLNVSCTYSSSGYPTLFWYVQYPGEGPQLLLKATTSSDKASNKDFKAAYRKEPNSFHLEKASVRESDSAMYYCALG
Pteropus vampyrus V97 trav ABRP02219981.1 2913 DAKGQKVTQPDSHITVSEGASLELRCKYEYGATPLLFWYVQYPSEGLQLLLKYYSGDTLVKGDKDFVAELRKNEFSFDLRKSSARLSDSAVYFCVLS
Pteropus vampyrus V98 iglv ABRP02220617.1 7535 ATSQAVVTQEASLSTSPGGTVTLTCGSSAGAVTTSNHASWVQQKPYQVPQGLIGGSSNRAPGVPARFSGSLLGGKAALTITGAQPEDEADYYCAL
Pteropus vampyrus V99 trav ABRP02220641.1 1503 VSSAYVLEQNPSFLSIQEREHAIINCTYQKKTFYNFHWFRQDPGKGLVSLTLTQSSQKEQADKAFKEQLGKEKWYSVLHIPASHIGDSATYFCAL
Pteropus vampyrus V100 trav ABRP02220641.1 10994 GIGAQSVTQPDHHVTVSEGTSLELRCTYSTSFSPYLFWYVQYPNQGLQLLLKDISGATLVKGTKDFEAVFSKNEASFHLKKSSAHWNDSATYFCAVS
Pteropus vampyrus V101 iglv ABRP02220834.1 2036 TWAQSGLRQEASVSGSVGQKVTLSCAGNSNNVGTYGAGWYQQMPGAAPKTVMLGSSRPSGVPDRFSGSRSGNTAYLSIVDLQPEDEADYFCSAWDYSISN
Pteropus vampyrus V102 trav ABRP02220988.1 3474 VRSLEVQQSPQSVIIQEGKDVTITCKSSGTLYFLHWYHQKHEEGRIFLMMLQKGGEEKNHDKIVATFNENKQQSSLTIMASQPSHSGTYFCGVE
Pteropus vampyrus V103 trav ABRP02221040.1 1298 GVRGLEVEQSPSSLLSLQEGTNSTLRCKFSDTVNYVQWFRQDPGADLTSLFFLTSGMKTNGRLSSTMNLKERNSTLHIMASQLEDSATYLCAGQ
Pteropus vampyrus V104 trav ABRP02221099.1 6052 VIRGEKVDQRPSTLSVQEGDSSVINCTYSDSASVYFLWYKQEAGKGPQLIIDIHSYKNENKDGRFTVSLRKADKQFSLRIEATQPGDSAVYFCSAS
Pteropus vampyrus V105 iglv ABRP02030700.1 3444 SVASYELTQPPSLSVAPGQTARITCEGNNIGSKSAYWYQQKPGQAPVQVIYRDSTRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQVWDSGN
Pteropus vampyrus V106 iglv ABRP02030701.1 535 SVASYELTQPSSLSVAPGQTARITCEGNNIGSRNAYWYQQKPGQAPVLVIYEDSKRPSGISDRFSGSNSGNTATLTISGARAEDEADYYCQVWDGSEK
Pteropus vampyrus V107 iglv ABRP02030702.1 835 SVASYELTQPPSFSVAPGQTAKITCEGNNIGDKYSYWYQQKPGQAPVQVIYRDSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCFVWDSTDK
Pteropus vampyrus V108 iglv ABRP02030704.1 380 SVASSNVSQPPAVSVAIGQTARITCQGESVKKYYPGWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSHSGDTGTLTISGVQVEDEADYYCSVWDSTDK
Pteropus vampyrus V109 trgv ABRP02137015.1 17400 VLGLSKVEQSQISISTVVKKSVDIHCKISSTSFEKDVIFWYWQKPNQALEYLIRVSSTQSPARSPKGGKSNKVEARKNSQILTSILTINFIEKEDAAIYYCAGW
Pteropus vampyrus V110 trgv ABRP02137015.1 8270 TSGDILITQIITSITKKRGNTAFLECQIKPDILKKNVYIHWYQQKPDQPLKRILYISSNENVVHEQSVSEERYEARKQRSGLLVSLRIHQVNEEDAGLYYCARWD
