WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Camelus dromedarius LSZX00000000.1 (LSZX01) 131 10 34 11 40 24 3 9
Camelus dromedarius JWIN00000000.1 (JWIN01) 113 3 34 8 34 19 3 12
Camelus dromedarius JDVD00000000.1 (JDVD01) 122 3 31 13 38 26 2 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Camelus dromedarius V0 trav LSZX01000530.1 170 SVKAQKVTQDRPAISRPEKEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus dromedarius V1 trav LSZX01001729.1 613 MWSLQKGAAQSLNVPEGATASLTCSYSNSNSQTFMWYRQYSGRGPERLMTFYPNNDKKEGRFTAQVNKSSRYVSLLIRDSQPSDSGAYLCAE
Camelus dromedarius V2 trgv LSZX01025075.1 27813 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDTGIYYCAGWY
Camelus dromedarius V3 trgv LSZX01025075.1 33271 GLMLPQLEQPEVSVTGVRDKSVVLSCKVPSDSFDKDYIHWYQQKPDQGLKQLMYVLTASALGDLGGKKNKLEARKYASISTSTLKISFLKKEDEATYYCALWTS
Camelus dromedarius V4 igkv LSZX01071207.1 564 SSGDFVLTQTPGSLSVTPGEPASISCRSTESLEDSDGDTYLSWFLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISGVKAGDAGVYYCAQA
Camelus dromedarius V5 igkv LSZX01071207.1 5734 ARCAIQMTQSPSSLSASLGDTVTITCQASQSISNELSWYQQKPGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDLATYYCLQDYSWP
Camelus dromedarius V6 igkv LSZX01071208.1 8977 SSGEVVLTQTPGSLSVTPGEPASISCKASQSLVHSDGKTYLYWLLQKPGQPPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQA
Camelus dromedarius V7 igkv LSZX01071209.1 13694 CWGQIALTQFPESLAASHGSLVSITCRSSIEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Camelus dromedarius V8 igkv LSZX01071209.1 18080 ARCATQVTQSPSSLSASLGDTVTITCQASQSISSYLAWYQQKPGQVPKLLIYDASSLYTGVPLRFSGSGSGTSFTLTISGVEAEDVGTYYCQQYNSAP
Camelus dromedarius V9 igkv LSZX01071210.1 4883 SSGATVLTQSPALLSKAPGDKATITCRASQSVSNYLRWYQQKPNQPPKLLIQYASQTISGVPARFIGSGSGTDFTLTISSLEAEDAAKYYCQQSYSSS
Camelus dromedarius V10 igkv LSZX01071210.1 9611 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus dromedarius V11 trdv LSZX01090404.1 21418 KGVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus dromedarius V12 igkv LSZX01113954.1 19535 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKSYLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSFQPEDAAVYYCQQAYSAP
Camelus dromedarius V13 iglv LSZX01114329.1 652 SWAQSVLTQPPSMSGSQGQRVTISCTGSSRNIGGGNGVQWYQQLPGMAPKLLIYENSNRSSGVPDGFSGSKSGSSASLTITGFQAEDEADYYCGCYDNSVSA
Camelus dromedarius V14 iglv LSZX01114330.1 7078 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRHSGVPSRFSGSISGNKAALTITGAQPEDEAEYYCAL
Camelus dromedarius V15 iglv LSZX01114331.1 231 VVSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPGWIQQTPGQVPRTLIYSTSSCPSGIPSRFAGTISGNKATLTITGAQPEDEADYYCALYPGSYP
Camelus dromedarius V16 iglv LSZX01114332.1 5275 LDSQTVVTQKLSLSVSPGGTVTLTCGLSSGSVTTSNNPGWIQQTSGQALHTLIYRTSSCLSGVPSCFSGSISGNKTALTITGAQPEDEADYYCAVYKGSGS
Camelus dromedarius V17 iglv LSZX01114333.1 1196 SLSQPVLTQPPSLSASPGDSARLTCTLSSGTVVGGYHINWFQKKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGT
Camelus dromedarius V18 iglv LSZX01114333.1 4645 SWAQSVLTQPPSVSGSLGQRATICTGSSSNIGHGNYVNWYQQLPGTCPRLLIYHVKNRASGVPDPFSGSKSGNSASLSITGLQAEDEADYYCADWDNSLS
Camelus dromedarius V19 iglv LSZX01114334.1 1765 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQKPGQSLRTLIYSTNSHHSGVPNRFSGSISGNKAALTITGAQPEDEANYYCAL
Camelus dromedarius V20 iglv LSZX01114334.1 7265 SWAQSVLTQPPSVSGSLSQRVTISCTGSSSNIGGNYVNWYQHLPGTAPKLLIYDNSNRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus dromedarius V21 iglv LSZX01114334.1 21942 SWAQSVLTQPPSVSGSPGQRVIISCTGSSSNIGGGYSVQWYKQLPGTAPILLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEANYYCGCYDSSLS
Camelus dromedarius V22 iglv LSZX01114335.1 10200 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTVPKLLIYNANNRASRVPNRFSGSKSGSLAFLTITGLQAEDEADYYCGCYDSSLSA
Camelus dromedarius V23 iglv LSZX01134584.1 10225 SWAQSALTQPPSVSGTPGQTVTISCAGTSSDVGYGSYVSWYKQLPGTAPKLLIYEDSNAATVIPDRFSSSKSGNTASLTISGLQSEDEADYYCASYRND
Camelus dromedarius V24 iglv LSZX01134584.1 32492 YAASSALTQPSAVSVSLGETARITCQGGNIGSNYANWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSGYN
Camelus dromedarius V25 trgv LSZX01137245.1 8651 DQEEVRLVQPALVMARTRGSTTLPCRTYGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNNDGRSCFLSLMKLEKADEGTYYCAAWD
Camelus dromedarius V27 trav LSZX01137338.1 4413 TLGDAKTTQPTSMESTEEEPVALPCDHATISGNEYIYWYRQIPHQGPEYLIHGLKNNVTNNMASLSIAIDRKSSSLVLPQVTLRDSAVYYCALRE
Camelus dromedarius V28 trbv LSZX01138311.1 6469 ALDTGVFQMPKYLITQMGSKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus dromedarius V29 trbv LSZX01138312.1 4548 LVDSGVTQTPRHLIKARGQQVTLSCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYFCASSL
Camelus dromedarius V30 trbv LSZX01138312.1 8063 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQFLIQYYRQKETERGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Camelus dromedarius V31 trbv LSZX01138312.1 11934 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHDYMYWYRQDPGHGLRLIHYSAGSGTTNKGDIPDGYSVSRSDVENFTLKLESATPNQTSVYLCASSY
Camelus dromedarius V32 trbv LSZX01138312.1 14314 HTEAGISQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQTLGQGLEILTLFQNKDAVDTSGMPDARFSAKRPQGLSSTLEIQRVEPGDLAVYLCASSL
Camelus dromedarius V33 trbv LSZX01138312.1 17328 PTDAEITQTPRYRIVSTGHKTVLECSQHMNHFGMFWYQQDPGQGPRLIHYSNDIGSTAEGEVTEGYRVSRPEKAHFPLTLESASTNQTSLYLCASSV
Camelus dromedarius V34 trbv LSZX01138312.1 22443 PLEAGVTQTPRHLIKTTGQMVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSRSELNVSSLQLSDSALYLCASSL
Camelus dromedarius V35 trbv LSZX01138312.1 29381 HTKAGVSQSPRHRVTGRGQNVTLMCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLKIQRVEPGDSAEYLCASSL
Camelus dromedarius V36 trbv LSZX01138313.1 3950 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYYTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSAYLCASSN
Camelus dromedarius V37 trbv LSZX01138314.1 4171 LTEGGVAQSPRHKITEERQAVALWCDPISGHSFLYWYRQTLEQDLELLILFEETAGINVLQSPKNRFSAERPSGANSTLKIQSAELGDSAVYLCASSL
Camelus dromedarius V38 trbv LSZX01138314.1 25863 TVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKQLLYYYNTQLNRETDTSDNFQSSRLNTSSCSLDIRSAGVGDSAVYLCASSR
Camelus dromedarius V39 trbv LSZX01138315.1 1981 FLEAEVTQTPGHLVKGKGQKAEMYCVPKKGHSYVYWYQQIPAKEFKFLISFQNNNEFDKTGMPKERFSAVCYQNSSCTLKIQPAALQDSAVYLCASSE
Camelus dromedarius V40 trbv LSZX01138332.1 175 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDTMYWYRQDPGQRPRLIYFSLSAKDVQKGDMAEGYGASREKKPLFPLTVTLTQKNQTAVYLCASSI
Camelus dromedarius V41 trbv LSZX01138332.1 3197 SGLGAQVSQHPSRAIRERGASVTFQCRAEDFQATIMFWYRQFPEQGLTLIATSNQGSNATYEQGFTKDKFPINHPSLTFSSLAVTSVSPADSSLYFCSAS
Camelus dromedarius V42 trbv LSZX01138334.1 2237 SMDTGVTQSPGHLVREKEQRAKMDCVPKEGHNYVYWYRKKLEEAFEFLVYLRNGGDIMEEAEGFKQRFSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus dromedarius V43 trbv LSZX01138334.1 8493 GSVDTGVTQSPGHLVRGKEQRAKMHCVPIKGHIFVFWYRKKLEEAFEFLVYLRNEDIVEKIAGFEQRYSAKCPKNSPCSLEINSTQAGDSAQYFCASSE
Camelus dromedarius V44 trbv LSZX01138335.1 1775 SMDTGVTQSPGHLVREKEQRAKMYCVPKEGHAYVYWYRKKLEEAFEFLVYLQNEDIVEKIAGFEQRYSAKCPKNSPCSLEINSTQAGDSAQYFCASSE
Camelus dromedarius V45 trbv LSZX01138335.1 16304 SMDTGVTQTPRNRITNTGNSVLLECFQTKGHNYMYWYRQDPGLGLRLIYASYNVNDTNKGELSNGYRVSRAEKAKFFLFLETPVPNQTALYFCASSY
