WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Eulemur macaco LGHX00000000.1 (LGHX01) 106 12 11 5 44 23 4 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Eulemur macaco V12 trgv LGHX01000211.1 166625 SQISANLEGRMMSITRKTGLPVTITCDIQQSTNKYIHWYLFQEGRAPRRLLYYDLHNPRIMVESEISPEKYHAYAPTGRNSRFILQNLEDSDSGMYYCATWM
Eulemur macaco V13 trgv LGHX01000211.1 191046 GLGLLKVEQSHISISTEVTKNINIHCKISTVYFETEVVHWYQQKPNQTLKHLIQVSSTKASVQVSSAGRKNKVVAKKYPQNSTSILTINSVQKEDMAIYYCAGWY
Eulemur macaco V14 trgv LGHX01000211.1 198245 GLGKFEQPKISVSAATDKSAYISCKAAIQGFDSLPIHWYRQKPNQGLEHIKYVTSTTSSRDRKSSKIEASKDSQTSTSTLRINSLKKEDEAIYYCAYWTG
Eulemur macaco V109 trav LGHX01001811.1 7705 AAGQSIEQPRELAAVEGAFIQVNCTYQTSGFNGLSWYQQHDSGAPIFLSYSVLDGLEGRGRFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Eulemur macaco V110 trav LGHX01001811.1 53095 GLRAQSVTQPEDQVTVSEGDPLTVKCTYSYSGSPYLFWYVQHPNQGLQFLLKYIGGENLVKGSFGFEAEFNKSQTSFHLKKASARGSDPALYFCAVS
Eulemur macaco V111 trav LGHX01001811.1 61005 TLSLAKTTQPIAMESHEGEDVNIPCSHTDIATNEYIFWYQQFPNQGPRFIIQGFKTNVTNEVASLFIPADRKSSILSLPRVALSDTAVYYCVVV
Eulemur macaco V112 trav LGHX01001811.1 67843 GTRAQSVTQPDGHVTVSEGDPLELRCNYSSPYSPYLFWYVQYHNQGLQLLLKYTSGNSLITGIKSFKVEFSKSETSFHLKKASAHLSDSAQYFCAVS
Eulemur macaco V113 trav LGHX01001811.1 76152 VNSQKIEQHPRALSIHEGETAAVTCNYTSYSPSLFQWYRQDPERGLTFLLLIRENEGEKQEGRLKVTFDTTLKQSSFYIPASQPADSATYLCAA
Eulemur macaco V114 trav LGHX01001811.1 86360 DAGAQSVTQPDGHVTVSEGDSLELRCNYSYGGAFYLFWYVQYPGQGLQLLLRYVSGDTLVKGIKGFEAEVKKSESSFTLRKPSVHWSDAAEYFCALS
Eulemur macaco V115 trav LGHX01001811.1 94510 RSHGDSVTQTEGQMRLTEGDSLIVNCSYETTQYPGLFWYVQYPGEGPQVLLKAMKANDKGINKGFEATYNRETTSFHLEKASVHESDSAVYYCALS
Eulemur macaco V116 trav LGHX01001811.1 100101 NARAQSATQPDLSITVSEGASLELRCNYSYRGGSAYLFWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEVRKNESSFTLRKPSVHWSDAAEYFCALS
Eulemur macaco V117 trav LGHX01001811.1 111580 GVRGLEVQQSPSVLSLQEGSSPTLRCNFSATVYNMQWFRQNPGSGLISLFFMTSGTKENGRLNSTMNSKERYSTLHITATRLEDSGTYLCAAQD
Eulemur macaco V118 trav LGHX01001811.1 116215 RTYGNTVTQEEGQVTLSEEAFLTINCTYTSTGYPALFWYVQYPGEGPQLLLTATKANDKGINKGFEATYKKETTSFHLEKASVHESDSAVYYCALS
Eulemur macaco V119 trav LGHX01001811.1 125267 VSGQNQVEQGPQSLVILEGENCTLQCNYTVSPFNNLRWYKQETGRGPVSLIIMTYSKNKESDGRYTATLDASTKQSSLHITASQLSDSASYICVVS