Pteropus vampyrus V111 trgv ABRP02137015.1 6490 GDTKVRISQSQLSFTRRTDRTVHIGCKLSGVHLENAIVHWYQQKEGEPLRRILYGSTNNYKQDKPNSRLETDMKDNGNFYLIINNVVKSDEATYYCAYWD
Pteropus vampyrus V112 trgv ABRP02137016.1 25281 TQVSSNLEGRKISVTRATGMIAVFTCDSLQKSVDYIHWYRYQEGMALQHLLYYHFFSSKVVVEGRISSGKYHAYEGTGRSCKFVLRNLEESDSGVYYCAAWE
Pteropus vampyrus V113 trbv ABRP02141076.1 1998 SVFGAVLSQKPSRDICQHGTFTMMQCQADRELNLMFWYRQLPGQSLTLIATANQGSQVTYESGFTKDKFPISRPNLTFSVLTVSNLSPEDSSVYFCSAG
Pteropus vampyrus V114 trbv ABRP02141077.1 1684 LMDTEVTQIPKYLVKTMGEKVLIECLQNMGYDRMFWYRQDPGLGLRLLHVSYGVDSKEKGDFLHGYSVSREKKESFLLTLESASTNQTSVYLCAVY
Pteropus vampyrus V115 trbv ABRP02141084.1 1138 HTDAGITQSPRYKVTGTEKKVTLRCHQTEKHDYMYWYRQDLGHELTLIYYSYGTDNIEKGDVPDGYNVSRSDIESFPLTLESATPSQTSVYFCASRE
Pteropus vampyrus V116 iglv ABRP02161988.1 3447 SWAEFVLTQPHSMSGSPGQKAIISCTRSSGSIGGYYVYWYQQRPGSAPITVIYKDNKRPSGVPDRFSGSIDSSSNSAYLTISGLQPEDEADYYCQSYDSDSN
Pteropus vampyrus V117 iglv ABRP02163284.1 367 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWHQQTPGRAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEAEYYCLLWHSGA
Pteropus vampyrus V118 iglv ABRP02163292.1 533 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGNSVNWHQQLPGAAPKTLIYYNNRRPSGVPDRFSGSKSGNSGSLTISGLQAEDEADYYCSAWDDNLS
Pteropus vampyrus V119 iglv ABRP02163848.1 887 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGLGNYVQWYQQLPETAPKTLIYGASSRPSGVPDRFSGSRSGSSASLTIRGLQAEDEADYYCSAWDNSLD
Pteropus vampyrus V120 iglv ABRP02163854.1 566 ANSQTVVTQEPSLSVSTGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRTLIYHTNSRPSEIPGRFSGSISGNKAALTITGAQPEDEADYYCSV
Pteropus vampyrus V121 iglv ABRP02163861.1 565 SLSQPVVTQPPYLSASLGATARLTCTLSSGFTVGGHWINWFQQKPGSPPRYLLSFYSDSNKHQASGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLL
Pteropus vampyrus V122 iglv ABRP02163863.1 605 ANSQTVVTQEPSLSVSTGGTVTLTCGLSSGSVSTGNYPGWYQQTPGRAPRTLIYHTNSRPSEIPGRFSGSISGNKAALTITGAQPEDEADYYCSV
Pteropus vampyrus V123 trav ABRP02164910.1 3980 DARAQTVTQPDSHIAVSEGASLELRCKYEYGGTPYLFWYVQYPSEGLQLLLKYYSGDTLVKGDKDFVAEFRKNEFSFDLRKSSARLSDSAVYFCVLS
Pteropus vampyrus V124 trav ABRP02164935.1 362 DARAQTVTQPERHIAVSEGASLELRCKYEFGSTPRLFWYVQYPSEGLQLLLKYSAGDTLFKGDKDFVAEFRKNEFSFNLKKSSARLSDSAVYFCAVS
