WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Manis pentadactyla JPTV00000000.1 (JPTV01) 71 9 9 12 18 12 5 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Manis pentadactyla V139 iglv JPTV01032930.1 15117 SWAEVRLTQPSSVSGSPGQTVTISCVRSSGSIDDYYIYWYQQHPGRAPTTVIYNDDQRPSGVPDRFSGSVDSSSNTASLTISGLLAEDEADYYCQSGDDSDYK
Manis pentadactyla V162 trav JPTV01042666.1 7072 VARAQQVTQPEVHVYVPEGAPLELRCNYSYGGILYLFWYVQYPSQGLQLLLRYFSGAILVQGIKGFEAEFKKSESSFNLRKSSARWSDSAQYFCALG
Manis pentadactyla V163 trav JPTV01042666.1 14708 RSNGNSVNQAKGQVTFLEKDSLTMNCTYSATGYPTLFWYVQYPRAGPQLLLKATKANEKGRNKGFEATYNKEASSFHLEKASVQELDSAVYYCALS
Manis pentadactyla V191 igkv JPTV01049985.1 1073 SSGDIVLTQTPSSPPISPGEPASISCRSSESLVHNDGNSYLSWYLQKPGQSQQLLIYRASNRVSGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCQQARKA
Manis pentadactyla V237 trbv JPTV01063618.1 29491 VRAQTIHQWPHARVQPVGSPLSLECTVRGASSPYLYWYRQAGGGALQLLFYSVGAGQVDSEAPQHLEASRPQDGKFVLNSTKLLLSDSGFYLCAWS
Manis pentadactyla V270 ighv JPTV01074259.1 21983 VHSQVQLVQSGAELKKPGTSVKVSCKASGYTFTSYYISWVRQFPGQGLEWMGNINPSSGGTGYAQKFQSRVTLNMDTSTSTAFMELSSLRPEDTAVYYCV
Manis pentadactyla V303 ighv JPTV01088662.1 3542 VHSQVQLVQSGAELKKLGTSVKVSCKESGYTFTSYNMHWVRQVPGEGLEWMGYINPSSGGTNYAQKFQGRVTLTRDTSTSTAFMELSSLRPEDTAVYYCAR
Manis pentadactyla V305 ighv JPTV01088667.1 4947 VHSQVQLVQSGAELKKPGTSVKVSCKASGYTFTSYYMNWVRQVRGQGLEWMGLINPSSGGTNYAQKFQGRVTLTRDTSTSTAFMELSSLRPEDTAMYYCAR
Manis pentadactyla V336 trav JPTV01101709.1 5919 ESTEQLEQSPQFLSIQQGKNVTVYCNSSSILPSLQWYKQEVGEGPVLLMTLAKGGEMKAQKRLTAQFGESRMDSSMHITAAQPQDAGIYFCA
Manis pentadactyla V337 trav JPTV01101710.1 3330 VGIQMKVAQSPEVLNLQQGGNSSLKCNFSISITSMQWFQQNPGGRLISLFYMASGVRQKGRLKSTVNIKERYSHLYITDSQPEDSATYICAVG
Manis pentadactyla V338 trdv JPTV01101710.1 21996 SSMAAKVIQAQATITAQEGEAVTLPCTYETNWHTYSYTLYWYKQPPSGEKVLLISQNHDESNAKQGRYSVNFQKAKTSISLTISSLQLEDSGRYICALQLLNEF
Manis pentadactyla V339 trdv JPTV01101710.1 37358 SSMADRVTQPQATITAQEGEAVTLPCTYETTWSTYYLYWYKKPASGEMVLLITQYSSYSNAKQGRYSVNFQKAKKSISLTISSLQLEDSAKYFCALRI
Manis pentadactyla V342 trdv JPTV01102452.1 10794 VTSAFVLVPQDEAVTVPVGESVTLRCTMEGAAITSYYMNWYRKTQVNTLTFIFRDGGTYGPGFQHRFRGNVDKSNNQVLLEILKASEVDEGSYYCASD