Eulemur macaco V120 trav LGHX01001811.1 132029 VRSQQEVEQTPESLSVSEGATASLSCTYSNTASQYFMWYRQHSGKGPELLVSTYSAGDKEEGRFIAQLNKASRNVSLLIRDSQPRDSATYLCAV
Eulemur macaco V237 trdv LGHX01004486.1 587448 AQAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSHLELEDEGVYICEF
Eulemur macaco V242 trbv LGHX01004561.1 4156 SVNAGVTQTPRFQILETGQNMTLRCVQDMNHDSMYWYRQDPGLGLRLIHYSGTVGSPSKGNIPEGYSVSRSSKEKFPLTLESVTPSQTSVYFCASGD
Eulemur macaco V243 trbv LGHX01004561.1 7711 HTGAGVSQSPRHKVTERGQNVTLRCDPISGHTALYWYQQTLGQGLQFLIYFQGKGVPDKSKLTGDRISAERPEGSYSTLKIQPAEQGDSAVYLCASSS
Eulemur macaco V244 trbv LGHX01004561.1 12271 PAEAGVTQTPGHLIKARGQQVTLRCSPVSGHNRVYWYQQALGQGPQFLIQYFEGKEAEKGNFPDRFSGHQFSDYRSELNLSALELGDSALYLCASS
Eulemur macaco V245 trbv LGHX01004561.1 20452 PGDAGVIQSPRHLIKGKQETAILKCYPFSGHDTVYWYQQAPGQGLQFFISYYDKTQRDKGNMPPRFSAQQFDDRHSELNLSSLELGDSALYLCASSL
Eulemur macaco V246 trbv LGHX01004561.1 23571 HTDAGITQNPRHKITEIGKKVTLKCHQTDNHNNMYWYRQDLGHGLRLIYYSYGVPTTDKGEVSEGYNVSRSNTEDFPLVLESATRSQTSVYFCASSD
Eulemur macaco V247 trbv LGHX01004561.1 26919 LTEAGVIQSPRHKITEKRQAVAFWCDPISGHVTLYWYRQTLRMGLELLIQFQNEAVVEDSGLAKDRFSAERPKGADSTLRIQKAELGDSATYLCASSP
Eulemur macaco V248 trbv LGHX01004561.1 31752 HTDVGVIQTPRHKVTEMGQAVTLECEPISSHNTLFWYKQTLAQGLELLTYFRSQSQIDDAGLPTGRFSAKMPNASFSTLNIQPSEPGDSAMYLCASSS
Eulemur macaco V249 trbv LGHX01004561.1 41382 HIAAGVTQFPSSEVIEKDQAVTVRCDPISGHEYLFWYRRTVGKEMEFLIYFLKENIQDKSGMPNDRFSAERTEGTYSTLKIQPAELEDSGVYFCASSL
Eulemur macaco V250 trbv LGHX01004561.1 47183 HVGAMVMQNPRYQVTSVGKTVTLSCSQNLNHDTMYWYQQKLSQAPKLLFYYYEKEFNNETDTPDNFQPSRPDTSSSSLDIRSPGLGDSAVYLCASSK
Eulemur macaco V251 trbv LGHX01004561.1 50705 SAGEEVTQTPGHLLKGKGQKVKMYCVPIEGHRYVLWYQQILEKEFKFLISFQDKAVYEETEMLKQRFSAECLQNSSCSLEIHTAELQDSAVYLCASSK
Eulemur macaco V252 trbv LGHX01004561.1 52480 HTEPGVSQTPSHQLTEMGQGVILRCDPISGHIFVYWYRQNLRQEMEFLLCFQYQNIAAESAMPKERFSAERPKGTSSTLKIHPAELGDSAVYLCASSS
Eulemur macaco V253 trbv LGHX01004561.1 63474 ATDGGITQTPKYLFTKEGQTVTLDCEQNLDHNAMYWYRQDPGQGLRLIYHSQLVSQVLKGDIAQGYSTSREKKAQFPLTVTSPQGNQTALYLCASA
Eulemur macaco V254 trbv LGHX01004561.1 75711 SVDTEVTQSPRYLLKGKEEKTKMDCVPMKGHSYVYWYQKKLEEELKFLVYLQNEDIMQKTEIFNDRFSAQCPKNSPCSLEIQSIESGDAALYFCASSQ
Eulemur macaco V255 trbv LGHX01004561.1 86367 STDAGVTQTPRNRIAKTGQSILLECSQTEGHDRMYWYRQDPGLGLRLIYYSLAVNSTNKGEVSEGYRVSRKEQAKFSLSLETAVPNQTALYFCASSY