Pteropus vampyrus V125 ighv ABRP02165144.1 8597 VLSQVQLQETGPGLVKPSQTLSLTCTVSGFSLTNYGVQWTRQAPGKGLEWVGYIGSGGSTNYNPSLKSRVSITRDTSKSQVFLKLNSVTSEDTAVYYCAR
Pteropus vampyrus V126 ighv ABRP02165144.1 3338 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTDYYMHWVQQAPGQGLEWMGRVYPNSGSTSYAQKFKGRVTITADKSSSTAYMELSSLRPEDTATYYCA
Pteropus vampyrus V127 ighv ABRP02165146.1 339 VQCEVQLVESGGDVVRPGGSLRLTCAASGFTFSSYVMNWVRQAPGKGLEWVSFISETGKNINYAEPVKGRFTISRDNAKNMLYLQMSSLKAEDTAVYYCAR
Pteropus vampyrus V128 ighv ABRP02165150.1 1327 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYYMYWVRQAPGKGLEWVSYISSDGSSTNYAASVKGRFTISRDNAKNTLYLQMSSLKPEDTAVYYCAT
Pteropus vampyrus V129 ighv ABRP02165151.1 3434 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVGEINADSSTTNYGSSVKGRFTISRDNAKNTVYLQMSSLKAEDTAVYYCAK
Pteropus vampyrus V130 ighv ABRP02165154.1 2154 VHAEVQLVQSGAEVRKPGASVKVSCKASGYTFSSYAMHWVRQAPGQGLEWMGWVYPNDGSTSYAQKFKGRVTITADKSSSTAYMELSSLRPEDTATYYCA
Pteropus vampyrus V131 ighv ABRP02165157.1 2858 VYAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGRIDPEDSSTSYAQKFQGRVTITADKSSSTAYMELSSLRPEDTATYYCA
Pteropus vampyrus V132 ighv ABRP02165159.1 2693 VHAQVQLVQSGAEVRKPGASVKVSCKASRYTFTSKYMYWVRQAQGQGLEWMGRIDPEDSSTSYAQKFQGRVTITADTSTSTAYMELSSLRPEDTATYYCVR
Pteropus vampyrus V133 ighv ABRP02165164.1 1913 VQCEVQLVESGGDVVQPGGSLRLSCVASGFTFSSYYMNWVRQAPGKGLEWVSYINGDGSSTNYAASVKGRFTISRDNAKNTLYLQMSSLKPEDTAVYYCAK
Pteropus vampyrus V134 ighv ABRP02165165.1 2092 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSKYMYWVQQAQGQGLEWMGRIDPEDSSTWYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V135 ighv ABRP02165170.1 4345 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYSMSWVRQALGKGLEWVSYIRYDGSSTYYADSVKGRFTISRDNAKNMLYLQMSSLKAEDTAMYYCVR
Pteropus vampyrus V136 ighv ABRP02165170.1 639 VLSQVQLQETGPGLVKPSQTLSLTCTVSGFSLTSYGVQWTRQAPGKGLEWVGGIWSSGSTYYNPALKSRLSITRDTSKSQVFLKLNSVTSEDTAVYYCAR
Pteropus vampyrus V137 trav ABRP02165709.1 1938 VCSDDKAIQSPPSLVVREGDYVTLNCNYEVTNFQSLHWYKQEKKTPTFLFILISSGIDKHSGSLRGTLDKKERLSTLHITATQTRDSATYLCAVE
Pteropus vampyrus V138 trav ABRP02165718.1 18013 IKSDAKSTQPDVVESTEEEPVHLPCNHPTISGTEYIHWYRQIPGQGPEFVIHGLKGNVSHGMMSLIITTDRKSSTLILAQVTLRDSAVYYCILR