Camelus dromedarius V46 trbv LSZX01138336.1 4155 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSHGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Camelus dromedarius V47 trbv LSZX01138337.1 2359 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQRDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSE
Camelus dromedarius V48 trbv LSZX01138340.1 3133 PVEADVTQSPTHRITETRKKLTVTCSQNMNHEAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKEKKDFSLTLESASITQTSLYLCASSV
Camelus dromedarius V49 trbv LSZX01138340.1 11487 LMDAKVTQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDPALGLQLLHYSYDVDIVEKGDMPEGYNVSRKKKERFALTLESASTSQTSVYLCASSI
Camelus dromedarius V50 trbv LSZX01138341.1 5043 SAFGALVSQKPSRAICQHGVSVMIQCEADSQVISMYWYRQRPGQSLSLIATANQGSQATYESGFDKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Camelus dromedarius V51 trav LSZX01145346.1 1118 VNGQQLKQIPEFVPLQEGENFTTYCNTTSTIDSLQWYKQQPGGRPVFLMLLTKGGDVKRPERLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus dromedarius V52 trdv LSZX01145352.1 734 SAVAQTVTQDQPAVSSHVGETATLNCRYETSWSYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSINFRKAEKSLSLSISNLQLEDSAKYFCALRE
Camelus dromedarius V53 trdv LSZX01145353.1 334 SAVAQTVTQDQPAVSSHVGETVTLNCRYETSWSYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSINFRKAEKSLSLSISNLQLEDSAKYFCALRE
Camelus dromedarius V54 trav LSZX01145354.1 5445 LRVQMKVEQSPGVLTLQEGEHSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Camelus dromedarius V55 trdv LSZX01145354.1 14114 SGMAAKVTQTQTTETAQEGQAVTMHCTYETTAQRYTLYWYKQGPSGRMAFLIYQDDNKASAKRDRYSVNFQKANQSISLTISSSQLADSGKYFCALWR
Camelus dromedarius V56 ighv LSZX01147228.1 4482 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSRGSTHYADSMKGRFTISRDNAKNVLYLQMNSLKPEDTVVYYCAR
Camelus dromedarius V57 trdv LSZX01151991.1 3787 SGVAQTVTQEQPAVSSHVGETATLNCRYETSYTEYYIFWYKQPPSGEMTFLIEQYSSSRNAKNGRYSVNFRKAEKSLSLTISYLQLEDSAKYFCALRE
Camelus dromedarius V58 ighv LSZX01153228.1 293 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSTINSAGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCVR
Camelus dromedarius V59 trav LSZX01000015.1 2909 MWSRQKGAAQSLNVPEGATASLTCSYSNSNSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLHIRDSQPSDSAAYLCAES
Camelus dromedarius V60 trav LSZX01000522.1 5411 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSAFLFWYVQYLNKEPELLLKSSSENQKVVRGGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALR
Camelus dromedarius V61 trav LSZX01000524.1 6537 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDPYLFWYVQYVNKAPQLLLKGSAANPRPEHQGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALR
Camelus dromedarius V62 trav LSZX01000524.1 972 GTSGDSVTQTEVPVTLSEEASVFLNCIYQTIESNHYLFWYVQYVNKAPQLLLKGSAANPRPEHQGFQATLVKSNRTFHLQKSSVQTSDSAVYYCALS
Camelus dromedarius V63 trav LSZX01002982.1 538 GAAAQSVTQPDRHGITVPEGARLELRCNYSSSYQPTPFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFEAEFRRNETSFHLKKTSAHWSDSAEYFCSLS
Camelus dromedarius V65 igkv LSZX01071209.1 24728 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVLSSSNQKSYLNWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQGYSA
Camelus dromedarius V67 igkv LSZX01071210.1 14783 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVLSSSNQKSYLNWYQQRPGQSPRLLIYYASTRESGIPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Camelus dromedarius V68 trdv LSZX01090417.1 37673 VSLGIILEPETKTLTVPLGGPATFRCNVTGGDLGSYQMSWYKKNEDQSLTSVYRQGNNATDGARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Camelus dromedarius V69 trdv LSZX01090417.1 17274 IMSADVLVPQDAAVTVSVGGSVTLRCSMKGGPISDYYNYWYRKIPGSTMTFVFREGGTYGPGFQENFRGEVDQVNNQVLLEILKASEGDKGSYYCAAT
Camelus dromedarius V70 trav LSZX01090423.1 14990 GTSSNSVQQTSQVTVSEGTSVTMNCTYTSAGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNIKDKSSPITIYPAQIADSAVYYCLLRLTVPR
Camelus dromedarius V71 trav LSZX01090423.1 11031 ISGENEVEQSPPYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPRDSAVYICAV
Camelus dromedarius V72 trdv LSZX01090424.1 16164 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDYYLFWYKQPPSGETIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAAMYFCA
Camelus dromedarius V73 trav LSZX01090424.1 2122 LNAEVNVEQSLPSLSIQEGEDCTVYCNYSSGTSDRLHWYRQDLGKSLEFLFLLTSGAVKQEGQLTASLDTKARRSTLHITASQPSFSATYFCALD
Camelus dromedarius V74 trav LSZX01090425.1 11414 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLYWYKQEEKGLAFLFVLVSTGIEKKSGRLRGTLDKKELLRTLHITATEPEDSATYLCAVE
Camelus dromedarius V75 trav LSZX01090425.1 6488 PGRADWIRPQETEVSGTEGKTVSLLCNYDTSSMGPVDLYWFRQYPNQAPEYILHRGWRHSGKGYASFATERFYSENTANTTSLYIRRVVLADAALYHCALNSE
Camelus dromedarius V76 iglv LSZX01093187.1 4912 SWAQSVLTQPPSMSGSLGQRVTISCTGSSSNIGGGYGVQWFQQLPGTAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQADDEADYYCGRYDNSLSG
Camelus dromedarius V77 iglv LSZX01093188.1 7118 SLSQPVLTQPSSLSVSLGASARLTCTLSSGFKVGDFWIRWHQQKPGNPPRYLLTFHSDSDKHQGSGVPSRVSGSSDASANAGLLLISGLQPEDEADYYCAT
Camelus dromedarius V78 ighv LSZX01094241.1 15918 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSSIYTGGGSTYYADSVKGRFTISKDNAKNTLYLQMNSLKPEDTAVYYCAR
Camelus dromedarius V79 igkv LSZX01113954.1 11983 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLISGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN
Camelus dromedarius V80 trav LSZX01115849.1 5293 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V81 trav LSZX01115849.1 985 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALT
Camelus dromedarius V82 trav LSZX01115850.1 5725 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V83 trav LSZX01115851.1 6709 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus dromedarius V84 trav LSZX01115852.1 4847 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V85 trav LSZX01115853.1 4011 VSQGENVKQSPPSLSVQEGNSSVITCTYTDSNSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V86 trav LSZX01115855.1 2606 RTHGDSVMQTEGPVTLSETAALTINCSYSTTTYPTLFWYVQYSGEGPQLLLKASRDKEKVLKKGFEAMHHREQTSFHLEKASVQGADSAVYYCALT
Camelus dromedarius V87 ighv LSZX01116427.1 477 VQADVQLVESGGGSVQAGGSLRLSCAASGYTYSSYCMGWFRQAPGKEREGVAAINSGGGSTYYADSVKGRFTISRDNAKNTVYLQLNSLKTEDTAMYYCAK
Camelus dromedarius V88 trav LSZX01117767.1 9756 TVIEAAIEQPKSKDFTEGEDVTLHCNHSTIGLKDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALTE
Camelus dromedarius V89 trav LSZX01117767.1 4258 VTGEDVEQSPPVLSLQEGATSTLWCKFSSSVTSLRWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Camelus dromedarius V90 trav LSZX01117768.1 4474 VNGQQLKQIPEFVPLQEGENFTTYCNTSSSLTSLQWYKQQPGGRPVFLMTLTKSGDVTRQGRLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus dromedarius V91 trav LSZX01117770.1 28378 TVIEAEIDQPKSKDFAEGEDVNLPCNHSTVGGNDYIHWYRQRPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALTE
Camelus dromedarius V92 trdv LSZX01117770.1 5766 SAVAQTVTQDQPALSSHLGESATLNCQYETSYTEYYIFWYKQPPSGEMTFLIQQYSSSGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALEE
Camelus dromedarius V93 trav LSZX01125514.1 2234 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSASSFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V94 trav LSZX01125515.1 6774 GVRGMNVEQSPSALSIQEGTSSTLQCNFSNPVNYVQWFRQNPGGGLINLFYITLGMKQNGRLNSTLNSKEQYSTLHITASQLEDSATYLCAAE