Manis pentadactyla V349 iglv JPTV01109573.1 15823 SVISSELIQPLEVSVALGQTARISCQGDSFESDYAHWYQQKPGQAPVLLIYQESNLASGIPDRFSGSSSGDTATLTISGAQAEDEADYYCQVWDSSDT
Manis pentadactyla V350 iglv JPTV01109573.1 20989 SVASYELIQPPSVSVDPGQTALITCSGDLLSKNYAYWYQQKPGQVPRLVIYKDSERPSGIPDRFSGASSGNTATLTISGARAEDEADYYCQSYDSSDN
Manis pentadactyla V351 trav JPTV01109631.1 8442 VSSVVTVEQTPQSLHVQEGKSTNFTCNFPSSNFYALHWYRWEPAKSPKILFVITVNGDEKEDGRVRVTLNTKDGYSYLYIKGSQPEDSATYLCAL
Manis pentadactyla V352 trav JPTV01109631.1 16340 VNGQQIKQIPQFLALQEGEDFTTYCNSSTTVNGFQWYEQKPGGRPVLLMIVVKVGEVKKEKRLTFRFGETSKDSSLHITAAQIADVGTYFCAE
Manis pentadactyla V353 trav JPTV01109633.1 3646 IMTNAKTTQTNFQDHAEGEDVNLHCNHSTIGGNEYVHWYRQNFNQSPQYIIHGLRDTVIKSMASLTIAADRKSSTLTLHRVTLRDAAVYYCILRN
Manis pentadactyla V354 ighv JPTV01109901.1 3629 VLSDVTLKESGPGLVAPSQTLSLTCTVAESPVTSSNYWNWIRQRPEKGLEWMGYWTGSTSYNPAFQGRLSITADTSKNQFFLQLTSVTSEDTATYYCA
Manis pentadactyla V363 trdv JPTV01115689.1 9806 SSMADRVTQAQATITVQEGEAVTLPCTYETSSNVYYLYWYKQPASEEMVLLIIQFSSDSNAKQGRYSVNFQKAKKSISLTISSLQPEDSAKYFCALLE
Manis pentadactyla V376 igkv JPTV01120916.1 6374 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSNEVAWYQQKPGQAPKLLIYDASTQASGVPNRFSGSGSGTDFTFTISSAQAEDVAAYYCQQDYSSP
Manis pentadactyla V379 ighv JPTV01122397.1 15490 VRCEVQLVESGGGLVQPGGSLRLTCVASGFTFDDYAMSWIRQAEGKGLEWVSSISWNGNNKYYTDSVKGRFTISRDNGKNTVDLQMDPLTDEDSALYFCAK
Manis pentadactyla V380 ighv JPTV01122398.1 9896 VHSQVQLVQSGAELKKPGTSVKVSCKASGYTFTSYGVNWVRQVPGQGLEWMGWINTNTGVPSYAQKFQGRVTMTRDTSTSTAFMELSSLRPEDTAVYYCAR
Manis pentadactyla V383 igkv JPTV01127351.1 3678 SSGDIVMTQSPHSAPVSPGESASISCRSSQSLLHSNGNTYLQWYLQKPGQSPQLLIYGVSNRASGVPDRFSGSGSGTDFTLKISRVQADDAGVYYCHQDIQNP
Manis pentadactyla V384 iglv JPTV01127658.1 8677 TISQAVVTQETSLTTSPGGTVILTCGSSAGTITTSNYANWFQKKPYQAPQGLIGATSTQVPGVPVQFSGSLLGNKAALSITGAQPKDEAEYFCALWFSNH
Manis pentadactyla V395 trav JPTV01135613.1 2633 MRSQQKGVEQSPGSLRVPEGAIASLNCTYGDSASQYFPWYRQYSGKGPELLIYIFSSGDKKEGRFTVQLNKDSQYVSLLIRDSQLSDSATYLCAVS
Manis pentadactyla V396 trav JPTV01135613.1 7395 GTRAQSVTQPDGHITVSERDRLELRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNNLVPGIKGFEAEFKKSETSFHLKKPSAHWSDSAQYFCALS
Manis pentadactyla V403 igkv JPTV01144445.1 3662 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYDASTRASGVPDRFSGSGSGTDFTFNISSAQAEDLASYYCQQHYSSP
Manis pentadactyla V404 iglv JPTV01144826.1 5013 SWAQSGLTQPPSVSGSPGQRVTIPCSNIPGSYVHWYQQLTGSAPRLLIYDNSKRASGVPDRFSGSKSGSSGSLTITGLQAEDEADYYCSAWDSNLQ
Manis pentadactyla V405 igkv JPTV01145519.1 137 SSGDIVLMQTPLSLPVSPGEPASISCRSSESLLHSDGNTYLQWFLQKPGQAPWLLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVQADDAGVYYCHQGTKR
Manis pentadactyla V410 trav JPTV01149706.1 4565 VSGVEVEQSPPAQSLQEGATSMLQCNFSTSVNSVQWLHQNPGGHLVHLFYIPLGTRQNGRLNSTTVSRERRSSLYISSSQTTDSGIYFCAVG
Manis pentadactyla V411 iglv JPTV01152421.1 3510 SVTSYELTQAPSVSVSPGGTARITCGGDNIGSKNAYWYQQKPTQAPRLLIYEDSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSGN
Manis pentadactyla V412 ighv JPTV01152808.1 1254 VHSQVQLVQSGAELKKPGTSVKVSCKASGYTFTSYYMSWVRQVPGQGFEWIGWIYPSSGGTNYAQKFQGRVTLTRDTSTSTGFMELSSLRPEDTAVYYCA
Manis pentadactyla V418 trav JPTV01156987.1 3215 GTGAQQVTQPDGHIAVSEGAPLELRCNYSYGGSLYLFWYVQYPRQGPQLLLKYTSGPTLVKGIKGFEAEFKKSETSIHLKKPSACWSDSAQYFCALS
Manis pentadactyla V533 trav JPTV01022262.1 12347 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Manis pentadactyla V587 trgv JPTV01037424.1 15431 GLGQTKPKQLEISVTRARDKSAHIRCKVTIEEFDEEIIHWYRQKPDQSIEHLIYVSGTFNSGSLGGKNNKLEASKNLAAFTSTLKVNFLEKEDEAVYYCAFWT
Manis pentadactyla V588 trgv JPTV01037424.1 10914 IGGDILITQLRTSITKKKGNTAFLECQIKTDTLKKNVYVHWYRQKPDQPIKRILYISSNENVVHEQGVSEERYEARKPQDNLPASLRIHQVKEADTGLYYCACW
Manis pentadactyla V589 trgv JPTV01037425.1 13147 TQMSSNEEGIELTVTRHTGSSVVITCDKQSTSYTHWYRFQEGMAPHRILYYDFYNSKVVLDSGFSSTKYHAYEHEGKKCKLVIRNLQESDSGVYYCAVWE
Manis pentadactyla V590 trgv JPTV01037425.1 11812 TQMSSNEEGIELTVTRHTGSSVVITCDKQSTSYTHWYRFQEGMAPHRILYYDFYNSKVVLDSGFSSTKYHAYEHEGKKCKLVIRNLQESDSGVYYCAVWE
Manis pentadactyla V591 trgv JPTV01037425.1 6382 TQMSSNLQGRKMSVTTQTGLSTVITCDIITQNRYIHWYRFQEGMAPGRILYYDSSNANVVVDSGIIPGKYYAYEDEDKSYKFVIGNMQESDSGVYYCAVWE
Manis pentadactyla V634 igkv JPTV01051618.1 2412 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYAASNRPSGVPDRFSGSGSGTDFTFTISSTQAEDLATYYCLQYNYYT
Manis pentadactyla V635 igkv JPTV01051624.1 8640 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYIAWYQQKPGQAPKLLIYAASSRASGVPDRFNGSGSGTDFTFTISSAQAEDLAIYYCQQYNSSN
Manis pentadactyla V636 igkv JPTV01051624.1 2405 ACGDTVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYAASNRPSGVPDRFSGSGSGTDFTFTISSTQAEDLATYYCLQYNYYT
Manis pentadactyla V667 trbv JPTV01063624.1 15226 PAEAEVTQTPRHLIAKTKKRLTINCSQSMNHDAMYWYRQDPGLGLRLIYFSRNVELFETGDVPDGYSVTRKEKGKFPLTLEWSSTNQTSVYLCASS
Manis pentadactyla V709 trbv JPTV01080962.1 394 FMDADVSQTPRYCVTERGKKVTLECSQTMGHEYMYWYRQDAGMELQLIHYSYGVNTTEKGEHSSGSTVSRPRKDHFVLTLQSASSSQTSRYLCASSE
Manis pentadactyla V710 trbv JPTV01080965.1 6287 FIDARVTQTPRHLVKSKGQKARMDCIPPKEHTVVYWYQQIQKKEFKFLINFQNEQVIDQIELVKKRFSAKCPSNSPCSLEIQSSEPEDSALYFCASS
Manis pentadactyla V711 trbv JPTV01080965.1 1902 SMDSGVTQTPRNRITKTGMSVSLECSQTKRHDAMFWYREDPGRGLRLVYYSLDVNDTNRGEVSSGYSVSRWEQAKFSLRLETPTPNQTALYFCASSK
Manis pentadactyla V712 trbv JPTV01080966.1 720 SGFGALVSQHPSRALRKSGASVKMECRLVDLEASTMFWYHQSPKQGLVLMATSNQASDVIYEQGFTKDKFPISHPNVTFSSLMVTSVQRADSSFYFCGAS
Manis pentadactyla V713 trbv JPTV01080970.1 2454 TLPFTGTVDGGISQTPKYLCREEGRNVTLRCEQNFNHNSMYWYRQDPGQGLRLVYYSMVENDVQKGDLHKGYNASRKKKESFPLTVTSTQKDQTALYLCASSV
Manis pentadactyla V714 trbv JPTV01080971.1 22234 HVDAGVTQSPRYKVTGTGHRVVLRCHQTENYDYMYWYRQDLGHWLRLIHYSYGINNTEKGEVPDGYDVSRLNTEDFLLTLESPTRSQTSVYFCACSD
Manis pentadactyla V715 trbv JPTV01080971.1 16097 SKDAGVSQTPRHRVTKTGQAVTLRCEPIPGHAALFWYRQTSMQGLQFLIYFSNREPIDKTGMPKDRFSAEMPSGSLSTLKIQPAEPGDSAVYLCASSV
Manis pentadactyla V725 trbv JPTV01088592.1 12811 HTGTGVSQSPMHRVTGRGQAVVLSCDPISSHAVLYWYRQTLGQGLEFMMFFQNSDAVDQSGMPNARFSAERPGGSSSTLKIERAEPGDSAVYLCASSL
Manis pentadactyla V726 trbv JPTV01088592.1 9696 GLMDAAVTQMPRHHIIRAGSKTSLECSQDMDHFTMFWYRQDPGQGLRLIHYSTDVNSTAKGDITEGYSVSRDDKAHFPLTVESASTSQTSTYLCASS
Manis pentadactyla V727 trbv JPTV01088593.1 320 HTGTGVSQSPMHRVTGRGQAVVLSCDPISSHAVLYWYRQTLGQGLEFMMFFQNSDAVDQSGMPNARFSAERPGGSSSTLKIERAEPGDSAVYLCASSL
Manis pentadactyla V755 trdv JPTV01102452.1 47440 KGVLCATVTQGSPDQTVTSGSKVTLLCTYKTSDSDPDLYWYRIRPDHSFQFILYRDNTESEDAEFTQGQFSVQHSQTRKNFHLVISSVEIEDSATYYCALR
Manis pentadactyla V758 trav JPTV01104643.1 40484 VNSQQGEQNHWALSIQEGENATMNCSYKATITTLQWYRQDPGRGLSLLILIRSNERHKSHARLQVTLDPSSKSSSLSITASQAADSAAYFCATD
Manis pentadactyla V759 trav JPTV01104643.1 34886 GTDGDSVMQTEGPVTLFEGKPLTLNCTYQTSYSATVFWYVQYRNKELELLLKSSSGNQGTGHTGFQASLVKSESSFHLQKPSVQTSDSAVYYCALE
Manis pentadactyla V760 trav JPTV01104643.1 21307 SSMTQKVTQALSTISMVQKETVTLDCAYETSSYTYYLFWYKQTPSGEMIFLIGQESYNEQNAAEGRYSLNFQKPASSVSLTITALQLQDSAMYFCALRE
Manis pentadactyla V774 ighv JPTV01113821.1 328 VPSQVQLVQSGAVLKKPGTSLKVSCKASGYTFTSYYMSWVRQVPGQGLKWMGWIYPGDGDTDYAQKFQGRVTLTRDTSTSTDFMVLSSLRPEDTAVYYCVR
Manis pentadactyla V782 iglv JPTV01118524.1 2534 SWAQSGLTQPPSVSGSPGQRVTIPCTGSSSNIGAYFVNWYQQLPGSAPRLLIYDNSKRASGVPDRFSGSKSGSSGSLTITGLQAEDEADYYCSSLDSSLGG
Manis pentadactyla V783 iglv JPTV01118525.1 675 SWAQSGLTQPPSVSGSPGQRVTIPCTGSSSNIGAYFVNWYQQLPGSSPRLLIYGDSKRASGVPDRFSGSKSGSSGSLIITGLQAEDEADYYCSSWDSSLGG
Manis pentadactyla V793 trdv JPTV01122830.1 13394 CGIAKKVTQTQLAVFVQEKAAVTLDCTYDTGDVDYYIFWYKQFSSGVMISLIHQYSYNQQNATEGRYSLNFQKTSKTIDLVISASQLEDSAVYFCALW
Manis pentadactyla V794 trav JPTV01122830.1 7626 QARGDSVAQMEGQVTFLERDSLTMNCTYSATGYPTLFWYVQSPGAGPQLLLKPAKTNEKGRNKGFGATYNKEASSFHLEKASVQELDSAMYYCALS
Manis pentadactyla V795 trav JPTV01122830.1 3229 ASSINEVEQSPPSLIILEGENGTLQCNYTMSPFNNLRWYRQDAGRGPVSLIIMSNAESRKSKGRYTATLDTARKRSSLHIRATQLSDPAVYICVVS
Manis pentadactyla V813 igkv JPTV01139995.1 348 ISGDIVMTQSPGSLAVSVGERVTINCKSSQSLLSSSNQKNYLAWYQQKPGQAPKLLIYWASTRESGVPDRFSGSGSRTDFTLTISSAQAEDVAAYYCQQHYSYP
Manis pentadactyla V821 trav JPTV01145004.1 2074 MSRGEEVEQHPSFQTVQEGDSFAINCTYTDSASTYFSWYKQEPRKGLQLLMHILSNVEQKKEERLTVLLDKKDKHLSLHITATHSGDSATYFCAVR
Manis pentadactyla V822 igkv JPTV01145520.1 2268 ISGDIVMTQPPGSLAVSAGERVTINCKSSQSVLQSSNQKNYLGWYQQKPGQALKLLISWASTWASGIHDRFSGSGSGTDFTLTISSAQAEDVAAYYCQQHYSYP
Manis pentadactyla V823 igkv JPTV01145522.1 486 ISGDIVMSQSPGSLAVSVGGRVTINCKSSQSLLQSSNQKNYLGWYQQKPGQAPKLLISWAFTRASGVPDRFSGSGSGTDFTLTSSSTHAEDVAAYYCMQHYSYP
Manis pentadactyla V827 ighv JPTV01149619.1 2146 VQCEVQLVESGGGLVQPGGSLRLTCVASGFTFSSYAMHWIRQAPGKGLQWVAGISGNANSKYYTDSVKGRSTISRDNAKNTVDLQMDRLTDEDSALYFCAK
Manis pentadactyla V829 iglv JPTV01150487.1 459 ADSQTVVTQEPALSVSPGGTVTLTCGPGSGSVSTSNYPSWFQQTPGRAPRTLIYNTNNRPSGVPGRFSGSISGSKAALSITGAQPEDDAEYFCALYMGGGI
Manis pentadactyla V837 igkv JPTV01190463.1 410 VSGDIVMIQSPGSLAVSVGGRVTINCKSSQSLLQSSNQKNYLGWYEQKPGQAPKLLISWAFTRASGVPDRFSGSGSGTDFTLTISGAQGEDVAAYYCQQHYSSP