Pteropus vampyrus V139 trav ABRP02165718.1 16451 VRSQEVQQSPQSVIIQEGEDVTIMCKPSKTSYSLHWYFQKREESPIFLMMLQKGGEEKNHDKIVATFNENKQQSSLNITASQPSHSGTYFCGV
Pteropus vampyrus V140 trdv ABRP02165718.1 9548 FSMTERVTQVQTTVTRQKGDAVTMDCTYESKWSNYDLYWYKQPPNGKMVFLIYQHSSSPNAKRDRYSVNLQTAETIISLTISSLQLADSAKYFCA
Pteropus vampyrus V141 trdv ABRP02165724.1 371 FSVTERVTQAQTTVTRREGEAVTINCTYETTSSYYDLYWYKQPPSGEMVVITDQHIFNSNEKGDRYSVNFQKAKKFISLTISSLQLADSAKYFCT
Pteropus vampyrus V142 trav ABRP02165732.1 593 IMGDAKSTQPEAVESTEEKPVNLPCNHPTISGAEYVYWYRQIPGQGPEYVIQGLKGNVSHGMMSLIIATYRKSSTLILAQVTLRDSAVYYCILR
Pteropus vampyrus V143 trdv ABRP02165734.1 1300 FSMTERVTQAQTTVTGREGEAVTMDCTYETTSTYYLYWYKQPPSGKMVFLIYQGSSSPNEEQDRYSVNFQNAKKVFSLTISSLQLADSAKYFCA
Pteropus vampyrus V144 iglv ABRP02165976.1 1820 SAASSNVSQPPVVSVAIGQTARITCQGESIKKKYPNWLQQKPGQAPVLVIYGNNNRPSGIPDRFSSSDSGDTSTLTISGFQAEDEADYYCSVWDNSDN
Pteropus vampyrus V145 iglv ABRP02165982.1 1012 SVASYELTQPPSLSVAPGQTARITCEGNNIGGKRAHWYQQKPGQAPVLVIYGDNYRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSGN
Pteropus vampyrus V146 trbv ABRP02166245.1 368 PGLGALVTQQPSRAICRSGASVVIKCRTEDFQATTVYWYRQFPQQGLMLLVTSNQGSRAKYEQGFTEAKFPISPLELKYSNLTVASAQPADSGLYLCGAD
Pteropus vampyrus V148 trbv ABRP02166249.1 870 PMGAMVTQNPKDQVTRVGKPVTLNCFQDLNHGAMYWYQQKLSQAPKLLFYYYETQFNNETDASDNFQPSRTNTSHCSLDVRSPGLGDSATYLCASSR
Pteropus vampyrus V149 trbv ABRP02166255.1 518 SVFTGHTGAGVSQSPRHRVTGRGQEVVLKCDPISGHVYLYWYRQTPGRGLEFLISFQNKQDLDTSGMPTDRFSAQRPEGTDSTLTIQRAEPGDSALYLCASSK
Pteropus vampyrus V150 trbv ABRP02166259.1 1662 PVDSGVMQTPRHLVKAEGQTATLRCSPVSGHLYVYWYQQALGQGPQFLGQYYKGEESGKVNLPDRFSVKQLRDSRYELNMSSLELADSALYLCASSL
Pteropus vampyrus V151 trbv ABRP02166260.1 840 PVDSGVTQTPRHVVTARGQTATLRCSPVSGHRSVYWYQQALGQGPQLLVQYYNGKESGKGNLPDRFSVQQPSDSRSELNMSSLELADSALYLCASSL
Pteropus vampyrus V152 ighv ABRP02166527.1 2140 VHAQVQLVQSGAEVRKPGASVKVSCKPSGYTFSSYAMHWVRQAPGQGLEWMGWVYPIAGITSYAQKFKGRVTITADTSTSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V153 ighv ABRP02166534.1 6911 VLSQVQLQETGPGLVKPSQTLSLTCTVSGFSLTSYHVHWTRQAPGKGLEWVGAIWSGGSTDYNPSLKSRLSITRDTSKSQVFLKLNSVTSEDTAVYYCAR
Pteropus vampyrus V154 ighv ABRP02166534.1 1979 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGSVYPIAGITSYAQKFKGRVTITADQSSSTAYMELSSLRPEDTATYYCAR