Camelus dromedarius V95 trav LSZX01125516.1 6366 GSNEDSVSQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNEMASNKGFKATYHRKPNSFHLEKASVRGADSAVYYCALG
Camelus dromedarius V96 trav LSZX01125516.1 1168 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFESEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus dromedarius V97 trav LSZX01125517.1 3672 GAGAQSVTQPDRHGITVPEGARLELRCNYSSSYPPSLFWYVWYPNQGLQLLLKYTSGNNLVSGIKGFVAEFRRNETSFHLKKTSAHWSDSAEYFCAVG
Camelus dromedarius V98 trav LSZX01125518.1 2595 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATSEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Camelus dromedarius V99 trav LSZX01125519.1 2378 GLRAQSATQLKEPITGAEGEPLTVKCAYSLSGTPYRFWYVQYPSQGLQFLLKYVAGDNLVKGNYGFEAEFNKSQTSFHLKKASVQGSDSALYFCAVT
Camelus dromedarius V100 trav LSZX01125521.1 32553 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELHTEDSASYLCAVI
Camelus dromedarius V101 iglv LSZX01125923.1 4996 SVTSYELTQQASVSVDLQQMARITCSGDLLDKKYTQWYQQKPGQAPVLVIYKDSERHSGIPERFSGSSSGKTATLTISGSQGDDEADYYCQSYDSSDN
Camelus dromedarius V102 iglv LSZX01125925.1 6034 SVASSAVAQPSAVSVSLGQTASITCQFGSLGSYYAHWLQQKPGQAPVLVIYNDNSRPSGIPERFSGSRSGDTATLTISGAQAEDEADYYCQVWDSSGYN
Camelus dromedarius V103 iglv LSZX01125926.1 3387 SVASSALTQPSAVSVSLGQTARITCQGGILGSSYAYWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSRSGGTATLTISGAQAEDEADYYCQSYDSSSY
Camelus dromedarius V104 iglv LSZX01125928.1 982 SWAQSALTQPPLVSGTPEQMVTISCAGASSDVGYGNYVSWYQQLPGTAPKLLIYDVSSRSSGIPNHFSGSKSGNMASLTISGLQSEDEADYYCASYGSSYN
Camelus dromedarius V105 ighv LSZX01126105.1 1187 VQAQVQLVESGGGSVQAGGSLRLSCAASGYTYCSYDMSWYRQAPGKEREFVSAIDSDGSTSYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCNT
Camelus dromedarius V106 trbv LSZX01134879.1 18954 VRAQTIHQRPPTVVQPMGSSLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSFSADQVDSEEPQNFEASVSQDGSFILSSKKLLLNNSGFYLCAWS
Camelus dromedarius V107 ighv LSZX01136486.1 349 VQAQVQLVESGGGSVQAGGSLRLSCAASGYTYCSYDMSWYRQAPGKEREFVSAIDSDGSTSYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCNT
Camelus dromedarius V108 trav LSZX01138450.1 1459 MWSRQKGAAQSLNVPEGATASLTCSYSNSNSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLHIRDSQPSDSAAYLCAES
Camelus dromedarius V109 trav LSZX01138451.1 6685 IVIEAEIDQPKSKDFAEGEDVNLPCNHSTIGVSDYIHWYRQRPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALRE
Camelus dromedarius V110 trav LSZX01138451.1 2660 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus dromedarius V111 iglv LSZX01138643.1 2952 YAASSALTQPSAVSVSLGETARITCQGGNIGSYYASWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSGYN
Camelus dromedarius V112 ighv LSZX01140891.1 882 VQAQVQLVESGGGSVQAGGSLRLSCAASGYTYSSNCMGWFRQAPGKEREGVAAIYTGGGSTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAA
Camelus dromedarius V113 iglv LSZX01142993.1 593 YVASSALTQPSAVSVSLGETARITCQGGNFGSYYASWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSGSSSAN
Camelus dromedarius V114 ighv LSZX01143549.1 521 VQAQVQLVESGGGSVQAGGSLRLSCAASGYTYCSYDMSWYRQAPGKEREFVSAIDSDGSTSYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCKT
Camelus dromedarius V115 trav LSZX01146183.1 358 VQAQVQLVESGGGSVQAGGSLKLSCAASGYIFSSCGMGWYRQAPGKERELVSTISSDGSTSYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAVYFCAA
Camelus dromedarius V116 iglv LSZX01146987.1 21411 SWAPSVLTQPPSMSGSPGQRATISCTGSSSNIGRGNYVEWYQQLPGKAPKLLIYDVNNRASGVPNRFSGSKSGNSVSLTITGLQAEDKADYYCEDWDNSLNG
Camelus dromedarius V117 iglv LSZX01146987.1 15639 VDSQTVVIQNSSLTLSPGETVTLTCGPSSGSVTTSNYPSWYQQTPGQAPQVLSIAEAAEGPQSGVPSRLSGSISGIKATLTTTEALPKDKADYYCALYPGS
Camelus dromedarius V118 iglv LSZX01146987.1 5173 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSRFFGSISGNKAALTIMGAQPKDEADYYCALDMGSGS
Camelus dromedarius V119 iglv LSZX01146988.1 4112 VNSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQAPSTLIYRTSNRLSGVPSRFSGSISGNKAALTITGAQPEDEADYYCAVYMGSGS
Camelus dromedarius V120 ighv LSZX01147228.1 18340 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSGIYSDGSNTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDTALYYCAT
Camelus dromedarius V121 iglv LSZX01150094.1 30633 YVAPSALTQPSTASMSLGQTAKITCQGGSLRSYYAHWYQQKPGLAPVLVIYKDSNRPSGIPERFSGSRSGGTATLTISRTQAEDEADYYCLSADSSDYN
Camelus dromedarius V122 iglv LSZX01150094.1 25998 SVASYELTQSPSVSVALRQTAKITCGGDNIGSKSVHWYQQKPGQAPVLVIYDDNSRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSSAN
Camelus dromedarius V123 iglv LSZX01150094.1 11767 SWAQSALTQPPSVSRTPGQTVTISCAGTSNDVGRYIYVSWYQQLPGTAPKLLIYEDTSRVSEIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V124 iglv LSZX01150094.1 5790 SWAQSALTQPSSVSGTPGQTVTISCTGTSNDVGGYNYVSWYQQLPGTAPKLLIYQVNKRASGIPDRFSGSKSGNTASMTISGLQSADEADYYCASYRSSYN
Camelus dromedarius V125 iglv LSZX01150094.1 1055 SVASSALTQPSTVSVSLGQTARITCKVDSLGSYAAQWYQQKPGQAPVLVIYGNSNRPSGIPERFSGSKSGGTATLTISGAQAEDEADYYCQSGSSNAN
Camelus dromedarius V126 iglv LSZX01150095.1 15131 SWAQSALTQPPSVSGTLGKMVTISCVGTSSDTGGYNYISWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSRSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V127 iglv LSZX01150095.1 10213 SWAQSALTQPPSVSGTLGKTVTISCAGTSSDVGYRNYVSWYQQLPGTAPKLLIYAVSYRASGISDRFSGSKPGNTASLTISGLQSEDEADYYCASYRSSNN
Camelus dromedarius V128 ighv LSZX01154050.1 695 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSGINSDGSNTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDTALYYCVR
Camelus dromedarius V129 trav LSZX01155326.1 6893 GTSGDSVTQTEVPVTLPEEALLILNCTYQSTYSDAYLFWYVQYVNKAPQLLLKGSAANPRPEHQGFQATLVKSNRTFHLQKPSVQTSDSAVYYCALS
Camelus dromedarius V130 trav LSZX01155326.1 730 RTSGDSVTQTEVPVTLPEEASVFLNCIYQTISSNLYLFWYVQYVNRAPQLLLKGSTANPRPEHQGFQATLVKSNRTFHLQKPSVQTSDSAVYYCALS
Camelus dromedarius V131 iglv LSZX01158307.1 9778 VNSQTVVTQEPSLSVSPGGTVTLTCGLSTGSVTSSNYPSWYQQTPGQSPQLLIYKTNSRHSGVPNRFSGSISGNKAALTITGAQPEYEDDYYCALYMGSGS
Camelus dromedarius V132 iglv LSZX01160281.1 4557 TVAQARLTQPQSVTASPGQTATLTCTGDSHSVGNEGAAWLQQHPGQAPRLLTLRNNQRPSGVSERFSGSRSGSMASLSISGLQAEDEADYYCSAWDSSLSA
Camelus dromedarius V133 iglv LSZX01160282.1 12598 SLAQPVLTQPPSLSGSLGSSARLTCTLSSGNNVGGYTVYWYQQNAGSPPRYLVYYYSDSSKHQGSGVPSCFSGSKDASANTGLLLISGLQPEDEADYYCGT
Camelus dromedarius V0 trav JWIN01006659.1 4276 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALT
Camelus dromedarius V1 trav JWIN01007708.1 585 VQAQVQLVESGGGSVQAGGSLKLSCAASGYIFSSCGMGWYRQAPGKERELVSTISSDGSTSYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAVYFCAA
Camelus dromedarius V2 iglv JWIN01012345.1 530 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRHSGVPSRFSGSISGNKAALTITGAQPEYEDDYYCALYMGSGS
Camelus dromedarius V3 trav JWIN01013264.1 759 GTSGDSVTQTEVPVTLPEEALLILNCTYQTIDSDPYLFWYVQYVNRAPQLLLKGSTANPRPEHQGFQATLVKSSRTFHLQKPSVQMSDSAVYYCALR
Camelus dromedarius V4 trav JWIN01016068.1 61 GTSGDSVTQTEVPVTLPEEASVFLNCIYQTAGSNPYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFHATLDKSNRTFHLQKPSVQTSDSAVYYCALS
Camelus dromedarius V5 ighv JWIN01030055.1 54512 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSRGSTHYADSMKGRFTISRDNAKNVLYLQMNSLKPEDTVVYYCAR