Eulemur macaco V256 trbv LGHX01004561.1 102059 PVEAQVTQTPRYLITGTGKNVTATCSQNMNHEYMFWYRQDPGLGLKLIYYSANVDFVTEGDVPHGYTASRREKPSFPLNLESTLTSQTALYLCASSL
Eulemur macaco V257 trbv LGHX01004561.1 107977 LVDTKVTQTPRHLIKRTGEKVLLECSQDMDHERMFWYRQDPGLGLRLIYFSYDVDNDEKGDVSEGYSASRKKKEDFPLVLESASTSQTSVYLCASRY
Eulemur macaco V258 trbv LGHX01004561.1 115562 SVLAVLVSQTPSRAICQRGTSVTIQCQVDSQVTLMFWYRQLPGQNLMLMATANQGSEATYESGFTKDEFPISRPELTFSNMTVSNVSPKDSSLYLCSAG
Eulemur macaco V343 ighv LGHX01007286.1 17129 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMHWVHQAPGKGLEWVALVRNKANSYTTEYAASVKGRFTISRDDSKSTVSLQMNSLRAEDTALYYCAR
Eulemur macaco V344 ighv LGHX01007286.1 18943 VQCEVQLVESGGGLVQPGGSLRLSCAASRFIFSGYYMNWARQAPGKGLEWVSIIYGGGSTYYADAVKGRFTTSRDNSKNMLYLQMNSLRAEDTALYYCVG
Eulemur macaco V355 trav LGHX01007677.1 4382 VSGGENVGLHPPMLSVQEGDTSVINCSYSNSASTYFPWYKQELGKGPQFIIDVRSHMDKNQEQRFTVLLNKTAKHLSLHIAATQTGDSAVYFCAES
Eulemur macaco V356 trav LGHX01007677.1 9790 FGISQKVTQDQPAMLVQEKEAVTLDCTYDTSTSLGNYALFWYKQPSSGEMILLILQDSYNEQNAAEGRYSLNFQKASKSIKLVISASQVGDSAIYFCALSE
Eulemur macaco V357 trav LGHX01007677.1 16649 VRSQQKEVEQIPKFLSVSEGATASLNCTYSNTAFQSFFWYRQYSGKGPELLVSIYATGDKEEGRFTAQLNKASRYVSLLIRDSQHSDSATYLCAA
Eulemur macaco V358 trav LGHX01007677.1 20910 GTRAQTVTQPDLHVTVTERASLELKCNYAVSYTPTLWWYVQYPNQGLQLVLKYVSGSTLVKGIQGFEAEFSKSENSFHLKKHSAHLSDSAQYFCALS
Eulemur macaco V359 trav LGHX01007677.1 26670 DARAQSVTQPDGHITVSEGAFLELRCKYSYGATPALCWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEFRKNESSFTLRKPSVHWSDAAEYFCALS
Eulemur macaco V363 trav LGHX01007919.1 12583 GTRAQTVTQPEECLSVFKGAPVQLKCNYSYSGSPVLFWYVQYPKQGLQVLLKHISGESVKGFTAVLNKGEATFHLEKTSVQEEDSAMYYCALS
Eulemur macaco V364 trav LGHX01007919.1 16606 VNSQQGEENPQALSIREGENATMNCSYKSSINNLQWYRQDSGRGLTLLILIRANKREEHHGRLTATLDTSIKSSSLIITASSAADTATYFCTTD
Eulemur macaco V365 trav LGHX01007919.1 22432 GTSGDSVTQTEGPVTLPEGKALDLNCTYQSSYAVLLFWYVQFPNKEPELLLKSSSENQELDSRGFQANDVKSDSSFHLKKRSVHLSDSAVYYCAM
Eulemur macaco V366 trav LGHX01007919.1 39524 RSNGDSVNQTEGTVTLPEGAPVILNCTYQTTYSVSYLFWYVQYLSQSPQLLLKSSTENQRSENQGFRANLVKSDRSFHLEKSSLHMSDSAVYYCALR
Eulemur macaco V367 trdv LGHX01007919.1 46369 SSVSEKITQARAATSVLERKAVTLECLYETITFSYYLFWYKQSPNGEMILLIDQESFNEQNATKGRYTLNFQKSTGSISLTITALQLGDSAMYFCALRE
Eulemur macaco V368 trav LGHX01007919.1 56959 VSSKQEVMQIPAALSVPEGESLVLNCSFTDSAIYNLQWFRQDSEKGFTSLLLIQSNQREQKSGRFKASLDKSSRQSTLNIAAAQPGDSATYLCAV
Eulemur macaco V369 trav LGHX01007919.1 66218 VRGIKVEQSPPALSLHEGASSMLWCNFSAAPNTVQWFRQNPGEPLINLFYIPSGTKQIGRLTATTVTKERRSSLYISFSQTTDSAIYFCAVEP
Eulemur macaco V370 trav LGHX01007919.1 75724 SDQKQVKQSPESLIVQEGGISILKCTYEDRAYTYFPWYRQFPRKAPALLIAISSFDSEKKDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur macaco V376 iglv LGHX01008562.1 3979 SLSQPVLTQPPSLSAAPGASARLTCTLSSGLSVGGKLLYWYQQKPGSPPQNLLRYYSDSDKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCVI
Eulemur macaco V379 igkv LGHX01008780.1 7093 SRGQIVLTQSPAFLSGTPGEKATLTCRASQGISNNLHWYQQKPGQAPKLLVKYASQSVSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQSNSYP
Eulemur macaco V380 igkv LGHX01008780.1 15829 NGDIVLTQTPASLSAHPGDTVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPTRYSSRGSGTSYVFSISALEPGDSGEYYCMHDYGWP
Eulemur macaco V381 igkv LGHX01008780.1 28409 ACGDIVMTQSPGSLAASAGERISINCKSSQSLLSNNKNYLAWYQQKPGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCGQSY
Eulemur macaco V383 ighv LGHX01008958.1 956 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMNWVRQAPGKGLEWVSYISYDGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur macaco V384 trav LGHX01008959.1 3675 SDQKQVKQSPESLIVQEGGISILKCTYENSAFDYFPWYQQSPGKAPALLIAIRSYDSKKEDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur macaco V385 trdv LGHX01008959.1 12064 STVAQKVTQAQISTTMTVRQAVTLNCQYETTWSSYYIYWYKQLPSKEMIFLLRHHSDDNQNAKYGRYSVNFQKEAKSIDLIISALRLEDSAKYFCALWD
Eulemur macaco V386 trdv LGHX01008959.1 18549 STVAQKVTQAQTATPTTVGRAVTLNCWYETTWSEYNIYWYKQLPSKEMIFLLRQYSGSSSNAKNGRFSVNFQKQAKSIDLTISASQLEDSAKYFCALQD
Eulemur macaco V393 ighv LGHX01009451.1 4948 VLSDDHLVQWGDGVVVSSQKLSLTCAAYTRSISEYSVSWVRLPHGKGLEWVGVIWANGNTNYSPYLQSRVGISRNTNKNQVFLELRSVTAEDAGTYYCAQ
Eulemur macaco V400 iglv LGHX01010929.1 4568 SVASSEVTQVPAVSVALGQTASITCQGDGISSYYAHWYQQKPGQSPVLLIYDNTYRHSGIPERFSGSILGTTATLTITDTQVGDEADYYCHTWESSGYN
Eulemur macaco V402 ighv LGHX01011116.1 4638 VQCEVQLVESGGGLVQSGGSLRLSCAASGFTFSSYGMHWVHQAPGKGLEWVLFINIGGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAQDTALYYCAR
Eulemur macaco V404 ighv LGHX01011563.1 1957 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWYDGSKQYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur macaco V405 ighv LGHX01012338.1 229 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSNINNGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur macaco V407 iglv LGHX01013153.1 884 SWAPVLTQPPSVSGALGQTVTISCTGSSSNIGGNYVHWYQQLPGTAPKLLIYGDSGRASGVPARFSGSKSGSSASLTITGLQAEDEADYYCSAWDDSLSG
Eulemur macaco V408 iglv LGHX01013233.1 428 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYWIYWHQQKPGSPPRYLLSYYSDSSKHQGSGVPSCFCGSKDASANAGILHISGLQPEDEADYYCAT
Eulemur macaco V411 trav LGHX01015935.1 5708 SDQKQVKQSPESLIVQEGGISILKCTYEDSAFDYFPWYQQSPGKAPALLIAIRSYDSKKEDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur macaco V413 trav LGHX01016843.1 616 RVRGLEVQQSPSVLSLQEGTSPTLRCNFSATVTSVQWFRQNPGGGLINLFYMASGTKENGRLNSTMNSKERYSTLHITATRLEDSGTYLCAAQE
Eulemur macaco V463 trbv LGHX01000443.1 5541 HTEPGVTQTPTHQVTKKGQEVILRCDPMSGHLYFYWYQQIWGQKVEFLVSFYNDNISEKSKIFKDRFSVERQRGSYFALKIRSTEVEDSATYFCASKQ
Eulemur macaco V553 iglv LGHX01001982.1 90419 SLSQPVVTQPPSLSASPGASVRLTCTLRSDISVGGKNLYWYQQKPGSPPRYLLYYYSDSDKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCMT
Eulemur macaco V554 iglv LGHX01001982.1 73959 ATSQAVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYAKWLQQKSNQAPQSLIGNTNSQGPGVPARFSGSLVGDKAALTITGAQPEDEAEYYCALWFSSR
Eulemur macaco V555 iglv LGHX01001982.1 69680 SSSQAVVTQESSMTVSPGGTVTLTCGSSTGAVTDGHYPYWFQQKPGQAPRTLIYNTNNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLVYSGV
Eulemur macaco V557 iglv LGHX01001982.1 45020 ATSQAVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKSNQAPQGLIGGTTSRVPGVPARFSGSLVGDKAALTIMGAQPEDEAEYYCALWFSSH
Eulemur macaco V596 trgv LGHX01002585.1 11120 SQISCNSEGRIKSIFRKTGSTVDISCDIKQSARYIHWYFFPEDRDPGRLLYYDTYYSSQQLDSGTRRDKYDASKITDKSFKLHLKRLEASDSGVYYCAAWV
Eulemur macaco V613 ighv LGHX01002906.1 423 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVAYISSPSGSNKYYADAVKSRFTISRDNSKNTLSLQMNSLRAEDTALYYCAS
Eulemur macaco V625 trav LGHX01003227.1 30717 RTHGDSVMQREGQVTLPEEAFLSINCTYTATGYPTLFWYVQYPGEGPQLLLKATKANDKVINKGFEATYKRETTSFHLEKASVHESDSAVYYCALS
Eulemur macaco V626 trav LGHX01003227.1 21422 VKSQQKYVEQTLESLSVSEGATASLNCTYSDTTSQYFAWYRQYSGKGPEFLVSIYSTGDKAEGRFTAQLDKASQNVSLLIRDSQHSDSATYLCAV
Eulemur macaco V627 trav LGHX01003227.1 11356 RVRGLEVQQSPSVLSLQEGTSPTLRCNFSATVTSVQWFRQNPGGGLINLFFMASGTKENGRLNSRMNSKERYSTLHITATRLEDSGTYLCAAQE
Eulemur macaco V628 trav LGHX01003227.1 3646 VGGEENVGLRPPTLSVQEGDTSVINCSYSDSASSYFLWYKQELGKSPQSIIDIRSNMGKKEEERFTALLNKTAKHLSLRIAGTRPGDSAVYFCAES
Eulemur macaco V667 trav LGHX01004081.1 155043 LNGQQIKQIPQFLHLQEGEDFSTYCNSSSTLNTVQWYKQRPGGSPVLLMILVKAGEVKKERKLTAQFGETRKDSSLHITAAQTADVGTYFCAE
Eulemur macaco V668 trav LGHX01004081.1 136430 RTGAQSVTQPDIHVTVSEGDPLKLRCSYSGGVVTTYLFWYVRYPGQSLQFLLKYTSGDTLVKGVKGFEAEFRKNETSFHLKKHSAHSSDTAEYFCAVS
Eulemur macaco V669 trdv LGHX01004081.1 99232 SSMSQQVIQSQSAISKQEGETVELECSYNTSVPYYMLYWYKRPPSGEIIFLIFQRTDADTNATQGRYSVSFQKATKTIRLIISSSQPEDSATYFCCLRE
Eulemur macaco V670 trav LGHX01004081.1 77342 VSSQELEQNPRSLVIQEGEDLTINCNSSKTLYGIHWYRQKYGEGGLIFLVLLLKGGEEKSLEKITAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Eulemur macaco V671 trav LGHX01004081.1 68357 VSSEDKVVQSAPSLAVHEGDSATLTCNYEVSYFQSLQWYKQEKNAPVFLFTLTSSGIEKKSGRLSSILDKKERLSTLNITATQTEDSAIYFCAVEE
Eulemur macaco V672 trav LGHX01004081.1 65456 PGRADWITSQETEVSRTEGETVDLVCNYSTSGRYTYLHWFRQYPSQDPEYILHRGWGLPGKGDANFARERFYSKSTENMINLYIRNLVPADTALYYCALR
Eulemur macaco V673 trav LGHX01004081.1 46943 SSVAQTVTQSQPEMSVQEAETVTLDCTYATSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Eulemur macaco V674 trav LGHX01004081.1 28371 MFSWTGLRGEVEVQQSPLSLSTQEGEDCTIYCNHSSSASDRLYWYRQAPGKSLELLFVLLSNGAVKREGPLTASLDTKARLSTLHIGGPQHGLSATYFCAV
Eulemur macaco V678 trdv LGHX01004143.1 163285 VMPAVVLVPENQAVTVPVGGSATLRCSMEGGTISSYYANWYRKTQGNTLTFIYRESNIYGPGFQGRFQGGQDLPRNQAVLKIVTTSESDEGFYYCACDL
Eulemur macaco V694 trbv LGHX01004561.1 156658 ARAQTIQQWPAVRVQPVGSPLSLKCTVKGTSSPTLSWYRQVTGGPLQLLFYSVGVQDIVPEEPLNLSASRPEDSEFILSSEKLLRSHSGFYLCAWS
Eulemur macaco V742 iglv LGHX01005929.1 1525 SLSQPVLTQPPSLSASPGTSVRLTCTLRSDISVGGKYVYWYQQKPGSPPRYLLSYYSDSNKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCVT
Eulemur macaco V743 trdv LGHX01005966.1 16793 STVAQKVTQAQTSATMTVRQAVTLNCQYETIWSLYYIYWYKQLPSKKMIFLLRQHSTRQNAKDGRYSVNFQREAKSIDLIISALQLEDSAKYFCALVE
Eulemur macaco V744 trav LGHX01005966.1 5986 LNGQQVKQIPQFLHLQEGEDFSTYCNSSSTLNTVQWYKQRPGGSPILLMILVKGGEVKKEKRLTAQFGEARKDSSLHITAAQTADVGTYFCAV
Eulemur macaco V776 igkv LGHX01007038.1 677 SSGDIVMTQTPLSLSVTPGESASISCKASQSLLHSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQG
Eulemur macaco V786 iglv LGHX01007774.1 4877 SVASQLTQVPAVSVALGQTASITCQGDIVNSYSTQWYQQKPGQAPVLVIYSNNQRPSGIPERFSGSKSGNTATLTISGAQAEDEADYYCSSYTGS
Eulemur macaco V792 trav LGHX01007927.1 9737 VSGGENVGLHPPILSVQEGDTSVINCSYSNSNSDYFPWYKQVLGKGPEFITDIRSNRNEKKEGRFTILLTKTAKHLSLRIASTRPGDSAVYFCAES
Eulemur macaco V793 trav LGHX01007927.1 2430 SGIAQTVTQDQPAMSVQEKEAVTLDCTYDTSDSNYALFWYKQPSSGEMILLIRQDSYSQQNTTEGRYSLNFQRARKSIHLVISALQLGDSAIYFCALSE
Eulemur macaco V805 trav LGHX01008631.1 7500 SGIAQKVTQSQPAMSVQEKEAVTLDCTYDTSDSRYYLFWYKQPSSGEMILIIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQVGDSAIYFCALIE
Eulemur macaco V806 trav LGHX01008631.1 707 VRSQQEVEQTPESLSVSEGATASLSCTYSDTTSQNFPWYRQYSGRGPELLVSIYSTGDKEEGRFTAQLNRASRNVSLLIRDSQPSDSATYLCAV
Eulemur macaco V809 trbv LGHX01008678.1 22255 PMDTGVTQTPRHLVMGMTEKKSLKCEQNLGHNAMYWYKQSAKKPLELMFYYYLQELRENLTMSSRFSPENPDSSHLYLHLDALQPEDSATYLCASSQ
Eulemur macaco V810 trbv LGHX01008678.1 14792 PLDTAVFQTPKYLLSQMGNNVSLKCEQTLGHDTMYWYKQDSKKLLEIMFTYNNKKLILNETISSRFTPESPDKAHLNLHIKSPEPGDSAMYLCASSY
Eulemur macaco V811 trbv LGHX01008678.1 10261 PMDTGVTQAPRHLVMGMTEKKSLKCEQNLGHNAMFWYKQSAKKPLELMFLCRLGKLTENLTMSNRFSPECPDNSHFYALQPEDSATYLCASSQ
Eulemur macaco V812 igkv LGHX01008780.1 43615 TRAETTLTQTPALVSVAPGDKITITCKASQDIDDDIHWYQQKPGASPKFIIKYASTLVSGVPSWFSGSGYGTDFALTINNLESEDAAYYFCQQDDNLP
Eulemur macaco V822 ighv LGHX01010534.1 4308 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSTINGNGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur macaco V823 trav LGHX01010669.1 12325 AAGQSTEQPRELAAVEGAFIQVNCTYRTSGFNGLSWYQQHDSGAPTFLSYSVLDGLERRGRFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Eulemur macaco V824 ighv LGHX01010724.1 1664 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWACQAPGKGLEWVAVICYDGSKQYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAS
Eulemur macaco V826 trbv LGHX01011476.1 5712 HTDAGITQNPRFKVTETGKQVTLKCHQTDNHDCMYWYRQDLGHGLRLIYYSVGVPTTDKGEVSEGYNVSRSNTEDFSLLLESATRSQTSVYFCASSD
Eulemur macaco V833 ighv LGHX01013464.1 889 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSSYYMHWVRQAPGKGLEWVSRIYGNGGSTSYADAVKGRFTISTDSSKNTVYLQMNSLRAEDTALYYCTS
Eulemur macaco V834 iglv LGHX01013946.1 19680 SVASYELTQPPSVSVSPGQTARITCGGNNIGGKNVYWYQQKPGQTPVLIIYRDSNRPSGIPERFSGSNSGNTATLTISGAQAGDEADYYCQVWDG
Eulemur macaco V835 ighv LGHX01014152.1 1171 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVALVRNKANSYTTEYAASVKGRFTISRDDSKSTVSLQMNSLRAEDTALYYCAR