Pteropus vampyrus V155 ighv ABRP02166537.1 2795 VQCEVQLVESGGDVVRPGGSLRLSCVASGFTFSSYYMYWVRQAPGKGLEWVSYISGDGSSTNYADSVKGRFTISRDNAKNTLYLQMSSLKAEDTAVYYCAK
Pteropus vampyrus V156 ighv ABRP02166538.1 1561 VQCEVQLVESGGDVVRPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSYISGGGSSTYYAASVKGRFTISRDNAKNMLYLQMSSLKAEDTALYYCA
Pteropus vampyrus V157 trbv ABRP02167672.1 349 PSSATVTQKPRHLVTGSGQEATLSCIPEEGHPYVFWYRQLPGEELKFMIYLSQERIMDESGMPKERFSAKFPKEGPNVFKIQLAEPGDSAVYFCASSL
Pteropus vampyrus V158 trbv ABRP02167687.1 313 PVDSGVTQTPRHLVKAEGQTATLRCSPVSGHRYVFWYQQAPGQGPQFLLQYFDGKETRKENLPDQFSVQELRDSRSELNMSSLELADSALYLCASSL
Pteropus vampyrus V159 trbv ABRP02167688.1 1786 PVDSGVSQTPRHVVKARGQTAMLRCSPVSGHRSVYWYQQAPGQGPQLLVEYYDRNERQKGNLPDRFSVQQPSDSRSELNMSSLELADSALYLCASSL
Pteropus vampyrus V160 iglv ABRP02168214.1 3765 SVASSNVSQPPAVSVAIGQTARITCQGETVKKYYPGWYQQKPGQAPVRVIYDNNKRPSGIPDRFSGSHSGDTSTLTISGAQAEDEADYYCSVWDGSDK
Pteropus vampyrus V161 iglv ABRP02168216.1 1746 SVASYELTQPPSLSVAPGQTARITCEGNNIGSKNAHWYQQKPGQAPVLVIYGDNNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSSN
Pteropus vampyrus V162 iglv ABRP02168219.1 2149 SVASYELTQRLSLSVAPGQTAKITCEGNNIGDKYCYWYQQKPGQAPVLVIYKDNERPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCAVWDNSDN
Pteropus vampyrus V163 trav ABRP02168887.1 689 VRSLEVQQSPQSMIIQEGKDVTITCKSSEALYSLHWYLQKREEGPIFLMMLQKGGDEKNRDKIVAIFNDNEQQSSLHITASQPRHSGTYFCGVE
Pteropus vampyrus V164 trav ABRP02168895.1 430 IMGDAKSTQPEAVESTEEEPVHLPCNHSTISGAAYIHWYRQIPGQGPEYVIHGLKGNMSHGMTSLIIATDKKSSTLILAQVTLRDSAVYYCILR
Pteropus vampyrus V165 iglv ABRP02169063.1 617 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNVGKYHVQWFQQLPGTAPKRLIYGNSNRDSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCEAYDSSLSA
Pteropus vampyrus V166 iglv ABRP02169069.1 792 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYNTNNRPSGIPGRFSGSISGSKAALSITGAQTEDEADYYCSLYMGSYT
Pteropus vampyrus V167 iglv ABRP02169073.1 1249 TWAQSGLRQEASVSGSVGQKVTLSCAGNSNNVGTYSAGWYQQIPGAAPKTVMLGSSRPSGVPDRFSGSMSGNTAYLSITGLQPEDEADYYCSTWDNSISN
Pteropus vampyrus V168 iglv ABRP02169075.1 1317 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGSYVSWYQQLPERAPKLLIYGDSDRYTGVPNRFSGSKSGNSASLTISGLQAEDEADYYCSAGDSSLSA