Camelus dromedarius V6 ighv JWIN01030375.1 5292 VQAQVQLVESGGGSVQAGGSLRLSCAASGYTYSSNCMGWFRQAPGKEREGVAAIYTGGGSTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAA
Camelus dromedarius V8 trav JWIN01031997.1 11537 SVKAQKVTQDQPAISRPEKEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus dromedarius V9 trav JWIN01031997.1 23562 VTGEDVEQSPPVLSLQEGAASTLWCKSSSSVTSVHWYHQNPGGRLIHLFSVASGTKHDGRFSATTVAKERRSILNISSSQTTDSATYFCAVEHSAPR
Camelus dromedarius V10 trdv JWIN01031997.1 32036 SGVAQTVTQDQPAISSHVGETVTLNCRYETSDSIYYIFWYKQPPSGEMTFLIHQGSSSGNANRGRYSVNFRKAEKALSLTISNLLLKDSAKYFCALRE
Camelus dromedarius V12 trdv JWIN01032054.1 286088 KGVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus dromedarius V13 trdv JWIN01032164.1 11401 SAVAQTVTQDQPAVSSHVWETVTLNCRYETSYSTYYIFWYKQPPSGEMTFLIRQGSSSGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALRE
Camelus dromedarius V14 iglv JWIN01032824.1 1210396 SLSQPVLTQPSSLSVSLGASARLTCTLSSGFKVGDFWIRWHQQKPGNPPRYLLTFHSDSDKHQGSGVPSRVSGSSDASANAGLLLISGLQPEDEADYYCAT
Camelus dromedarius V15 iglv JWIN01032824.1 1221365 SWAQSVLTQPPSMSGSLGQRVTISCTGSSSNIGGGYGVQWFQQLPGTAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQADDEADYYCGRYDNSLSG
Camelus dromedarius V16 trav JWIN01032891.1 334 IVIEAEIDQPKSKDFAEGEDVNLPCNHSTIGVSDYIHWYRQKPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALRE
Camelus dromedarius V17 trav JWIN01032935.1 2370 RTRGDSVTQTEGPVTLPESAALTMNCSYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHREQTSFHLEKASVRGADSAVYYCAMT
Camelus dromedarius V19 trav JWIN01033407.1 518910 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELRTEDSASYLCAVI
Camelus dromedarius V20 trav JWIN01033407.1 564546 GLRAQSATQLKEPITGAEGEPLTVKCAYSLSGTPYRFWYVQYPSQGLQFLLKYVAGDNLVKGNYGFEAEFNKSQTSFHLKKASVQGSDSALYFCAVT
Camelus dromedarius V21 trav JWIN01033407.1 570483 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATSEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Camelus dromedarius V22 trav JWIN01033407.1 581632 GSNEDSVSQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNEMASNKGFKATYHRKPNSFHLEKASVRGADSALYYCALG
Camelus dromedarius V23 trav JWIN01033407.1 586831 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFESEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus dromedarius V24 trav JWIN01033407.1 596548 GVRGMNVEQSPSALSIQEGTSSTLQCNFSNPVNYVQWFRQNPGGGLINLFYITLGMKQNGRLNSTLNSKEQYSTLHITASQLEDSATYLCAAE
Camelus dromedarius V25 trav JWIN01033407.1 607917 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDISDPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V26 trav JWIN01033407.1 614383 RTHGDSVMQTEGPVTLSETAALTINCSYSTTTYPTLFWYVQYSGEGPQLLLKASRDKEKVLKKGFEAMHHREQTSFHLEKASVQGADSAVYYCALT
Camelus dromedarius V27 trav JWIN01033407.1 621718 VSQGENVKQSPPSLSVQEGNSSVITCTYTDSNSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDTAVYFCAAS
Camelus dromedarius V29 trdv JWIN01033629.1 26560 SAVAQTVTQDQPALSSHLGESATLNCQYETSYTEYYIFWYKQPPSGEMTFLIQQYSSSGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALEE
Camelus dromedarius V30 trav JWIN01033629.1 37907 VNGQQLKQIPEFVPLQEGENFTTYCNTTSSLNSLQWYKQQPGGRPVFLMILTKGGDVKRQGRLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus dromedarius V31 trav JWIN01033629.1 42217 TVIEAAIEQPKSKDFTEGEDVTLHCNHSTIGLKDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALTE
Camelus dromedarius V32 trav JWIN01033629.1 47714 VTGEDVEQSPPVLSLQEGATSTLWCKFSSSVTSLCWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNSSSSQTTDSATYFCAVSTVLP
Camelus dromedarius V33 trdv JWIN01033629.1 56278 SAVAQTVTQDQPAVSSHVGETVTLNCQYETSYSTYYIFWYKQPPSGEMTFLIRQEYNRGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALDE
Camelus dromedarius V34 igkv JWIN01034013.1 1936347 SSGDVVLTQTPGSLSVTPGEPASISCRSTESLEDSDGDTYLSWFLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSETDFTLKISGVKAEDAGVYYCAHSL
Camelus dromedarius V35 igkv JWIN01034013.1 1941509 ARCAIQRTQSPSSLSASLGDTVTITCQASQSISNELSWYQQKPGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDLATYYCLQDYSWP
Camelus dromedarius V36 igkv JWIN01034013.1 1967231 CWGQIALTQFPESLAASHGSLVSITCRSSIEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Camelus dromedarius V37 igkv JWIN01034013.1 1971609 ARCATQVTQSPSSLSASLGDTVTITCQASQSISSYLAWYQQKPGQVPKLLIYDASSLYTGVPLRFSGSGSGTSFTLTISGVEAEDVGTYYCQQYNSAP
Camelus dromedarius V38 igkv JWIN01034013.1 1984327 SSGATVLTQSPALLSKAPGDKATITCRASQSVSNYLRWYQQKPNQPPKLLIQYASQTISGVPARFIGSGSGTDFTLTISSLEAEDAAKYYCQQSYSSS
Camelus dromedarius V39 igkv JWIN01034013.1 1989054 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus dromedarius V40 igkv JWIN01034013.1 2013674 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLIFGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN
Camelus dromedarius V41 ighv JWIN01034167.1 6104 VQADVQLVESGGGLVQAGGSLRLSCAASGFTYSSCCMSWYRQAPGKERELVSSISSDGSTYYADSVRGRFTISKGNAKNTLYLQMNSLKPEDTAVYYCAA
Camelus dromedarius V42 trbv JWIN01034703.1 177744 VRAQTIHQRPPTVVQPMGSSLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSFSADQVDSEEPQNFEASVSQDGSFILSSKKLLLNNSGFYLCAWS
Camelus dromedarius V43 trav JWIN01034735.1 4758 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus dromedarius V44 trav JWIN01034735.1 17132 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSEYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V45 iglv JWIN01034848.1 12569 SWAQSALTQPPSVSGTLGKMVTISCVGTSSDTGGYNYISWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSRSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V46 iglv JWIN01034848.1 17487 SWAQSALTQPPSVSGTLGKTVTISCAGTSSDVGYRNYVSWYQQLPGTAPKLLIYAVSYRASGISDRFSGSKPGNTASLTISGLQSEDEADYYCASYRSSNN
Camelus dromedarius V47 iglv JWIN01034848.1 29274 YVAPSALTQPSTASMSLGQTAKITCQGGSLRSYYAHWYQQKPGLAPVLVIYKDSNRPSGIPERFSGSRSGGTATLTISRTQAEDEADYYCLSADSSDYN
Camelus dromedarius V48 iglv JWIN01034848.1 33909 SVASYELTQSPSVSVALRQTAKITCGGDNIGSKSVHWYQQKPGQAPVLVIYDDNSRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSSAN
Camelus dromedarius V49 iglv JWIN01034848.1 48140 SWAQSALTQPPSVSRTPGQTVTISCAGTSNDVGRYIYVSWYQQLPGTAPKLLIYEDTSRVSEIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V50 iglv JWIN01034848.1 54117 SWAQSALTQPSSVSGTPGQTVTISCTGTSNDVGGYNYVSWYQQLPGTAPKLLIYQVNKRASGIPDRFSGSKSGNTASMTISGLQSADEADYYCASYRSSYN
Camelus dromedarius V51 iglv JWIN01034848.1 58852 SVASSALTQPSTVSVSLGQTARITCKVDSLGSYAAQWYQQKPGQAPVLVIYGNSNRPSGIPERFSGSKSGGTATLTISGAQAEDEADYYCQSGSSNAN
Camelus dromedarius V54 trav JWIN01035350.1 6918 MWSRQKGAAQSLNVPEGATASLTCSYSNSNSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLHIRDSQPSDSAAYLCAES
Camelus dromedarius V55 iglv JWIN01035738.1 24948 SLAQPVLTQPPSLSGSLGSSARLTCTLSSGNNVGGYTVYWYQQNAGSPPRYLVYYYSDSSKHQGSGVPSCFSGSKDASANTGLLLISGLQPEDEADYYCGT
Camelus dromedarius V56 iglv JWIN01035738.1 41888 TVAQARLTQPQSVTASPGQTATLTCTGDSHSVGNEGAAWLQQHPGQAPRLLTLRNNQRPSGVSERFSGSRSGSMASLSISGLQAEDEADYYCSAWDSSLSA
Camelus dromedarius V57 iglv JWIN01035749.1 2219 VNSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQAPSTLIYRTSNRLSGVPSRFSGSISGNKAALTITGAQPEDEADYYCAVYMGSGS
Camelus dromedarius V58 iglv JWIN01035749.1 9380 SWAPSVLTQPPSMSGSPGQRATISCTGSSSNIGRGNYVEWYQQLPGKAPKLLIYDVNNRASGVPNRFSGSKSGNSVSLTITGLQAEDKADYYCEDWDNSLNG
Camelus dromedarius V59 iglv JWIN01035749.1 15152 VDSQTVVIQNSSLTLSPGETVTLTCGPSSGSVTTSNYPSWYQQTPGQAPQVLSIAEAAEGPQSGVPSRLSGSISGIKATLTTTEALPKDKADYYCALYPGS
Camelus dromedarius V60 iglv JWIN01035749.1 25610 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSRFFGSISGNKAALTIMGAQPKDEADYYCALDMGSGS
Camelus dromedarius V61 iglv JWIN01035749.1 35323 SWAQSVLTQPPSMSGSQGQRVTISCTGSSRNIGGGNGVQWYQQLPGMAPKLLIYENSNRSSGVPDGFSGSKSGSSASLTITGLQAEDEADYYCGCYDNSVSA
Camelus dromedarius V62 iglv JWIN01035749.1 43166 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRHSGVPSRFSGSISGNKAALTITGAQPEDEAEYYCAL
Camelus dromedarius V63 iglv JWIN01035749.1 52581 VVSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPGWIQQTPGQVPRTLIYSTSSRPSGIPSRFAGTISGNKATLTITGAQPEDEADYYCALYPGSYP
Camelus dromedarius V64 iglv JWIN01035749.1 66453 LDSQTVVTQKPSLSVSPGGTVTLTCGLSSGSVTTSNNPGWIQQTSGQALHTLIYRTSSCLSGVPSCFSGSISGNKTALTITGAQPEDEADYYCAVYKGSGS
Camelus dromedarius V65 iglv JWIN01035749.1 75043 SLSQPVLTQPPSLSASPGDSARLTCTLSSGTVVGGYHINWFQKKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGT
Camelus dromedarius V66 iglv JWIN01035749.1 78581 SWAQSVLTQPPSVSGSLGQRATICTGSSSNIGHGNYVNWYQQLPGTCPRLLIYHVKNRASGVPDPFSGSKSGNSASLSITGLQAEDEADYYCADWDNSLS
Camelus dromedarius V67 iglv JWIN01035749.1 85528 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQKPGQSLRTLIYSTNSHHSGVPNRFSGSISGNKAALTITGAQPEDEANYYCAL
Camelus dromedarius V68 iglv JWIN01035749.1 91027 SWAQSVLTQPPSVSGSLSQRVTISCTGSSSNIGGNYVNWYQHLPGTAPKLLIYDNSNRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus dromedarius V69 iglv JWIN01035749.1 105707 SWAQSVLTQPPSVSGSPGQRVIISCTGSSSNIGGGYSVQWYKQLPGTAPILLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEANYYCGCYDSSLS
Camelus dromedarius V70 iglv JWIN01035749.1 116572 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTVPKLLIYNANNRASRVPNRFSGSKSGSLAFLTITGLQAEDEADYYCGCYDSSLSA
Camelus dromedarius V71 iglv JWIN01035749.1 175785 SWAQSALTQPPLVSGTPEQMVTISCAGASSDVGYGNYVSWYQQLPGTAPKLLIYDVSSRSSGIPNHFSGSKSGNMASLTISGLQSEDEADYYCASYGSSYN
Camelus dromedarius V72 iglv JWIN01035749.1 180607 SVASSALTQPSAVSVSLGQTARITCQGGILGSSYAYWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSRSGGTATLTISGAQAEDEADYYCQSYDSSSY
Camelus dromedarius V73 iglv JWIN01035749.1 184240 SVASSAVAQPSAVSVSLGQTASITCQFGSLGSYYAHWLQQKPGQAPVLVIYNDNSRPSGIPERFSGSRSGDTATLTISGAQAEDEADYYCQVWDSSGYN
Camelus dromedarius V74 trav JWIN01001657.1 935 GAGAQSVTQPEDHVSVFARAPVQVKCNYSYPGSPVLFWYVQYPKQSLQLLLKHISKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCAVS
Camelus dromedarius V75 trgv JWIN01005686.1 7543 DQEEVRLVQPALVMARTRGSTTLPCRTYGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNNDGRSCFLSLMKLEKADEGTYYCAAWD
Camelus dromedarius V76 trav JWIN01014964.1 6223 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSAFLFWYVQYLNKEPELLLKSSSENQKVVRGGFQATLVKSSRTFHLQKASVQTSDSAVYYCALS
Camelus dromedarius V77 trav JWIN01014964.1 802 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDPYLFWYVQYVNKAPQLLLKGSAANPRPEHQGFQATLVKSSRTFHLQKPSVQMSDSAVYYCALR
Camelus dromedarius V78 iglv JWIN01024227.1 1528 SVTSYELTQQASVSVDLQQMARITCSGDLLDKKYTQWYQQKPGQAPVLVIYKDSERHSGIPERFSGSSSGKTATLTISGSQGDDEADYYCQSYDSSDN
Camelus dromedarius V79 trav JWIN01026744.1 952 GAAAQSVTQPDRHGITVPEGARLELRCNYSSSYPPTLFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFEAEFRRNETSFHLKKTSAHWSDSAEYFCALS
Camelus dromedarius V80 iglv JWIN01028207.1 816 YVASSALTQPSAVSVSLGETARITCQGGNVGSYYASWYQQKPGQAPVLVIYEDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSVN
Camelus dromedarius V83 trgv JWIN01031009.1 38818 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDTGIYYCAGWY
Camelus dromedarius V84 trgv JWIN01031009.1 33360 GLMLPQLEQPEVSVTGVRDKSVVLSCKVPSDSFDKDYIHWYQQKPDQGLKQLMYVLTASALGDLGGKKNKLEARKYASISTSTLKISFLKKEDEATYYCALWIS
Camelus dromedarius V85 trdv JWIN01032054.1 547375 SAVAQTVTQDQPAVSSHVGETATLNCRYETSWSYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSINFRKAEKSLSLSISNLQLEDSAKYFCALWE
Camelus dromedarius V86 trav JWIN01032054.1 526915 LRVQMKVEQSPGVLTLQEGEHSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Camelus dromedarius V87 trdv JWIN01032054.1 518246 SGMAAKVTQTQTTETAQEGQAVTMHCTYETSALRYTLYWYKQGPSGGMAFLIYQDDNKANAKRDRYSVNFQKAKQSISLTISSSQLADSGKYFCALWD
Camelus dromedarius V88 trav JWIN01032054.1 509555 TLGDAKTTQPTSMESTEEEPVALPCDHATISGNEYIYWYRQIPHQGPEYLIHGLKNNVTNNMASLSIAIDRKSSSLVLPQVTLRDSAVYYCALRE
Camelus dromedarius V89 trdv JWIN01032054.1 503653 SGMAAKVTQTQTTETAQEGQAVTMHCTYETSALRYTLYWYKQGPSGGMAFLIYQDDNKANAKRDRYSVNFQKAKQSISLTISSSQLADSGKYFCALWD
Camelus dromedarius V90 trav JWIN01032054.1 495877 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLYWYKQEEKGLAFLFVLVSTGIEKKSGRLRGTLDKKELLRTLHITATEPEDSATYLCAVE
Camelus dromedarius V91 trav JWIN01032054.1 490944 PGRADWIRPQETEVSGTEGKTVSLLCNYDTSSMGPVDLYWFRQYPNQAPEYILHRGWRHSGKGYASFATERFYSENTANTTSLYIRRVVLADAALYHCALNSE
Camelus dromedarius V92 trdv JWIN01032054.1 472450 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDYYLFWYKQPPSGETIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAAMYFCA
Camelus dromedarius V93 trav JWIN01032054.1 458405 LNAEVNVEQSPPSLSIQEGEDCTVYCNYSSGTSDRLHWYRQDLGKSLEFLFLLTSGAVKQEGQLTASLDTKARRSTLHITASQPSFSATYFCALD
Camelus dromedarius V94 trav JWIN01032054.1 445632 GTSSNSVQQTSQVTVSEGTSVTMNCTYTSAGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNIKDKSSPITIYPAQIADSAVYYCLLRLTVPR
Camelus dromedarius V95 trav JWIN01032054.1 441673 ISGENEVEQSPPYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPRDSAVYICAV
Camelus dromedarius V96 trdv JWIN01032054.1 381456 VSLGIILEPETKTLTVPLGGPATFRCNVTGGDLGSYQMSWYKKNEDQSLTSVYRQGNNATEEARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Camelus dromedarius V97 trdv JWIN01032054.1 361048 IMSADVLVPQDAAVTVSVGGSVTLRCSMKGGPISDYYNYWYRKIPGSTMTFVFREGGTYGPGFQENFRGEVDQVNNQVLLEILKASEGDKGSYYCAAT
Camelus dromedarius V98 trdv JWIN01033346.1 10915 SGVAQTVTQDQPAISSHVGESATLNCRYETSYSTYNIVWYKQPPSGEMTFLIHQGSSSGNAKSGRYSINFRKAEKSLSLTISNLQLEDSAKYFCAFDG
Camelus dromedarius V100 trbv JWIN01033489.1 109075 ALDTGVFQMPKYLITQMGSKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus dromedarius V101 trbv JWIN01033489.1 99823 LVDSGVTQTPRHLIKARGQQVTLSCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYFCASSL
Camelus dromedarius V102 trbv JWIN01033489.1 96308 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQFLIQYYRQKETERGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Camelus dromedarius V103 trbv JWIN01033489.1 92437 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHDYMYWYRQDPGHGLRLIHYSAGSGTTNKGDIPDGYSVSRSDVENFTLKLESATPNQTSVYLCASSY
Camelus dromedarius V104 trbv JWIN01033489.1 90097 HTEAGISQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQTLGQGLEILTLFQNKDAVDTSGMPDARFSAKRPQGLSSTLEIQRVEPGDSAVYLCASSL
Camelus dromedarius V105 trbv JWIN01033489.1 87088 PTDAEITQTPRYRIVSTGHKTVLECSQHMNHFGMFWYQQDPGQGPRLIHYSNDIGSTAEGEVTEGYRVSRPEKAHFPLTLESASTNQTSLYLCASSV
Camelus dromedarius V106 trbv JWIN01033489.1 81929 PLEAGVTQTPRHLIKTTGQMVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSRSELNVSSLQLSDSALYLCASSL
Camelus dromedarius V107 trbv JWIN01033489.1 74993 HTKAGVSQSPRHRVTGRGQNVTLMCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLKIQRVEPGDSAEYLCASSL
Camelus dromedarius V108 trbv JWIN01033489.1 66868 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYYTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSAYLCASSN
Camelus dromedarius V109 trbv JWIN01033489.1 61535 LTEGGVAQSPRHKITEERQAVALWCDPISGHSFLYWYRQTLEQDLELLILFEETAGINVLQSPKNRFSAERPSGANSTLKIQSAELGDSAVYLCASSLAIALQ
Camelus dromedarius V110 trbv JWIN01033489.1 39848 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKLLLYYYITELNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAMYLCASSR
Camelus dromedarius V111 trbv JWIN01033489.1 35307 FLEAEVTQTPGHLVKGTGQKAEMYCVPRKGHNYVCWYQQIPAKEFKFLISFQNNNELDKTGMPKERFSAVCYQNSSCTLKIQPAALQDSAVYLCASSE
Camelus dromedarius V112 trbv JWIN01033489.1 18123 SGLGAQVSQHPSRAIRERGASVTFQCRAEDFQATIMFWYRQFPEQGLTLIATSNQGSNATYEQGFTKDKFPINHPSLTFSSLAVTSVSPADSSLYFCSAS
Camelus dromedarius V113 iglv JWIN01033679.1 7555 YVASSALTQPSAVSVSLGETARITCQGGNFGSYYASWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSVN
Camelus dromedarius V114 igkv JWIN01034013.1 2006120 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKSYLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSFQPEDAAVYYCQQAYSAP
Camelus dromedarius V118 trbv JWIN01034703.1 256834 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSRGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSTYFCASSE
Camelus dromedarius V119 trbv JWIN01034703.1 250728 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQGDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSE
Camelus dromedarius V120 trbv JWIN01034703.1 245381 PVEADVTQSPTHRITETRKKLTVTCSQNMNHEAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKEKKDFSLTLESASITQTSLYLCASSV
Camelus dromedarius V121 trbv JWIN01034703.1 237027 LMDAKVTQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDPALGLQLLHYSYDVDIVEKGDMPEGYNVSRKKKERFALTLESASTSQTSVYLCASSI
Camelus dromedarius V122 trbv JWIN01034703.1 231090 SAFGALVSQKPSRAICQHGVSVMIQCEADSQVISMYWYRQRPGQSLSLIATANQGSQATYESGFDKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Camelus dromedarius V124 iglv JWIN01035101.1 38349 SWAQSALTQPPSVSGTPGQTVTISCAGTSSDVGYGSYVSWYKQLPGTAPKLLIYEDSNAATVIPDRFSSSKSGNTASLTISGLQSEDEADYYCASYRND
Camelus dromedarius V125 iglv JWIN01035101.1 15502 YVASSALTQPSAVSVSLGETARITCQGGNIGSNYANWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSGYN
Camelus dromedarius V98 trgv JDVD01018249.1 140451 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDMGIYYCAGWY
Camelus dromedarius V99 trgv JDVD01018249.1 145910 GLMLPQLEQPEVSVTGVRDKSVVLSCKVPSDSFDKDYIHWYQQKPDQGLKQLMYVLTASALGDLGGKKNKLEARKYASISTSTLKISFLKKEDEATYYCALWIS
Camelus dromedarius V118 trav JDVD01022907.1 21331 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Camelus dromedarius V201 iglv JDVD01036415.1 5443 YVAPSALTQPSTASMSLGQTAKITCQGGSLRSYYAHWYQQKPGLAPVLVIYKDSNRPSGIPERFSGSRSGGTATLTISRTQAEDEADYYCLSADSSDYN
Camelus dromedarius V202 iglv JDVD01036415.1 10078 SVASYELTQSPSVSVALRQTAKITCGGDNIGSKSVHWYQQKPGQAPVLVIYDDNSRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSSAN
Camelus dromedarius V203 iglv JDVD01036415.1 24255 SWAQSALTQPPSVSRTPGQTVTISCAGTSNDVGRYIYVSWYQQLPGTAPKLLIYEDTSRVSEIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V204 iglv JDVD01036415.1 30232 SWAQSALTQPSSVSGTPGQTVTISCTGTSNDVGGYNYVSWYQQLPGTAPKLLIYQVNKRASGIPDRFSGSKSGNTASMTISGLQSADEADYYCASYRSSYN
Camelus dromedarius V205 iglv JDVD01036415.1 34968 SVASSALTQPSTVSVSLGQTARITCKVDSLGSYAAQWYQQKPGQAPVLVIYGNSNRPSGIPERFSGSKSGGTATLTISGAQAEDEADYYCQSGSSNAN
Camelus dromedarius V223 ighv JDVD01039925.1 142 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSSIYTGGGSTYYADSVKGRFTISKDNAKNTLYLQMNSLKPEDTAVYYCAT
Camelus dromedarius V233 trav JDVD01041855.1 17371 LRVQMKVEQSPGVLTLQEGEHSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Camelus dromedarius V234 trdv JDVD01041855.1 26132 SGMAAKVTQTQTTETAQEGQAVTMHCTYETTAQRYTLYWYKQGPSGRMAFLIYQDDNKASAKRDRYSVNFQKANQSISLTISSSQLADSGKYFCALWR
Camelus dromedarius V235 trav JDVD01041855.1 34771 TLGDAKTTQPTSMESTEEEPVALPCDHATISGNEYIYWYRQIPHQGPEYLIHGLKNNVTNNMASLSIAIDRKSSSLVLPQVTLRDSAVYYCALRE
Camelus dromedarius V236 trdv JDVD01041855.1 40673 SGMAAKVTQTQTTETAQEGQAVTMHCTYETSALRYTLYWYKQGPSGGMAFLIYQDDNKANAKRDRYSVNFQKAKQSISLTISSSQLADSGKYFCALWD
Camelus dromedarius V237 trav JDVD01041856.1 3316 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLYWYKQEEKGLAFLFVLVSTGIEKKSGRLRGTLDKKELLRTLHITATEPEDSATYLCAVE
Camelus dromedarius V238 trav JDVD01041856.1 8239 PGRADWIRPQETEVSGTEGKTVSLLCNYDTSSMGPVDLYWFRQYPNQAPEYILHRGWRHSGKGYASFATERFYSENTANTTSLYIRRVVLADAALYHCALNSE
Camelus dromedarius V239 trdv JDVD01041857.1 2926 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDYYLFWYKQPPSGETIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAAMYFCA
Camelus dromedarius V240 trav JDVD01041857.1 16963 LNAEVNVEQSPPSLSIQEGEDCTVYCNYSSGTSDRLHWYRQDLGKSLEFLFLLTSGAVKQEGQLTASLDTKARRSTLHITASQPSFSATYFCALD
Camelus dromedarius V241 trav JDVD01041857.1 29741 GTSSNSVQQTSQVTVSEGTSVTMNCTYTSAGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNIKDKSSPITIYPAQIADSAVYYCLLRLTVPR
Camelus dromedarius V242 trav JDVD01041857.1 33700 ISGENEVEQSPPYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPRDSAVYICAV
Camelus dromedarius V243 trdv JDVD01041859.1 3461 VSLGIILEPETKTLTVPLGGPATFRCNVTGGDLGSYQMSWYKKNEDQSLTSVYRQGNNATEEARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Camelus dromedarius V244 trdv JDVD01041860.1 8499 IMSADVLVPQDAAVTVSVGGSVTLRCSMKGGPISDYYNYWYRKIPGSTMTFVFREGGTYGPGFQENFRGEVDQVNNQVLLEILKASEGDKGSYYCAAT
Camelus dromedarius V252 trbv JDVD01042950.1 7596 ALDTGVFQMPKYLITQMGSKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus dromedarius V253 trbv JDVD01042950.1 17024 PVDSGVTQTPRHLIKARGQQVTLSCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYFCASSL
Camelus dromedarius V254 trbv JDVD01042950.1 20539 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQFLIQYYRQKETERGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Camelus dromedarius V255 trbv JDVD01042950.1 24418 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHDYMYWYRQDPGHGLRLIHYSAGSGTTNKGDIPDGYSVSRSDVENFTLKLEYATPNQTSVYLCASSY
Camelus dromedarius V256 trbv JDVD01042950.1 26759 HTEAGISQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQTLGQGLEILTLFQNKDAVDTSGMPDARFSAKRPQGLSSTLEIQRVEPGDSAVYLCASSL
Camelus dromedarius V257 trbv JDVD01042950.1 29775 PTDAEITQTPRYRIVSTGHKTVLECSQHMNHFGMFWYQQDPGQGPGLIHYSNDIGSTAEGEVTEGYRVSRPEKAHFPLTLESASTNQTSLYLCASSV
Camelus dromedarius V258 trbv JDVD01042950.1 34929 PLEAGVTQTPRHLIKTTGQMVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSRSELNVSSLQLSDSALYLCASSL
Camelus dromedarius V259 trbv JDVD01042950.1 41867 HTKAGVSQSPRHRVTGRGQNVTLMCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLKIQRVEPGDSAEYLCASSL
Camelus dromedarius V260 trbv JDVD01042950.1 49990 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYYTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSAYLCASSN
Camelus dromedarius V261 trbv JDVD01042951.1 4218 LTEGGVAQSPRHKITEERQAVALWCDPISGHSFLYWYRQTLEQDLELLILFEETAGINVLQSPKNRFSAERPSGANSTLKIQSAELGDSAVYLCASSL
Camelus dromedarius V262 trbv JDVD01042951.1 25936 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKQLLYYYNTQLNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAVYLCASSR
Camelus dromedarius V263 trbv JDVD01042951.1 27496 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKQLLYYYNTQLNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAVYLCASSR
Camelus dromedarius V264 trbv JDVD01042951.1 32008 FLEAEVTQTPGHLVKGTGQKAEMYCVPRKGHNYVCWYQQIPAKEFKFLISFQNNNELDKTGMPKERFSAVCYQNSSCTLKIQPAALQDSAVYLCASSE
Camelus dromedarius V265 trbv JDVD01042953.1 4445 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDTMYWYRQDPGQRPRLIYFSLSAKDVQKGDMAEGYSASREKKPLFPLTVTLTQKNQTAVYLCASSI
Camelus dromedarius V266 trbv JDVD01042954.1 704 SGLGAQVSQHPSRAIRERGASVTFQCRAEDFQATIMFWYRQFPEQGLTLIATSNQGSNATYEQGFTKDKFPINHPSLTFSSLTVTSVSPADSSLYFCSAS
Camelus dromedarius V267 trbv JDVD01042955.1 1153 STDTGVTQSPGHLVREKEQRAKMDCVPKEGHNYVYWYRKKLEEAFEFLVYLRNGGDIMEEAEGFKQRFSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus dromedarius V336 trav JDVD01056086.1 8396 VTGEDVEQSPPVLILQEGATSTLWCKFSSSVTSVHWYHQNPGGRLIHLFYVASGTKHDGRFSATTVAKERRSSLNISSSQTTDSATYFCAVSTVLP
Camelus dromedarius V358 igkv JDVD01061871.1 30736 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSFQPEDAAVYYCQQAYSAP
Camelus dromedarius V359 igkv JDVD01061871.1 42550 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVFSSSSQKSLLAWHQQRPGQSPRRLIYYASTRASGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Camelus dromedarius V360 igkv JDVD01061872.1 227 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKSYLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQGYSA
Camelus dromedarius V361 igkv JDVD01061872.1 16329 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVLSSSNQKSYLNWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Camelus dromedarius V373 trdv JDVD01065004.1 2497 SAVAQTVTQDQPALSSHLGESATLNCQYETSYTEYYIFWYKQPPSGEMTFLIQQYSSSGNAKSGRYSVNFRKAEKSHSLTISNLKLEDSAKYFCALEE
Camelus dromedarius V374 trav JDVD01065005.1 12380 TVIEAAIEQPKSKDFTEGEDVTLHCNHSTIGLKDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALTE
Camelus dromedarius V375 trav JDVD01065006.1 763 VTGEDVEQSPPVLSLQEGATSTLWCKFSSSVTSLCWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Camelus dromedarius V376 trdv JDVD01065006.1 9134 SGVAQTVTQEQPAVSSHVGETATLNCRYETSYTEYYIFWYKQPPSGEMTFLIRQEYNRGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALEE
Camelus dromedarius V377 trav JDVD01065006.1 19825 VNGQQLKQIPEFVPLQEGENFTTYCNTSSPLDSLQWYKQQPGGRPVFLMLLTKGGDVKRPERLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus dromedarius V383 trav JDVD01067704.1 13057 IVIEAEIDQPKSKDFAEGEDVNLPCNHSTIGVSDYIHWYRQKPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALRE
Camelus dromedarius V384 trav JDVD01067705.1 3589 RTRGDSVTQTEGPVTLPESAALTMNCSYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHREQSSFHLEKASVRGADSAVYYCALG
Camelus dromedarius V390 iglv JDVD01071215.1 1857 SWAQSALTQPPLVSRTPGQTFTISCAGTSSDAGSGNYVSWYQQVPRTAPKLLIYEVNKRASGIPDRFSGSKSGNMASLTISGLQSEDEADYYCASYRND
Camelus dromedarius V391 iglv JDVD01071215.1 4674 SWAQSALTQPPLVSGTPEQMVTISCAGASSDVGYGNYVSWYQQLPGTAPKLLIYDVSSRSSGIPNHFSGSKSGNMASLTISGLQSEDEADYYCASYGSSYN
Camelus dromedarius V392 iglv JDVD01071215.1 13087 SVASSAVTQPSAVSVSLGQTASITCQFGSLGSYYAHWLQQKPGQAPVLVIYNDNSRPSGIPERFSGSRSGDTATLTISGAQAEDEADYYCQVWDSSGYN
Camelus dromedarius V393 iglv JDVD01071215.1 21937 SVTSYELTQQASVSVDLQQMARITCSGDLLDKKYTQWYQQKPGQAPVLVIYKDSERHSGIPERFSGSSSGKTATLTISGSQGDDEADYYCQSYDSSDN
Camelus dromedarius V394 iglv JDVD01071333.1 5653 YVASSALTQPSAVSVSLGETARITCQGGNFGSYYASWYQQKPGQAPVLVIYRNSNRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSGSSSAN
Camelus dromedarius V398 iglv JDVD01074293.1 1843 SWAQSALTQPPSVSGTLGKMVTISCVGTSSDTGGYNYISWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSRSGNTASLTISGLQSEDEADYFCASYTTS
Camelus dromedarius V399 iglv JDVD01074293.1 6753 SWAQSALTQPPSVSGTLGKTVTISCAGTSSDVGYRNYVSWYQQLPGTAPKLLIYAVSYRASGISDRFSGSKPGNTASLTISGLQSEDEADYYCASYRSSNN
Camelus dromedarius V400 iglv JDVD01074330.1 1769 SWAQSVLTQPPSVSGSPGQRVIISCTGSSSNIGGGYSVQWYKQLPGTAPILLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEANYYCGCYDSSLS
Camelus dromedarius V401 iglv JDVD01074331.1 9787 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTVPKLLIYNANNRASRVPNRFSGSKSGSLAFLTITGLQAEDEADYYCGCYDSSLSA
Camelus dromedarius V404 trbv JDVD01077907.1 1892 SMDTGVTQTPQNRITNTGNSVLLECFQTKGHNYMYWYRQDPGLGLRLIYSSYNVNDTNKGELSNGYRVSRAEKAKFFLFLETPVPNQTALYFCASSY
Camelus dromedarius V405 trdv JDVD01079086.1 1259 SAVAQTVTQDQPAVSSHVWETVTLNCRYETSYSTYYIFWYKQPPSGEMTFLIHQGSSSGNANRGRYSVNFRKAEKALSLTISNLLLKDSAKYFCALRE
Camelus dromedarius V407 trbv JDVD01104457.1 654 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKQLLYYYNTQLNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAVYLCASSR
Camelus dromedarius V519 trbv JDVD01018938.1 23261 SAFGALVSQKPSRAICQHGVSVMIQCEADSQVISMYWYRQRPGQSLSLIATANQGSQATYESGFAKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Camelus dromedarius V520 trbv JDVD01018939.1 14529 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQGDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSE
Camelus dromedarius V521 trbv JDVD01018939.1 9180 PVEADVTQSPTHRITETRKKLTVTCSQNMNHEAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKEKKDFSLTLESASITQTSLYLCASSV
Camelus dromedarius V522 trbv JDVD01018939.1 788 LMDAKVTQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDPALGLQLLHYSYDVDIVEKGDMPEGYNVSRKKKERFALTLESASTSQTSVYLCASSI
Camelus dromedarius V523 trbv JDVD01018940.1 12244 SVDTGVTQSPGHLVREKEQRAKMDCVPKEGHNYVYWYRKKLEGAFEFLVYLRNGGDIVEEAEGFKQRFSAKCPKNSPCSLEIQSSEPGDSALYFCARSQ
Camelus dromedarius V524 trbv JDVD01018940.1 1952 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSHGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Camelus dromedarius V525 trbv JDVD01018941.1 598 SVDTGVTQSPGHLVREKEQRAKMYCVPKEGHAYVYWYRKKLEEAFEFLVYLRNEDIVEKIAGFEQRYSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus dromedarius V631 trdv JDVD01041860.1 83371 KGVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus dromedarius V639 trav JDVD01043750.1 43020 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V640 trav JDVD01043750.1 37900 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHVEKASVRGADSAVYYCALG
Camelus dromedarius V641 trav JDVD01043750.1 25592 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSEYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V642 trav JDVD01043750.1 19918 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDISDPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V643 trav JDVD01043750.1 15610 RTRGDSVTQTEGPVTLPESAALTMNCSYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALT
Camelus dromedarius V644 trav JDVD01043750.1 5765 MWSLQKGAAQSLNVPEGATASLTCSYSNSNSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLHIRDSQPSDSAAYLCAES
Camelus dromedarius V645 trav JDVD01043750.1 946 GAGAQSVTQPEDHVSVFARAPVQVKCNYSYPGSPALFWYVQYPKQSLQLLLKHISKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCAVS
Camelus dromedarius V646 trav JDVD01043751.1 59700 GLRAQSATQLKEPITGAEGEPLTVKCAYSLSGTPYRFWYVQYPSQGLQFLLKYVAGDNLVKGNYGFEAEFNKSQTSFHLKKASVQGSDSALYFCAVT
Camelus dromedarius V647 trav JDVD01043751.1 53761 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATSEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Camelus dromedarius V648 trav JDVD01043751.1 47748 GAGAQSVTQPDRHGITVPEGARLELRCNYSSSYPPSLFWYVWYPNQGLQLLLKYTSGNNLVSGIKGFVAEFRRNETSFHLKKTSAHWSDSAEYFCALS
Camelus dromedarius V649 trav JDVD01043751.1 42485 GSNEDSVSQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNEMASNKGFKATYHRKPNSFHLEKASVRGADSALYYCALG
Camelus dromedarius V650 trav JDVD01043751.1 37286 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFESEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus dromedarius V651 trav JDVD01043751.1 27545 GVRGMNVEQSPSALSIQEGTSSTLQCNFSNPVNYVQWFRQNPGGGLINLFYITLGMKQNGRLNSTLNSKEQYSTLHITASQLEDSATYLCAAE
Camelus dromedarius V652 trav JDVD01043751.1 20876 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSEYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus dromedarius V653 trav JDVD01043751.1 16250 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDISDPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus dromedarius V654 trav JDVD01043751.1 9785 RTHGDSVMQTEGPVTLSETAALTINCSYSTTTYPTLFWYVQYSGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVQGADSAVYYCALT
Camelus dromedarius V655 trav JDVD01043751.1 2455 VSQGENVKQSPPSLSVQEGNSSVITCTYTDSRSEYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDTAVYFCAAS
Camelus dromedarius V656 trav JDVD01043752.1 26670 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELRTEDSASYLCAVI
Camelus dromedarius V658 ighv JDVD01043995.1 13577 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSRGSTHYADSMKGRFTISRDNAKNVLYLQMNSLKPEDTVVYYCAR
Camelus dromedarius V666 iglv JDVD01045214.1 49702 VVSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPGWIQQTPGQVPRTLIYSTSSCPSGIPSRFAGTISGNKATLTITGAQPEDEADYYCALYPGSYP
Camelus dromedarius V667 iglv JDVD01045214.1 35946 LDSQTVVTQKLSLSVSPGGTVTLTCGLSSGSVTTSNNPGWIQQTSGQALHTLIYRTSSCLSGVPSCFSGSISGNKTALTITGAQPEDEADYYCAVYKGSGS
Camelus dromedarius V668 iglv JDVD01045214.1 27311 SLSQPVLTQPPSLSASPGDSARLTCTLSSGTVVGGYHINWFQKKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGT
Camelus dromedarius V669 iglv JDVD01045214.1 23862 SWAQSVLTQPPSVSGSLGQRATICTGSSSNIGHGNYVNWYQQLPGTCPRLLIYHVKNRASGVPDPFSGSKSGNSASLSITGLQAEDEADYYCADWDNSLS
Camelus dromedarius V670 iglv JDVD01045214.1 16999 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQKPGQSLRTLIYSTNSHHSGVPNRFSGSISGNKAALTITGAQPEDEANYYCAL
Camelus dromedarius V671 iglv JDVD01045214.1 11499 SWAQSVLTQPPSVSGSLSQRVTISCTGSSSNIGGNYVNWYQHLPGTAPKLLIYDNSNRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus dromedarius V672 iglv JDVD01045215.1 6937 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRHSGVPSRFSGSISGNKAALTITGAQPEDEAEYYCAL
Camelus dromedarius V673 iglv JDVD01045216.1 43726 TVAQARLTQPQSVTASPGQTATLTCTGDSHSVGNEGAAWLQQHPGQAPRLLTLRNNQRPSGVSERFSGSRSGSMASLSISGLQAEDEADYYCSAWDSSLSA
Camelus dromedarius V674 iglv JDVD01045216.1 34036 VNSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQAPSTLIYRTSNRLSGVPSRFSGSISGNKAALTITGAQPEDEADYYCAVYMGSGS
Camelus dromedarius V675 iglv JDVD01045216.1 26875 SWAPSVLTQPPSMSGSPGQRATISCTGSSSNIGRGNYVEWYQQLPGKAPKLLIYDVNNRASGVPNRFSGSKSGNSVSLTITGLQAEDKADYYCEDWDNSLNG
Camelus dromedarius V676 iglv JDVD01045216.1 21102 VDSQTVVIQNSSLTLSPGETVTLTCGPSSGSVTTSNYPSWYQQTPGQAPQVLSIAEAAEGPQSGVPSRLSGSISGIKATLTTTEALPKDKADYYCALYPGS
Camelus dromedarius V677 iglv JDVD01045216.1 10636 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSRFFGSISGNKAALTIMGAQPKDEADYYCALDMGSGS
Camelus dromedarius V678 iglv JDVD01045217.1 7942 SLAQPVLTQPPSLSGSLGSSARLTCTLSSGNNVGGYTVYWYQQNAGSPPRYLVYYYSDSSKHQGSGVPSCFSGSKDASANTGLLLISGLQPEDEADYYCGT
Camelus dromedarius V688 iglv JDVD01047762.1 4204 VNSQTVVTQEPSLSVSPGGTVTLTCGLSTGSVTSSNYPSWYQQTPGQSPQLLIYKTNSRHSGVPNRFSGSISGNKAALTITGAQPEYEDDYYCALYMGSGS
Camelus dromedarius V689 iglv JDVD01047763.1 21452 SLSQPVLTQPSSLSVSLGASARLTCTLSSGFKVGDFWIRWHQQKPGNPPRYLLTFHSDSDKHQGSGVPSRVSGSSDASANAGLLLISGLQPEDEADYYCAT
Camelus dromedarius V690 iglv JDVD01047763.1 10520 SWAQSVLTQPPSMSGSLGQRVTISCTGSSSNIGGGYGVQWFQQLPGTAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQADDEADYYCGRYDNSLSG
Camelus dromedarius V705 iglv JDVD01050016.1 581 SWAQSALTQPPSVSGTPGQTVTISCAGTSSDVGYGSYVSWYKQLPGTAPKLLIYEDSNAATVIPDRFSSSKSGNTASLTISGLQSEDEADYYCASYRND
Camelus dromedarius V745 ighv JDVD01058271.1 5040 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSAISWSGDSTNYADSVKGQFTISRDNAKNTLYLQMNSLKPEDTAVYYCAK
Camelus dromedarius V760 igkv JDVD01061871.1 39229 ARCATQMTQSPSSLSASLGDTVTITCQASQSISSYLAWHQQKPGQAPKLLIYGASSLHTGVPSRFSGSGSGTSFTLTISGVEAEDVGTYYCLQHNSYP
Camelus dromedarius V761 igkv JDVD01061871.1 23185 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLISGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN
Camelus dromedarius V762 igkv JDVD01061872.1 29282 CWGQIALTQFPESLAASHGSLVSITCRSSIEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Camelus dromedarius V763 igkv JDVD01061872.1 22976 ARCATQVTQSPSSLSASLGDTVTITCQASQSISSYLAWYQQKPGQVPKLLIYDASSLYTGVPLRFSGSGSGTSFTLTISGVEAEDVGTYYCQQYNSAP
Camelus dromedarius V764 igkv JDVD01061872.1 10127 SSGATVLTQSPALLSKAPGDKATITCRASQSVSNYLRWYQQKPNQPPKLLIQYASQTISGVPARFIGSGSGTDFTLTISSLEAEDAAKYYCQQSYSSS
Camelus dromedarius V765 igkv JDVD01061872.1 5398 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus dromedarius V766 igkv JDVD01061873.1 20579 ARCAIQMTQSPSSLSASLGDTVTITCQASQSISNELSWCEPGSGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDLATYYCLQDYSWP
Camelus dromedarius V767 igkv JDVD01061873.1 9127 SSGEVVLTQTPGSLSVTPGEPASISCKASQSLVHSDGKTYLYWLLQKPGQPPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQA
Camelus dromedarius V768 igkv JDVD01061874.1 502 SSGDFVLTQTPGSLSVTPGEPASISCRSTESLEDSDGDTYLSWFLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAHSL
Camelus dromedarius V791 trbv JDVD01067766.1 8886 VRAQTIHQRPPTMVQPMGSSLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSFSADQVDSEEPQNFEASVSQDGSFILSSKKLLLNNSGFYLCAWS
Camelus dromedarius V800 trav JDVD01072831.1 16547 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDTYLFWYVQYVNKAPQLLLKGSAANPRRGGFQATLVKSNRTFHLQKPSVQTSDSAVYYCALR
Camelus dromedarius V801 trav JDVD01072831.1 4706 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDTYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFHATLVKSNRTFHLQKPSVQTSDSAVYYCALS
Camelus dromedarius V802 trav JDVD01072831.1 2158 SVKAQKVTQDQPAISRPEKEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus dromedarius V807 trav JDVD01076095.1 1510 GTSGDSVTQTEVPVTLPEEALLILNCTYQSTYSDAYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFHATLDKSNRTFHLQKPSVQTSDSAVYYCALR
Camelus dromedarius V808 trav JDVD01076096.1 5520 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSAFLFWYVQYLNKEPELLLKSSSENQKVVRGGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALS
Camelus dromedarius V809 trav JDVD01076097.1 2900 MWSLQKGAAQSLNVPEGATASLTCSYSNSNSQTFMWYRQYSGRGPERLMTFYPNNDKKEGRFTAQVNKSSRYVSLLIRDSQPSDSGAYLCAE