WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Python bivittatus AEQU00000000.2 (AEQU02) 134 71 34 0 27 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Python bivittatus Vs213 ighv AEQU02228303.1 530 IQSEDQLVESGGDVKRPGESLHLSCQGSGDDFSSYWMHWVRQYPGKGLEWVAAIDNAGDTYYSDKVKGRFNISRDDDNSLMNLQMNSLKPEDTGVYYCAA
Python bivittatus Vs212 ighv AEQU02227951.1 3599 VQSEIPLLESGGDVRRPGDSLNLSCQASGFSFSSYGMHWVRQYPGKGLEWVAYIGTSSTPMYYLDKVKGRFTISRDNANNQLYLQMNNLKPEDTGRYYCA
Python bivittatus Vs211 ighv AEQU02227944.1 50 VQSEAQLVESGGDVRRPGDSLRLSCQASGFTFSDYGMNWGRQYPGKGLEWVASIWPDSSTVSYSDKVKGRFTISRDDSRSQLYLQMNNLEPEDMGHYYCV
Python bivittatus Vs217 trav AEQU02229243.1 2779 HSAGDSVKQTSGTVILTEGQPITLNCSYEAGSLSTFFTYWYIQSPGQPLELFLTEFESQPQGFQATHIPHESKKNGTFHMEKAASQPKDSAVYFCAFR
Python bivittatus Vs216 trav AEQU02229231.1 158 QITGQSVKQTTGTVTVTEGQPVSLSCSYESTVTSNYPYWYIQPPGQPPKLLLTYFDHQAQGFEATHVILESKKKGTFNMQKKAIQLKDSALYFCAFA
Python bivittatus Vs215 ighv AEQU02228306.1 707 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYPMNWVRQYPGKGLEWVAYIGTSSTPILYSDKVKGRFTISRDDSRSQLNLQMDTLKAEDTGVYYCAR
Python bivittatus Vs214 ighv AEQU02228304.1 5542 VQSEIQLVEYGGDVKRPGESVHLSCQASGDDFINYSMNWVRQYPGKGLEWVAGIGSSSTPIYYSDKAKGKFTISRDDSRSQLYLQISSLKSEDTAVYYCTT
Python bivittatus Vs219 iglv AEQU02229944.1 1975 ITSQPTLTQPASQSGFPGETIQLSCAISSSPNTIAWLQQRSGESPRSVHCDGCSNRGPGIPDRFTATRSGNNGYLTITNLQAEDEADYFCFMWYSSGSE
Python bivittatus Vs356 trbv AEQU02129066.1 5359 GSDADITQPRIMVLEEGQDARMECTQNNGHYSMFWFQQHKQQQDLHLLYNFYNGNIQQKDSSLHRLNADQPEKGRSYLSISGVKPEDSAVYFCASSE
Python bivittatus Vs355 trbv AEQU02129059.1 1362 EHVLLTQKPTWISGQPGDKIQMNCYQNNTDHNWMYWYRQTVAKQQLELIGTIIKGTPTPTIEESFRNKGFEIQREHDKHCSLQIAKLSPDDTAVYFCASM
Python bivittatus Vs188 iglv AEQU02213028.1 6410 IDCQTVWTQPSSSSVSLGGTITLPCTTTQSSYSICWYQQKSGEAPSFVHCDGYSRGEGIPDRFTATRSGSTGSVAITNAQVEDEADYYCESWDSAVTV
Python bivittatus Vs187 iglv AEQU02213028.1 2703 IDCQTVWTQPPSSSVSLGGMITLSCTTTQSSYNIGWHQQKSGEGLRYVHASGGYNRGEGIPDRFTATKSGSTGYLTITNVLAEDEADYYCESMGSVSI
Python bivittatus Vs186 iglv AEQU02213028.1 256 ALAQFTLTQPPSLSALPGETVRITCRRTGGSISSNYVSWHQQKPGSSPLTLIYGDSKRPSGIPERFSGSVDSSSNSAILSISNIGEEDEGDYYCLTGASSGQ
Python bivittatus Vs185 iglv AEQU02213026.1 19233 FISQALVTQSGPVSVAVGQTATITCTLQGVEFISPTNPSWYQQKGGQSPRLLIYKSRERASGIPQRFSADTYDNNAKLTISSVEGADEGDYFCAMWHNDG
Python bivittatus Vs181 ighv AEQU02211523.1 6275 VSADIQLVESGPGMVRPGSQLNLVCKVTDFSIATSSSYAWHWIRQPPGKGLEWLSVINVNSGVKLYATFVKSRATTSADQSRNEFSLQLNSVTAADSSVYFCAR
Python bivittatus Vs429 iglv AEQU02205879.1 3186 INSQPTLTQPPYMSVSQGQTIKLSCTVSSDQNTIYWYQQKVGQSPRYVHYSGGSRGEGIPDRYTASVSGNIGYLTITDSQAVDEAVYYCDMWYSSGRM
Python bivittatus Vs503 iglv AEQU02259139.1 373 VTTQFTLTQPASQSGSLGETIKLSCAVSTSPYFLGWIQQRSGEAPRFVHCGGCESRGPGIPDRFTGTQSSNNGYLIITNLQPEDEANYYCCMWNTRDGG
Python bivittatus Vs502 ighv AEQU02259113.1 415 VQSEVQLVESGGDVRRPGGSLRLSCQASGFDFRSNWINWVRQYPRKGLEWVGHIKSDSTTIRYSDKVKGRFTISRDNSKSQLYLQMDNLKPEDTGLYYCAR
Python bivittatus Vs501 ighv AEQU02258920.1 394 VHSDVQLVESGGDVKRPGESLHLSCQASGFDFSSYYMNWVRQYPGKGLERVSEINPSSSSIAYSDKVKGWFTTSRDNSKSQLYLQMDNLNTEDTGLYYCTR
Python bivittatus Vs500 ighv AEQU02257808.1 447 GHSEVQLVETGGGMVAPGGSLRLTCKASGFNFASHDMDWVRQAPGQGLEWVAKVNGAGNSQWYHSKVKGRFTISRDNSQSLAFLQMNNLKPEDSALYYCTR
Python bivittatus Vs359 trav AEQU02129078.1 9290 TALEQPKDSVVTEGESLTLSCSQSKTTYAFMYWYKQERKKDIWLQLVAFTTEGSGGDSAIEKPFNSRFKTTGMKSYSLPLSLEDAQVEDTGIYYCA
Python bivittatus Vs180 ighv AEQU02211523.1 3963 VLSDTQLTESGPAVVRPGDLLNLVCKVRGFSISVPNEWHWMRQPLGKGLEWVSAINVNSGGKWYAASVKSCATISADESKNEFYLQLNSVTAADSSVYFCS
Python bivittatus Vs451 trav AEQU02221409.1 3963 GSTGQSVKQTAGIVTVTEGQTVFLNCSYKAQFAGTHYPFWYVQPPGQPLKLFLTEYNHVQGFQTTHTPHGNKKEGTFNMQKQAVQLNDSAVYFCAFR
Python bivittatus Vs450 trav AEQU02221409.1 7784 HSAGDSVEQTTGTVILTEGQPITLNCSYEAGNAGIFSTYWYIQSPGQPLELFLTESENQPQGFQTTHISHESKKKGTFHMEKTASQLKDSAVYFCAFR
Python bivittatus Vs452 ighv AEQU02221802.1 2261 SFCDVQLVSSGPETVRPGQNLNLLCKVTGVSITSSSYAWNWVRQPPGKGLEWIARIYPHDGRKWFSSSLQSRTSIASDNSKNEYSLQLNSLSAADTAVYYCARD
Python bivittatus Vs459 ighv AEQU02226891.1 478 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYDMSWVRQAPGKGLEWVGYIYTDSSVIYYSDKVKGRFTISRDNAKSQLYLQMNNLKLEDTGRYYCVR
Python bivittatus Vs208 ighv AEQU02227412.1 1469 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYGMSWVRQYPGKGLEWVALISYDSSAIYYSDKVKGRFTISRDNAKSQLYLQMNNLKLEDTGRYYCARE
Python bivittatus Vs209 ighv AEQU02227417.1 257 VQSEVQLVESGGDVRRPGESLRLSCQGSGFTFSSYGMSWVRQYPGKRLEWVAFIYGDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNNLKPEDTGHYYCV
Python bivittatus Vs204 iglv AEQU02226523.1 697 PSIQQLQSMKDSEMVAPGGTVALSCSYGAGPITDNNYPEWIQQKSEQVPRLLIYSTSSRAKGIPARFSGSRSANTMSLTITGALMEDDATYYCAVWTGKG
Python bivittatus Vs205 iglv AEQU02226524.1 201 LSLQQLQSLKDTESVTLGGTVTISCRYSLGSISDSNYPWWAQQKLGKPPQTVIYHTSIKPSDVPARFSGSISGNVMSLTITGALAEDEAFYYCCLNPGGS
Python bivittatus Vs206 iglv AEQU02226524.1 3050 LSIQQLQSLKNEESVALGGTVTISCSYSGGTISNNNYLRWIQQKPGQVLKLLIATSNSRPSGVPARFSGSTSGNIMSLTITGALGEDDATYYCAVWTGSG
Python bivittatus Vs201 iglv AEQU02224263.1 2148 VTSQPTLTQPVSQSGSLGETIKLSCAISSSPSTINWIQQRSGESPRFVHCDGCSSRGPGIPDRFTGTRSGNNGYLTITNLQAEDEAVYYCCMWYSSGSV
Python bivittatus Vs202 iglv AEQU02224266.1 995 TFAQYLLTQPPSVSVSLGQNGRITCSANSIGSKNVHWYQQKPGTPPVLIIYNDSQRPTGISERFSGTNSGNTATLSISGAQAQDEAEYYCQVWDSSQ
Python bivittatus Vs203 iglv AEQU02226519.1 1512 INCQMVLTQPPSSSVSLGGTITLSCTTTQSSYCIGWVQQKSGEGPHYVQCDGYSRGEGIPDRFTATRSGNTGSLAITNAQAEDEAVYYCGRWNSAGNQ
Python bivittatus Vs199 iglv AEQU02224260.1 1739 VTSQPTLTQPVSQSGSLGETIKLSCAISSSPNYIGWIQQRSGKAPCFVHCDGCSNRGPGIPDRFTGTRSGNNGYLTITNLQPEDEAVYYCCMWYSSGSV
Python bivittatus Vs191 ighv AEQU02216895.1 450 VQSDVQLLESGGDVRRPGGSLRLSCQGSGFTFSSYWMSWVRQYPGKGLEWVGEINLDSSAIRYSDKVKGRFTISRDNSKSQLYVQMNNLKPEDTGVYYCAS
Python bivittatus Vs192 ighv AEQU02216901.1 2168 LQSEVQLVESGGDVRRPGDSLRLSCQGSGFTFSSYHMSWVRQYPGKGLEWVAVIWYDSSNKYYSDKVKGCFTISRDNAKSQLYLQMNNLKPEDSGLYYCAG
Python bivittatus Vs193 ighv AEQU02216901.1 5796 IQSEVQLVESGGDVRRPGDSLHLSCQGSGFTFSSYGMSWVKQYPGKGLEWVAHIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNNLKPEDTGRYYCAG
Python bivittatus Vs194 ighv AEQU02216903.1 1073 VQSEVQLVESGGDVRRPGGSLHLSCQASGFSFSSYYMGWVRQLPRKGLEWVADIGRSSSPIRYSDKVKGRFTISRDDSRSQLNLQMDNLKAEDTGVYYCAR
Python bivittatus Vs446 trav AEQU02221403.1 1225 TSQSNSVSQTQNNMEILEGKDATLPCHFNSIDSTAYLYWYRQYGSQSPKRILAAYKDRSKNNHFQEGKFSTTLVFGSQNSVPLKIRNVSLLDAAAYFCVLN
Python bivittatus Vs447 trav AEQU02221405.1 3338 VVWCQTEVHQPSTVQALVGREVNLSCSHPTASTNQATIFWYQQFPNRAPQFFVSAYSGEVKSDDPKGTLHIAKSRTESTFSFAELRLQDSAVYFCALK
Python bivittatus Vs444 ighv AEQU02221285.1 1811 VQSEVQLVESGGDVRRPGDSLRLSCQGSGFTFSSYWMSWVRQYPGKGLEWVAQISHTGSTIRYSDKVKGRFSISRDNAKSQLYLQMNNLKVEDTGRYYCAR
Python bivittatus Vs445 ighv AEQU02221290.1 1962 VHSSVQLVESGPGTVTPGGSFTLTCTVTGDSIKNVYWHWIRQAPGKALEWVGQIDWASNNWRIYYASSLQSRTTLSADASRNEYYLTMRSLTAADSATYYCARG
Python bivittatus Vs442 ighv AEQU02219583.1 6981 IFPNLQLSQPFHKTLTPGGTFKLNCAVSGAEVGGWFWGWNRKCPGRSFEWLGGIHNSKEGGAPFYNPHFNHRIVITRDTSKNEFYLEMRSLAASDTAIYYCA
Python bivittatus Vs118 ighv AEQU02156887.1 1534 VQSEVQLLESGGDVRRPGGSLRLSCQGSGFTFSSYWMSWVRQYPGKGLEWVGDIKYDSTTIRYSDKVKGRFTISRDNSKSQLYLQMNNLKPEDTGLYYCAR
Python bivittatus Vs119 ighv AEQU02156890.1 924 VQSEVQLVESGGDVRRPGGSLRLSCQASGFTFSSYAMSWVRQYPGKGLEWVAFIHTASSPIYYSDKVKGRFTISRDDSRSQLNLQMDNLNAEDTGVYYCVR
Python bivittatus Vs448 trav AEQU02221405.1 761 SGEDLVSQLLPELFVQVGQEATLHCKFTTTSSNPDLFWYHQVPHQPPQHILTLNKYKLTSLGIISGTLNFNEKTSQLKIEKAALGDRAVYFCALS
Python bivittatus Vs449 trav AEQU02221408.1 1861 QSAEDSVEQRRGTVTVTEGNPVFIQCSYEADWSVTNFPFWYIQPPGQPPKFFLSEKEDHNQGFQASHTYTGNKRKGAFNLKKPTSHLNDSSLYLCA
Python bivittatus Vs170 ighv AEQU02199704.1 10909 GSSESITLTQPTAVTAVPEASVTLECLASGYDINRHHIHWLIQSTGKGLDYVGGFRTGDPVIVVNKFKGRVIPFTSGSTGKLRINALTAQDTSVYYCARG
Python bivittatus Vs178 ighv AEQU02211519.1 2677 AQSEVQLVESGGGVKRPGESIRLSCRGSGFTFSSSYLYWVRQSPGKPLEWVAYISTQSSPIYYSDKVKGRFTISRDDSNSLMFLQMNSLKAEDTAIYYCTRD
Python bivittatus Vs179 ighv AEQU02211523.1 1016 CHSEIQLLQSGGGLQVPGGSLTITCKGSGFDFRNYYMSWVRKQPDKGLEWLCRIPSVPNPWYNPAIAGRFVQTRDNAKATTSLQLNELKLEDSAVYFCTR
Python bivittatus Vs471 ighv AEQU02232938.1 1811 VQSEIQLVESGGDVKRPGESLRLSCQASGDDFSSYYSMYWVRQYPGKGLEWVAAIDYDGEKFYSDKVKGRFTISRDDDNNLMNLQMNSLKPEDTGVYYCTA
Python bivittatus Vs470 ighv AEQU02232467.1 1923 VQSEVQLEESGGDVRRPGDSLRLSCQGSGFTFSSYWMSWVRQYPGKGLEWVADMDAGSSTYYSDKVKGRFTISRDNAKSQLYLQMNNLTPEDTGLYYCTR
Python bivittatus Vs477 iglv AEQU02236561.1 664 IDCQTVWTQPPSSSVSLGGTVTLSCRTTQSSYSICWHQQKSGKAPRYVQCDGYSRGEGIPDRFTATRSGSTGSLAITNTQVEDEADYYCVSPDSAGNQ
Python bivittatus Vs476 iglv AEQU02236561.1 3203 ALAQSTLTQPPSLSASLGETVRITCERTGGSISSNYVSWHQQKPGSSPLTVIYADSSRPSGIPERFSGSVDSSSNSATLSISNIEGEDEAHYYCLVADNSGQ
Python bivittatus Vs197 trav AEQU02222861.1 1063 FPHLVSSQGFQPKQLILMEKDKIVINCAQNLTSADIMHWYKQIGSLLEFLGSSYDGRSVLPSGFTMVVDRESHSSRLTRDKARLKDAGVYFCALK
Python bivittatus Vs478 iglv AEQU02236562.1 3798 IDCQTVWTQPSSISVSLGGTITLPCTTTQSSYNIGWHQQKSGEGPRYVHTSGGYSRGEGIPDRFTATRSGSTGSLAITNAQAEDEADYYCSSWNSAVTV
Python bivittatus Vs468 ighv AEQU02232459.1 999 IQSEVQLVESGGDVKRPGDSLRLSCQGSGFTFSSYGMSWVRQYPGKGLEWVAYISSGSSAIYYSDKVKGRFTISRDNAKSQLYLQMNNLKPEDTGRYYCTR
Python bivittatus Vs469 ighv AEQU02232463.1 2117 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSDYGMNWVRQYPGKGLEWVAYIRYDSSSIYYSDKVNGRFTISRDNAKSQVYLQMNNLKLEDTGRYYCAR
Python bivittatus Vs464 ighv AEQU02231232.1 1829 VQSEVQLMESGGDVRRPGGSLRLSCQASGFTFSSDEMNWVRQAPGKGLEWVAEISTSSSPIRYSDKVKRRFIISRDDFQSQLYLQMNNLKAEDTGLYYCTR
Python bivittatus Vs465 trav AEQU02231789.1 4358 QITGQSVKQTTGTMTVTEGQSVSLSCSYQSTDTFNYPFWYIQQHGQAPKCILQADGEAYQGFQAIHKTGNNKKEGTFNMQKEALQLKDSAVYFCAFR
Python bivittatus Vs467 trav AEQU02231790.1 826 QITGQSLKQTTGTVTVTEGEPVSLNCSYQSTDTFNYPFWYIQQHGQAPKLILQTGGEAYQGFQAIHKTGNNKKDGTFNMQKQGIQLKDSAIYFCAFI
Python bivittatus Vs460 ighv AEQU02226894.1 987 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYSMNWVRQYPEKGLEWVAFINPSSSTIYYSDKVKGRFTISRDNAKSQLYLQMNNLKPEDTGLYYCAR
Python bivittatus Vs461 ighv AEQU02226895.1 344 VQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYSMNWVRQYPEKGLEWVAFINPSSSTIYYSDKVKGRFTISRDNAKSQLYLQMNTLKPEDTGLYYCAG
Python bivittatus Vs462 ighv AEQU02226896.1 724 VQSEVQLVESGGDVRRPGGSLRLSCQASGFDFSSYYMSWVRQYPGKGLEWVAEISNESSDVYYSDKVKGRFTISRDDAKSQLYLQMNNLKAEDTGLYYCAR
Python bivittatus Vs463 ighv AEQU02231232.1 4896 VHSEVQLVESGGDVKRPGESLHLSCQGSGFTFSSYYMTWVRQYPGKGLEWVAYIGTSSSPIYYSDKVKGRFTIFRDDSRSQMFLQINNLKPEDTGLYYCAR
Python bivittatus Vs154 ighv AEQU02180290.1 2852 CHSEVQLVETGGGMVAPEGSLRLTCKASGFTFASHEIHWVRQAPEEGLEWVAGISGAGSSQWYHSKVKGRFTISRDNSQSLALLQMNGLKPEDSALYYCT
Python bivittatus Vs156 ighv AEQU02180295.1 2070 VQSVIKLEESGGDVRRPGDSLSLSCQASGFTFSSYWMRWVRHYPKKGLEWVAEIGTTSSPIRYSDKVKGRFTISRNDSCNQLYLQMNNLKPEDTAVYYCAK
Python bivittatus Vs150 ighv AEQU02180273.1 6904 GLSQVVLTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMAWVRQKPGKGLEWLVSYYKSGTSYYSPTIKGRFTASTDSSNFYLQMNNLNAEDTAVYYCAR
Python bivittatus Vs151 ighv AEQU02180274.1 238 GLSQIVLTQSDPALKKPGEAHKLTCAVTGFNVNSYWMAWIRQKPGKGLEWLVWYYSSGSNYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Python bivittatus Vs152 ighv AEQU02180280.1 1647 GLSQIVLTQSDPMLKKPGEAHKLTCAVTGFDINSYYMDWVRQKPGKGLEWLVSYYSSGRNYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Python bivittatus Vs153 ighv AEQU02180286.1 2590 GLSQIVLTQSDPALKKPGEAHKLTCAVTGFNVNSYWMAWIRQKPGKGLEWLVDYYTSSSNYYSPSIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Python bivittatus Vs493 iglv AEQU02242774.1 2777 IDCQTVWTQAPSSSVSLGGTVTLSCTTTQSSYSIGWYQQKSGEGPRFVHCDGCSRGEGIPDRFTATRSGSTGFLAITNVEAEDEADYFCGSWDSAGNQ
Python bivittatus Vs492 iglv AEQU02241286.1 302 ISQPTLTQPVSQSGSLGETIKLSCAISSSPNYIGWIQQRSGESPRFVHCDGCSNRGPGIPGRFTGTRSGNNGYLTITSLQAEDEAVYYCCMWYSSGSV
Python bivittatus Vs495 ighv AEQU02245990.1 619 VQSEVQLVESGGNVRRPGESLHLSCQASGFDFSSDWMDWMRQAPGKGLEWVANMDAGGSRYYSDKVKGRFTISRDNARSQLYLQMNNLKPEDSAIYYCAG
Python bivittatus Vs494 trav AEQU02245866.1 599 TLPCQAERLAQDPLVEALNGRKHNVSCSHHDIQTSETIFWYRQFPSRPPHLIASGYKGASKSSEVEGVSLVVAVDRKTSNLLFARVTLEDAAVYFCAIG
Python bivittatus Vs497 iglv AEQU02250888.1 401 VTSQPTLTQPVSQSGSLGEIIKLSCATSSSPNYIHWVQQRSGESPRFVHCDSCSNMGPGIPDRFTATRSGNNGYLTISNLQAEDEADYYCFMWYSSGSE
Python bivittatus Vs496 trav AEQU02246293.1 795 QITGQSVKQTTGTVTVTEGQPVSLSCSYESTVTSNYPYWYIQPPGQPPKLLLTEFDHQAQGFEATHVILESKKKGIFNMQKKAIQLKDSAVYFCAFR
Python bivittatus Vs499 ighv AEQU02257212.1 525 VQSEIQLVESGGDVKRPGESLHLSCQASGDDFSSYNMDWVRQYPGKGLEWVAVIDYDGETFYSDKVKGRFTISRDDDNSLLNLQMNSLKPEDTGVYYCTA
Python bivittatus Vs498 ighv AEQU02251315.1 694 VQSEVQLVESEGDVRRPGDSLHLSCQGSGFTFSSYSMHWVRQDPGKGLEWVACITTGSSNTYYSYKVKGQFTISRDDSRSQVYLQRNNLKAEDTGVYYCVR
Python bivittatus Vs129 ighv AEQU02156912.1 1619 VQMEVQLVESGGDIKKPGESLRLSCQGSGFTFSSYEMSWVRQAPGKGLEWVAWIDNNGDGSSQYYANSVKGRFTISRQDASSMAYLQMNNLKLEDTAVYYCARD
Python bivittatus Vs128 ighv AEQU02156911.1 6127 IQSEVQLVDSGGDVRRPGGSLHLSCQGSGFTFSSYSMYWVRQYPGKGLEWVARIDTTTTYYSDKVKGRFTISRDNSKSQLYLQMNNLKPEDTGVYYCAR
Python bivittatus Vs121 ighv AEQU02156895.1 2024 VQSDVQLAESGGDVRRPGGSLHLSCQASGFDFSSKWMDWLRQYPGKGLEWVAEIKYDSSTVRYSDKVKGRFTISRDNSKSQLYLQMNNLKPEDTGVYYCT
Python bivittatus Vs120 ighv AEQU02156892.1 2822 VQSDVQLVESGGDVRRPGDSLRLSCQASGFDFSSYWMAWLRQNPGKGLEWLGEIKHESSSIRYSDKVKGRFTISRDLSKSQLYLQMNQLKPEDTGLYYCGR
Python bivittatus Vs123 ighv AEQU02156898.1 1966 VQSEVQLVESGGDVRRPGDSLRLSCQGSGFDFSKYWMSWVRQYPGKGLDWVAYINQASSSISYSDKVKGRFTISRDNAKSQVYLQMDNLKPEDMGRYYCAS
Python bivittatus Vs125 ighv AEQU02156909.1 219 VQSDVQLVPSGGDIRRPGDSLRLSCQASGFDFSSSWMAWVRQYPGKGLEWVGEINHDSTSISYSDKVKGRFTISRGNSRSQLYLQMSNLKPEDTGVYYCGR
Python bivittatus Vs124 ighv AEQU02156902.1 4178 VQSEIPWVVSGGDVRRPGDSLRLSCQTSGFTFSSYWMAWVRQAPGKGLEWVSTITTGSSSTYYSDKVKGRFTISRDDSRSQLYLQMNNLKAEDTGVYYCT
Python bivittatus Vs127 ighv AEQU02156911.1 2449 IQCEVQLVESGGDVKRPGESLCLSCQASGFTFSSKWMNWVRQYPGKGLEWFGDIKNDSSSIHYSDKVKGQFIISRDNSRSQLYLQMNNLKPEDTGLYYCAR
Python bivittatus Vs126 ighv AEQU02156910.1 263 VQSEIQLVESGGDVRGPGDFLRLSCQGSGFTFSSNWMNWVRQYPGKGAEWVEEIKYDSSTIRYLDKVKGRFTISRDNSKSQLYLEMNNWKPEDTGVYYCVR
Python bivittatus Vs482 iglv AEQU02237415.1 1533 STSQPTVIQESSMSPSLGQTVKLSCSLSSGQVTSYEQVWLQQKEGNSPRFLYGYYSSATAGSGDLSRFSASKESNQNKWYLTISNLQPEDEAGYYCGVW
Python bivittatus Vs483 iglv AEQU02237416.1 523 STSQPTVIQESSMSPSLGQTAKLSCSLSSGQVASYSLSWLQQKEGSPPRLLFYYYSSATAGSGDLSRFSASKESNQNKWYLTISNIQPEDEADYYCGVW
Python bivittatus Vs480 ighv AEQU02237249.1 575 VQSDVQLVESGGDVRRPGDSLSLSCQASGFTFSSYWMNWVRQYPGKGLEWVVQISDTSSSIRYSDKVKGRFTPSRDNSKSQLYLQMSNLNPEDTALYYCV
Python bivittatus Vs481 ighv AEQU02237250.1 2869 VQSDVQLVESGGDVRRPGDSLSLSCQASGFTFSSYWMYWVRQYPGKGLEWVALIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNNLKPEDTGHYYCAR
Python bivittatus Vs486 iglv AEQU02240306.1 706 ALAQSTLTQPPSLSASLGETARITCTKTGGSISSYYVSWYQQKPGSSPLTVIYKHSERPSGIPERFSGSVDSSSNSATLSISNVQGEDEADYYCFTGASSGQ
Python bivittatus Vs487 iglv AEQU02240307.1 845 ALAQFTLTQPPSLSASLGETVTINCKRTGGSISDGYVSWYQQKPGSSPLTVIYLDSERPSGIPERFSGSVDSSSNSATLSISNVQGEDEAVYYCLSYEGSGQ
Python bivittatus Vs484 iglv AEQU02237422.1 448 STSQPTVIQESSMSPSLGQTVKLSCSLSSGQVTSYEQVWLQQKEGNPPRVLYGYATRAAAGSGDLSRFSASKESNQNKWYLTISNIQPEDEADYYCGVW
Python bivittatus Vs488 ighv AEQU02240340.1 772 VQSEVQLVESGGDVRRPGGSLRLSCQASGFTFSSYYMTWVRQYPGKGLEWVAYISYDSSTIYYSDKVKERFTISRDNAKSQLYLQMNNLKPEDTGLYYCAR
Python bivittatus Vs489 ighv AEQU02240344.1 596 VQSEVQLVESGGDVRRPGGSLRLSCQASGFTFSSYWMFWIRQYPGKGLEWVGHIKNDSSAIYYSDKVKGRFTISRDNSKSQLYLQMNNLKPEDTGVYYCV
Python bivittatus Vs398 trav AEQU02174351.1 2096 VSGQTTITQEDQFLSIKEGESIWMNCSYTGTQYNLQWYKQYPGGQPEFMILLASSMTEEKDDFDMSLDTAQKTTSLYLKNTRLKDSAVYFCAL
Python bivittatus Vs399 trav AEQU02174351.1 1531 VRCQEEMDQKPIEVSKEGDDSTIACRFKSSNIYAMHWYRQYAGEAPVFLLKVTSVESKKDDRFSANFDKQKKQSHFNITKVQLKDAAIYFCSTD
Python bivittatus Vs396 trav AEQU02174349.1 309 CGSDAQVTQTPQDLEAQEGGPFSLKCSYSTQYSYYFWYHQIPGARPLLILSISSQGNISKNGFMADYLPNGKESNLFRPRAQLQDVGDYFCAVE
Python bivittatus Vs397 trav AEQU02174351.1 6546 WVSISQVTQTPLYKEVKEGDWVTINCNINTVYSYFHWYRQVPRMPLSYLLSITSSQNITEKGLTAEYLDNGQRSCLHLPSSLLQDSGTYFCGVN
Python bivittatus Vs395 trav AEQU02174347.1 1429 VRCQEQVDQKPVEVSKEGVDCTIACQFSSSTVYAMYWYRQYAGEAPVFLLKVTSVESKKDDHLIADLDKQKKQSHFNITKVQLKDAAVYFCSTD
Python bivittatus Vs88 ighv AEQU02116886.1 335 SFSDVHLGSSGPETVRPGQSLNLLCKVTGVSITSSSCAWSWVCQPPEKGLEWIAGIYPYSGVKSYSSSLQSPTTIASDNSKNVYSLQWNSLSAADTAMYYCA
Python bivittatus Vs234 trav AEQU02239527.1 2082 CRSDAQVTQTPQDLEVHEGGPFSLKCSYSVQYCPYFWYRQLPGAQPVLILSISSQGNISKNGFMADYLLNGKESNLFRPRAQLQDVGDYFCAVE
Python bivittatus Vs237 trav AEQU02241040.1 822 CSLDAQVTQTPQDLEVHEGGPFSLKCSYSAQYRPYFWYHQLPGAQPLLILSISSQGNISKNGFMADFLLNGKESNLFCPRAQLQDVGNYFCAVQ
Python bivittatus Vs236 trav AEQU02240594.1 830 QITGQSVKQITGTITVIEGKPVSLSCSYESTSFGQNYPYWYIQYPGQPLKPFVTQFDKQAQGFQATHISHESKKKGTFRMEKAASQPKESAVYFCAFG
Python bivittatus Vs231 ighv AEQU02236707.1 2063 VQSEVQLVESGGDVRRPGGSLRLSCQSSGFTFSSYVMHWVRQYPGKGLEWVALINPSSSTIYYLDKVKGRFAISRDNAKSQLYLQMNNLKPEDTGRYYCAR
Python bivittatus Vs233 trav AEQU02239475.1 1300 RAKGDSVNQTIHPVTEKEGQNVRLQCKYETAGSPYLFWYQQHPYSSPQLLLASYDSEGHSQKFSAHLDKVEKSFHLIKGSVELRDSAVYFCAL
Python bivittatus Vs132 ighv AEQU02156933.1 3892 VQMEVQLVESGGDIKRPGESLRLSCQGSGFTFSSYEMAWVRQAPGKGLEWVAWINDDGDESNQYYANSVKGRFTISRRDASSMVYLQMNNLKLEDTAVYYCAR
Python bivittatus Vs130 ighv AEQU02156930.1 2959 ALSEVQLVESGGDVRRPGDSLSLSCQASGFAFSTSWMGWVRQFPGKGLEWVAYIHPSSTSTFHSDKVKGCFTISRDNDKSQLYLQMNNLKPEDTSAYYCM
Python bivittatus Vs131 ighv AEQU02156933.1 966 VQMEVQLVESGGDIKRPGESLRLSCQGSGFTFSSYEMIWVRQAPGKGLEWVAWINDNGDDSNQLYANSVKGRFTISRRDASSMVYLQMNNLKPEDTAVYYCARD
Python bivittatus Vs239 ighv AEQU02244249.1 1518 VQSDVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYPMNWVRQYPGKALEWVAFIHTGSSSTYYSDKVKGRFTISRDDSRSQLNLQMDNLKAEDTGVYYCA
Python bivittatus Vs238 ighv AEQU02241929.1 2253 VQSEVQLVESGGDVKRPGDSLRLSCQDSGFTFSYGMYWVRQYPGKGLEWVAYIHPTSPSIYYSDKVKGRFTISRDNAQSQLYLQMNSLKLEDTGRYYCAR
Python bivittatus Vs435 ighv AEQU02208729.1 5763 AEPQKILTQPVSEIKLPGETLTLICKGVSSFHQSWIQWTYRIDNKGLKWIGELNEDGSRSNVRQALRDQFSISRDNSLDTASLQIRQLKVGDSGLYYCS
Python bivittatus Vs434 ighv AEQU02208728.1 9753 IALQITLTESGGGLKKPGETLQLTCRVSGFSITSNGVLWNRQAPGKGLEWNGAIWATGSTAYNSALQNRISITRDTSKNQVFFQLNDLKPEDAGIYYCAR
Python bivittatus Vs432 iglv AEQU02205882.1 1243 ASAQFVLTQPASVSAPVDGKVQISCTRSSGAMNSYYVSWYQQKSNEQPKLLIYQQIYRPADIPDRFSGTIDSSSATLIITGVQPEDEAKYYCQSYDSSWM
Python bivittatus Vs431 iglv AEQU02205881.1 11379 AWGQFVLTQPASLTVAPGGRAVISCTRNSANINKYHVSWYQQKPNTLPKLLIYQHNKRPPGIPERFSGFTDGSSATLTINNVQAEDSADYYCSSYDSGWL
Python bivittatus Vs430 iglv AEQU02205880.1 4505 VNSQPPWIQPASLSVSLGETANISCTVSGRVNNIYWYQQKTGQVPRYVQYSAGGRGAGFPDRFTASVSGNIGYLAISDSQAEDEADYYCAMWQSSASS
Python bivittatus Vs240 ighv AEQU02246590.1 1367 IQSEVQLVESGGDVRRPGGSLRLSCQGSGFTFSSYWMSWVRQYPGKGLEWVAQIGTSSSPIRYSDKVKGRFTISRDDSRSQLFLQMDNLKEEDTGVYYCAR
Python bivittatus Vs242 trav AEQU02273926.1 2571 HSAGDSVEQTTGTVILTEGQPITLNCSYEAGNAGIFSTYWYIQSPGQPLELFLTESENQPQGFQTTHISHESKKKGTFHMEKTASQLKDSAVYFCAFR
Python bivittatus Vs224 ighv AEQU02231108.1 796 IQSEVQLVESGGDVRRPGDSLHLSCQGSGFSFSSYGMSWVRQYPGKGLEWVAVIWYDSSNKYYSDKVKGRFTISRDNAKSQVYLQMNNLKPEDTGRYYCAR
Python bivittatus Vs225 ighv AEQU02231108.1 3776 VQSEVQLEESGGDVRSPGDSLRLSCQASGFTFISYGMHWVRPYPGKGLEWVAVIPSSSSTICYSDKVTGCFTISRDNAKSQLYLQMNNLKPEDMGLYYCAG
Python bivittatus Vs222 iglv AEQU02229949.1 1347 VMCKYTLTQPPPLYASLEQPAKLSCNISSSFYFGDFNWYQQKGGERPRFLLNFNTTSSVTKFGPEASGQFSASTNTPKKIAFLTISSVQAKDEGDYYCEAG
Python bivittatus Vs220 iglv AEQU02229946.1 4400 ITSQPILTQPASQSGSPGETIKLSCAISSSPNYIYWLQQRSGEAPRFVHCDGCSSRGPGIPDRFTGTRSGNNGYLTITNLQAEDDAVYYCSMWYSSGKV
Python bivittatus Vs221 iglv AEQU02229946.1 9077 IISQPTLTQPASQSGSPGETIKLSCAISSSPNYIYWLQQRSGESPRFVHCDGCSRGPGIPDRFTATQSGNNGYLTITNLQAEDEADYFCSMWYSSGSV
Python bivittatus Vs200 iglv AEQU02224260.1 3985 VTSQPTLTQPVSQSGSLGETIQLSCAISSSPNYIGWIQQRSGESPRFVHCDGCNRGPGIPDRFTGTRSGNNGYLTITNLQAEDEATYYCCMWYSSGSV
Python bivittatus Vs168 trav AEQU02197908.1 362 RAKGDSIKQTIHPFSVREAQNVLVQCKYETAGFPYLFWYQQHPYSSPQLLLASVDTEGDSQRFSAKLDRVEKSFNLIKESVELRDSAVYFCAL
Python bivittatus Vs427 iglv AEQU02205876.1 4269 LRSQPTVTQPASASASLGQEAKLSCTVNANVNHVYWFQQKSLGTPHFLHCNGCSSRGSGIPDRFTASRSGNTGYLTITNLNVEDEADYYCNAWFGSASV
Python bivittatus Vs428 iglv AEQU02205876.1 481 VTSQPTLTQPASQSGSPGETIKLSCAISSSPNTVRWLQQRSGESPRFVHCDGCSSRGPGIPDQFTGTRSGNNGYLTITNLQAEDEADYFCFMWYSSGSM
Python bivittatus Vs169 trav AEQU02197914.1 1964 ESAGMTVTQTEGSVTTIQGQPVFLSCTYELTVDYQPSPFWYIQYLGQPPKLFQSTFLISSPDVSLPQNFKALHNKTNKTFNMKKLVSQLNDSAIYICAVS
Python bivittatus Vs466 trav AEQU02231789.1 854 YSAGDSVEQTADTVTLTEGQPVTLNCSYKSKHHPQGNYLFWYIQHPRQPPRIFLWSRWKNPKGFYASHVSYENRKEGTFNMYKPASQLNDSAIYFCVFR
Python bivittatus Vs155 ighv AEQU02180295.1 309 VQSAVQLVESGGDVRRPGDSLRLSCQVSGFTFSSKWMSWLRQDPGKRLEWVARLRYDGAEVNYLDKVKGRFTISWNSANSQLHLQMNSLKPEDTAVYYCAR
Python bivittatus Vs89 ighv AEQU02116891.1 6370 SFSDVQLVSSGPETVRPGQNLNLLCKVTGVSITSSSYAWNWVRQPPEKDLEWIARIYPHDGRKWYSSSLQSHTTIASDNSKNEYSLQLSSLSAADTAMYYCA