Pteropus vampyrus V169 trav ABRP02169547.1 308 DTDGGDSVTQTEGPVTLLEGTPMILNCNYQTTFSNPFLFWYVQYLNKPLQLLLKSTRENQRAESQSFQAQLVKSDSSFHLQKSSVQMSDSAVYYCVLS
Pteropus vampyrus V170 ighv ABRP02170204.1 4829 VQCEVQLVESGGDAVRPGGSLRLSCAASGFTFSSHWMNWVRQAPGKGPEWVGWIKNPADGLTAEYAGSVKGRFTISRDDSKNTLYLQMSSLRAEDTAVYYCVR
Pteropus vampyrus V171 ighv ABRP02171021.1 14277 VQCDVQLVESGGDVVRPGGSLRLSCAASGFTFSSFWMYWVRQAPGKGLEWVSSISRDGSSTNYAASVKGRFTISRDNAQNTLYLQMSSLKAEDTAMYYCTT
Pteropus vampyrus V172 ighv ABRP02171021.1 10917 VLSQVQLQETGPGLVKPSQTLPLTCTVSGFSLTSNAVHWTRQAPGKGLEWVGAIWSGGSTDYNPSLKSRLSITRDTSKSQVFLKLNSVTSEDTAVYYCAR
Pteropus vampyrus V173 ighv ABRP02171021.1 5787 VHTQVQLVQSGAEVRKPGASVKVSCKASGFTFTDYYMNWVRQAPGHGLEWMGEIDPENSETSYAQKFKGRVTITADTSTSTSYMELSSLRPEDTATYYCAR
Pteropus vampyrus V174 ighv ABRP02171023.1 10729 VLSQVQLQETGPGLVKPSQTLSLTCTVSGFSLTSYGVQWTRQAPGKGLEWVGAIWGGGSTEYNPALKSRLSITRDTSKSQVFFKLNSVTREDMAAYYCAK
Pteropus vampyrus V175 ighv ABRP02171025.1 8363 VLSQVQLQESGPGQVNPSQTLSLTCAVSGGSVTSSDYWSWIRQRPGKGMEWMGYWTGSTRYNPAFQDHISVTADTSRNQFFPQLNSVTSEDTAMYFCAG
Pteropus vampyrus V176 trdv ABRP02171183.1 812 FSMTERVTQIQTSVTRREGEAATMDCTYETTSTFYFLYWYKQPHSGEMVFLIYQHSSSSNAKQDQYSVNFQKAKKVISLTISSLKLADSATYFCALD
Pteropus vampyrus V177 trdv ABRP02171184.1 426 FSMTERVTQVQTTVTGREGEAVTMDCTYETTLSYYGLYWYKQPPSRKMVFLIYQHSSSPNAKRDRYSVNFQNAKEIISLTISSLQLADSAKYFCALE
Pteropus vampyrus V178 trav ABRP02171185.1 923 MRSLEVQQSPQSMIIQEGKDVTIMCKSSETLYSLHWYLQKREEGPIFLMMLQKGGDEKNHDKIVATFNDNEQQSSLHITASQPSHSGTYFCGVE
Pteropus vampyrus V179 iglv ABRP02171383.1 962 SVASYELTQPPSLSVSPGQTARITCEGNNIGNKYSQWYQQKPGQAPVLVIYENSKRPSGIPDRFSGSNSGNTATLTISGTRAEDEADYYCQVWDSGN
Pteropus vampyrus V180 iglv ABRP02171384.1 10615 SVASYELTQRPSLSVAPGQTARITCEGNNIGSKIASWYQQKPGQAPVLVIYNDNKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCFVWDGSDK
Pteropus vampyrus V181 iglv ABRP02171385.1 1835 SVASYELTQPPSLSVAPGQTARITCEGNNIGSKSAYWYQQKPGQAPVLVIYSDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCSVWDYSDN
Pteropus vampyrus V182 iglv ABRP02171389.1 3663 SVASSNVSQPPAVSVAIGQTARITCQGESVKKYYPEWYQQKPGQAPVLVIYDENKRPSGIPDRFSGPLSADTSTLTISGVQAEDEADYYCAVWDNSDN
Pteropus vampyrus V183 iglv ABRP02171561.1 4726 SWAQSVLTQPSSVSGAPGQSVTISCTGSGSNIGRGNNVGWYQQLPGTAPKLLIYGTSSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSVWDSSLSA
Pteropus vampyrus V184 iglv ABRP02171562.1 8410 SWAQSVLTQPSSVSGAPGQSVTMSCTGSSSNIGGNSVQWFQQLAGMAPKTLMYRNSNRALGVPDRYSGSKSGNSASLTIRGLQAEDEADYYCSAWDSSLSA
Pteropus vampyrus V185 trav ABRP02171697.1 1145 RSSGDSVTQTQGQLTLTEGVSLNVSCTYSSSGYPTLFWYVQYPGEGPQLLLKATTSSDKASNKDFKAAYRKEPNSFHLEKASVRESDSAMYYCALG
Pteropus vampyrus V186 iglv ABRP02172192.1 1645 SWAQSVLTQPSSVSGAPGQSVTISCTGSRSNIGGRYVSWYQQLPERAPKRLIYGTSSRDSGVPDRFSGSKSGNSASLTISGLQAEDEADYYCSAWDSSLSA
Pteropus vampyrus V187 iglv ABRP02172193.1 596 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGRYVSWYQQLPEKAPKLLIYGDSYRDSGVPDRFSGSKSGNSASLTIRGLQAVDEADYYCSAWDSSLSA
Pteropus vampyrus V188 iglv ABRP02173193.1 2951 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGNYVRWFQQLPGKAPKLLIYGDSNRDSGVPDRFSGSRSGNSASLTIQGLQAEDEADYYCSSLEGQD
Pteropus vampyrus V189 trav ABRP02179827.1 474 DARAQTVTQPERHIAVSEGASLELRCKYEFGSTPRLFWYVQYPSEGFQLLLKYSSGDTLFKGDKDFVAEFRKNEFSFNLKKSSAHLSDSAVYFCAVS
Pteropus vampyrus V190 iglv ABRP02197148.1 445 SWAQSALTQPSSVSGALGQTVTISCAGSSNDIGSYNYVSWYQQRSGTTPKLLIYRVNTRPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCCSYRSD
Pteropus vampyrus V191 iglv ABRP02198194.1 406 ANSQTVVTQEPSLSVSLGGTVTLTCGLSSGSVSTSNYPSWYQQTPGRAPRTLNYKINTRPSGVPDRFSVSISENKAALTITGAQPEDEADYYCNIWDGNSKA
Pteropus vampyrus V192 iglv ABRP02202579.1 737 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGNYVQWFQQLPETAPKTLIYGASSRPSGVPDRFSGSRSGNSASLTIRGLQAADEADYYCETYDSSLD
Pteropus vampyrus V193 iglv ABRP02220321.1 11171 ANSQTVVTQEPSLSVSLGGTVTLTCGLSSGSVSTSNYPSWYQQTPGRAPRTLNYKINTRPSGVPDRFSVSISENKAALTITGAQPEDEADYYCNIWDGNSKA
Pteropus vampyrus V194 iglv ABRP02220321.1 3665 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDNNVHWYQHFPGSAPKLLIYDDSDRASGVPDRFSGSKSGSSASLTISGLQAEDEADYYCQTYDDSLGA
Pteropus vampyrus V195 iglv ABRP02220513.1 6032 ATSQAVVTQEASLSTSPGGTVTLTCGSSAGAVTTSNYADWVQQKPYHVPQGLIGDTSNRVAGVPARFSGSLLGGKAALTITGAQPEDEADYYCAL
Pteropus vampyrus V196 iglv ABRP02220680.1 554 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSKYPGWYQQTPGRAPRMLIYETNNRPSGIPSRFSGSISGNKAALTITGAQPEDEADYYCNLYMGSDT
Pteropus vampyrus V197 iglv ABRP02222128.1 1059 SLSQPVVTQPPSLSASLGASARLTCTLSSGFNVGNYYINWFQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCSV