WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Tupaia chinensis ALAR00000000.1 (ALAR01) 237 8 86 26 64 38 5 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Tupaia chinensis V22 iglv ALAR01005969.1 2641 ALAQSVLAQLPSVSGTLNQRITISCKGSSDNIGRNSVYWDQQLAGMLPRLLIYRNSNRPSGVPNRFSGSKSGTSASLTMSGLQTEDKATYHCLAWDSGINA
Tupaia chinensis V23 iglv ALAR01005969.1 8143 SLSQPVLTQPSSLSASPGASARLTCTLSSGFSVGSYYINWFQQKPGSRPRYLLNYYSDSDKHHGTGVPSRFSGSKDTSANAGVLHISGLEPEDEADYYCGT
Tupaia chinensis V24 iglv ALAR01005969.1 12743 SLSQTVLTQPPSLSASPGASARVTCTLSSGFGVGDFGIRWYQQKPESRLRYLLTFRSDSKKHHGSGVPSRFSGSSDALANAGVLHISGLQPEDEADYYCQT
Tupaia chinensis V25 iglv ALAR01005969.1 18204 SLSQPVLTQPPSLSASPGASVRLTCALSSDISVDGYWINWYQKKATSPRYLLSYYSDSVKHQGTGVPSRFSGSKDTSANAGVLHISGLQPEDEADYYCSI
Tupaia chinensis V26 iglv ALAR01005971.1 251 SVSAGSLSQSVLTQPPSLSASPGASVRLSCTLRNDISVGGKYVYWYQQKPESRPRYLLYHYSSTALGTGVPSRFSGSKDTSANAGVLHISGLQTEDEADYYCMI
Tupaia chinensis V27 iglv ALAR01005975.1 1780 SWAQSVLTQPSSVSGTPGQRVTLSCTGSSSNIGGNSVYWYQQLAGKAPRLLIYGNSNRPSGIADRFSGSKSGTSASLTISGLQAEDEAVYHCLSYDDSLK
Tupaia chinensis V28 iglv ALAR01005982.1 19895 SWAQSVLTQPSSVSGSLGQTVTISCAGSSNDIGGYNRVSWYQLHPGRTHKALIYDVNHRPSGIPDRFSGSKSGDTASLTISGLQAEDEAEYHCSSYAASGI
Tupaia chinensis V29 iglv ALAR01005984.1 1470 FWAQSALTQPSSVSGALGEKVTLSCVGSSNDIGERYHSISWYQQHPGSPPKLLIYAVSSRPSGIPTRFSGSKSGNTASMTISELQDEDEADYFCLLNAGSNT
Tupaia chinensis V30 iglv ALAR01005986.1 2229 SWAQSVLTQPPSVSGALEETITISCLGSSNDIGRYSGISWYQQHPGSPPKLLIYAVSSRPSGIPTRFSGSKSGNTASLTISELQEEDEALYFCQSYAGSNT
Tupaia chinensis V31 iglv ALAR01005986.1 8758 FWAQSALTQPSSVSGALGEKVTLSCVGSSNDIGRYNLVSWYQQHPGSLPKLLIYAVSSRPSGISTRFSGSKSGNTASMTISELQDEDEADYFCNSYAGSGI
Tupaia chinensis V32 iglv ALAR01005986.1 17527 CWAQSALTQLPSISGNPGERVSLSCVGSNSDIGSYNDVSWYQQHPETRPKLLIYGVNTRPSGIPDRFSGSKSGNTAFLTVSDIRPEDEGDYYCASYRSGRT
Tupaia chinensis V33 iglv ALAR01005991.1 6577 SVTSSALTQPPSVSVSLGGTVSITCQGEDLESYYSHWYQQKPAQRPALLIYYDDEQASGVPDRFSGSRSGRTATLTITGAQAEDEADYYCQSGYS
Tupaia chinensis V34 iglv ALAR01005991.1 13596 SVDTSVLTQPSALSVALGETVSITCQGGDFENSYAHWYQQKPGQRPSLFIYEDSNRESGVPDRFSGSNSGGTATLTITKALAEDEADYYCLSWDDDNY
Tupaia chinensis V35 iglv ALAR01005994.1 1741 SVASSVLTQPSALSVALGGTVSITCQGGDFENNYVHWYQQKPAQRPALLIYYDDEQASGVPDRFSGSRSGGTATLTITGAQAEDEADYYCQSADN
Tupaia chinensis V36 iglv ALAR01005995.1 3157 AAASYQLTQPSSVSVALGQTATITCSGDLLDKIYTDWYQQHPGQAPVVVIYKDTERPSGVPDRFSGSSSGKTVTLTITGAQAEDEADYYCESADNDKN
Tupaia chinensis V37 iglv ALAR01005996.1 1745 SVASYDVTQPSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRLVIYYDNKRPSGIPDRFSGSNSGNTAALTISGVQAEDETDYYCQVWDSSNYI
Tupaia chinensis V38 iglv ALAR01005997.1 1400 SVASSALTQPSTVSVVLGQTARITCQGGDLKTYAAHWYQQMPGQSPALLIYGDRRKASGVSDRFSGSSSGGTAALTITRAQAEDEAEYYCHSADSSGKY
Tupaia chinensis V85 trgv ALAR01021455.1 9284 SQVSSNLEGRMIVTGKTGSTVVISCNLQVSASYIHWYQFQEGKAPRRLLYLIQSSSKVVMDSGIRQEKYQAYKTTGNNYELVLRYLENSDSGMYYCAFWP
Tupaia chinensis V86 trgv ALAR01021485.1 12694 SQLSSNLEARTMTVTGKTGSSVVITCDLARGNNYIHWYQFEQGKVPQHLLYYDYHSSTVVVDLGISSSGKYHAYESTRSYKFVIRYLQESDSGVYYCAVWK
Tupaia chinensis V87 trgv ALAR01021485.1 15959 SQASSNLERRILAVTGKTGSSAEISCDFLQLSPTYVHWYQFQEGKPPRRFLYYDYYRSSMVVDSGISPAKYHAYAITRSSFMLVIRRAEERDSGVYYCAAWE
Tupaia chinensis V88 trgv ALAR01021489.1 4771 ANGDILITQLVTSVTKKKGSTAFLGCQIKTATLQNNLYIHWYRQQAGQPLKRILCISSNENVLHERGISERKFEARKQRGLSWSLRIHQVAEEDAGMYYCAYWD
Tupaia chinensis V89 trgv ALAR01021490.1 1619 GDTTIKLSQDQLSFTRRLDRTVHISCRLSGVPLDNAIVHWYQHKEGEPLKRILYGSSKKYKKDQPNPRLEADEKDDGVFYLIINNVIQSDEATYYCACWD
Tupaia chinensis V114 trav ALAR01030468.1 2335 KAQGDSVTQMEGQMTISERTSLTINCTYSATGYPALFWYVQYPGEGPQLLLKATKANEKGSNKEFEATYDKDKTSFHLKKASVQESDSAVYYCALS
Tupaia chinensis V115 trav ALAR01030469.1 3696 DARAQSVTQPDSHVTVSEKASLELRCTYSGTSTPYLFWYVRYPGQGLQLLLKYISGDALVKGNNGFEAEFKKSDSSFHLRKPSVHWTDTAEYFCALG
Tupaia chinensis V117 trav ALAR01030471.1 3252 VRGFQVEQSPSVLSLQEGTGSTLRCNFSAAIKYVQWFRQNPGGSLINLFFVASGAKQNGRVEATVNSKDLYSTLHITASHLEDSGTYLCAAEAQCPQ
Tupaia chinensis V118 trav ALAR01030471.1 8867 VSRGENVEQRPSTLRVLEGDSSVINCSYSDSASSYFPWYKQEPGKGPQLIIDIRENRDKNHNQRLTVFLDKTEKLFSLHIAATQPGDAAVYFCAAS
Tupaia chinensis V119 trav ALAR01030471.1 14741 KAQGDSVTQMEGQMTISERTSLTINCTYSATGYPTLFWYVQYPGEGPQLLLKATKANEKGSNKEFEATYDKDKTSFHLKKASVQESDSAVYYCALS
Tupaia chinensis V120 trav ALAR01030472.1 2110 VRSQQKEVEQSSESLSVAEGAIASLNCTYRDRASSSFAWYRQYSGKGPEMLILTFSSGDKEEGRFTMKVNKDSLYVSLIIKDSQPRDSATYFCAV
Tupaia chinensis V121 trav ALAR01030472.1 11810 GSRAQTVTQPEDHLSVLEGDPVQVKCNYSYSGSPVLFWYVQYPNTGLQLLLKHISGESTKGFTAHLNKGEASFHLKKSTAQEEDSATYYCALS
Tupaia chinensis V122 trdv ALAR01030472.1 28038 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSDPTYYLFWYKQPPTREMIALIRQDSYNEKNTSEGRYFLNFHKSARSISLTIMTSQLTDSTVYFCALR
Tupaia chinensis V123 trav ALAR01030472.1 39147 RSNGDSVTQTEGPITLSEGAPLILNCTYQVSHLQTPFLFWYIQYVSKAPQLLLKSSTGKQRTENQDFHADFVKDNSSFHLQKPSVQTSDSAVYYCALG
Tupaia chinensis V124 trav ALAR01030472.1 41312 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSVTTYYLFWYKQPPTGEMIALIRQDYYNEKNASEGRYFLTFLKSARSINLTISASQLTDSAVYFCALR
Tupaia chinensis V125 trav ALAR01030473.1 5542 LSGEDQVKQSPEMLRLQEGDNSSLSCSYTVSYFRGVQWYRQDPGKGPELLIALYSDGDDKWTGRLRATSSKKESTLHITAPMPEDSAMYLCAV
Tupaia chinensis V126 trav ALAR01030473.1 9233 VSSEQEVRQSPEALSVREGDNLVLNCSYTDSAVYSLQWFRQDPGKGLTLLIILRSNQRDESSGRLKASLDTSSRRSSLYIAASQPGDSATYLCAA
Tupaia chinensis V127 trav ALAR01030474.1 2331 VSGIQVEQSPSALSLQEGASSTLWCNFSTSINNLQWFRQNPGGRLITLFYVPSGTKRNGRLNATTVANERHSSLHVSSSQTTDSAVYYCAVGPQRSR
Tupaia chinensis V128 trdv ALAR01030474.1 15677 SSAAQKVIQAQPAISGPMGTSVTLECAYETSWTSYVLFWYKQLPSGEIVFVISQPSSSQNEKNGRYSSDLKRSAKLISLTISSLQLEDSAKYFCAFRK
Tupaia chinensis V129 trav ALAR01030475.1 12331 VSSVPNVAQSPRSLHVQEGESTNFTCSFPSSSFYGLHWYRQEPAKSPKILFVISVNGDEKQEGRVKVTLNTKEGYSFLYIKGSQPEDSASYLCAS
Tupaia chinensis V130 trav ALAR01030475.1 18257 EVNGQQVNQIPRFLNVQEEEDFTAYCNSSSTLNSLQWYIQKPGERPVFLMRLVAGGEVKKHDRLTASFGETRKNSSLHIVATQTADVGTYFCA
Tupaia chinensis V131 trdv ALAR01030477.1 11059 GPHTQKVTQSQSAISRPMGTSVTLECAYETSWTSYVLYWYKQLPSGEMIFLFSQLPTDQNKNIGRYSTNFQKSARSISLIISPLQLEDSAKYFCALSRN
Tupaia chinensis V132 trav ALAR01030482.1 853 VSSVPNVAQSPRSLHVQEGESTNFTCSFPSSSFYSLHWYRQEPAKSPKILFVISANGDEKQEGRVKVTLNTKEGYSFLYIKESQPEDSASYLCAL
Tupaia chinensis V133 trav ALAR01030482.1 7168 VNGQQVNQIPQFLHIQEGEDFTAYCNSSSTLNNLQWYMQKPGERPVLLVMLARGGEVKKHDRLMASFGETRKNSSLHIAATQTADVGTYFCA
Tupaia chinensis V134 trav ALAR01030482.1 12907 ALSDAKSTQPDAMVCAEGETVNLPCNHSSISTNEYIHWYRQGPRQSPQYLIHSLQNSVSNKVASLTIAADRKSSTLILPHVTLGDTAVYYCTVR
Tupaia chinensis V135 trdv ALAR01030483.1 2462 PSVAQKVTQVQSAISGPTGTSVTLECAYETSWTTYILYWYKQLPSGEMIFVINQGSSRQNEKNGRYSTNFQKSAKSISLIISSLQLEDSAKYFCALWE
Tupaia chinensis V136 trav ALAR01030485.1 1978 VSSVPNVAQSPRSLHVQEGESTNFTCSFPSSSFYGLHWYRQEPAKSPKILFVISVNGDEKQEGRVKVTLNTKEGYSFLYIKGSQPEDSASYLCAS
Tupaia chinensis V137 trav ALAR01030485.1 8093 VNGQQVNQIPQFLHIQEGEDFTAYCNSSSTLNNLQWYMQKPGERPVLLVMLARGGEVKKHDRLTASFGETRKNSSLHIAATQTADVGTYFCA
Tupaia chinensis V138 trav ALAR01030486.1 5077 ALSDAKSTQPDAMVCAEGEAVNLPCNHSSISTNEYIHWYRQGTRQSPQYLIHSLQNSVTNEVASLTIAADRKSSTLILPHVTLGDTAVYYCTVR
Tupaia chinensis V139 trav ALAR01030486.1 12085 GTGAQSVTQPDSHVSVSEESRLELKCTYSYSGAPFLFWYVQYPGQSLQFLLKDTTEAHLVKGIKGFEAELRKNETSFYLRKPSAHWSDSAQYFCALS
Tupaia chinensis V140 trav ALAR01030490.1 8431 VSTQGLEQSPPFQSIQEGEDFTVYCNSSSVFTRFQWYRQEPGKGLVLLMTLVKSGEVNKQKRLTARFGEARKDSSLHIATTQLGDAGVYLCAG
Tupaia chinensis V141 trav ALAR01030492.1 5547 VRAQMKVEQSPQVLILQEGRNSFLTCNYSSTMTGMQWFQQSPGGRLISLFYIASGTKHNGRLKCTVNTKERYSQLHISDAQPEDSASYFCAVE
Tupaia chinensis V142 trav ALAR01030493.1 21112 VSGQKKDVVQSPSILAVWERETAVINCSYTDGASNYFPWYKQEAGKGPSLLIEMRSNVNSKQDRRFTLLLDKNAKHISLHITPTQPEDSASYFCIA
Tupaia chinensis V143 trav ALAR01030493.1 38080 IMGDAKTTQPTSVKSAEEEPVHLPCNHSTISGSEYIHWYRQAPQQAPEFVIRGLKNNETNGMASLVIAADRKFSILILPRVTLRDTAVYYCMVR
Tupaia chinensis V144 trav ALAR01030493.1 47833 VCSQELEQSPQSLIVQEGKEITITCNSSKTLYTLHWYRQKDAEGLSFLMMLRKSGEEEKSHEKMTFTLDEKKQRSSLHIAVTRLSHSGTYFCGAE
Tupaia chinensis V146 trav ALAR01030495.1 4274 FSMAQTVTQSQSKMSVQETETVTLDCIYETSDSNYYLFWYQQPPSGQMIPIIRQEAFKQQNATEHRFSVNFQKEAKSFSLKISDSQLTDAAMYFCAFV
Tupaia chinensis V147 trav ALAR01030496.1 4528 FSMAQTVTQSQSKMSVQETEVVILDCIYDTSERNYYLFWYQQPPSGQMIPIIRQEAFKQQNATEHRFSVNFQKEAKSFSLKISDSQLTDAAMYFCAFM
Tupaia chinensis V148 trav ALAR01030498.1 3970 VSGMNEVKQSPQYLSTQEGGFITMNCSYSTGMTTLHWLRQNPGGGIISLFVLSLEIKKSGRLSATINTEENYSSLHITASQLRDAAIYLCAV
Tupaia chinensis V149 trdv ALAR01030499.1 55730 VSLDITLEPDAETLTVSVGEPATFRCSVTGGDLKNYQMSWYKKNENNSLVLVYKLRNNSNDDLENNFKGKTDTLRSQFILDIQKATAKDVGTYYCGSD
Tupaia chinensis V150 trdv ALAR01030504.1 2050 VLSDVVLLPQDQTLAVSVGRSATFKCSMEKETITNYYVSWYRKTQGSTLTFIHREGSTYGSGFKDRFQSKVHGNQAVLEILEASERDEGFYYCAVD
Tupaia chinensis V151 trdv ALAR01030504.1 3338 VLSDVVLLPQDQTLAVSVGRSATFKCSMEKETITNYYVSWYRKTQGSTLTFIHREGSTYGSGFKDRFQSKVHGNQAVLEILEASERDEGFYYCAVD
Tupaia chinensis V159 trbv ALAR01033743.1 21529 PVDTKITQIPKHLVTAMGSKRTLNCEQYLGHNAMYWYKQEPEKPLELMFSYNYKELVQNETVPSRFTPDCPDSAHLHLHLYALEPGDSAVYLCASSQ
Tupaia chinensis V160 trbv ALAR01033743.1 23255 HTEPGVTQTPSHQVTRMGHKVVLECDPVSGHLYFYWYRQILGQKMEFIVSFYDKPMEKSEIYKEDRFSVKKPSASYFTLKIEPTELEDSAVYFCASSI
Tupaia chinensis V161 trbv ALAR01033743.1 29403 PLDTAVSQTPKYFVTQMGNTRSFYCEQNLGHDNMYWYKQDSKQLLKIMFSYNNKELIINETVPSRFLPNSPDKAHLKLDIKSLEPGDSALYLCASS
Tupaia chinensis V162 trbv ALAR01033743.1 33615 SLDTGVTQSPKHLVMGRTNKKTLKCEQRLGHNFMYWYKQKPEKPPELMFIYNLKNLFQNETVPSRFSPECPDSSHLYLHLDALELGDSAVYLCASSQ
Tupaia chinensis V163 trbv ALAR01033743.1 40715 PVEAGVTQTPRHLIKTKGQKVTLKCSPMSGHNSVSWYQQILGQGPQFLFEYYREEERAKGNFPSRFSAHQFRNYSSEMNVSSLALEDSALYLCASSL
Tupaia chinensis V164 trbv ALAR01033745.1 885 PVEAGVTQTPRHLIKTKGQKVTLRCSPISGHESVSWYQQILGQGPQFLFEYYREEERAKGNFPSRFSAHQFRNYSSEMNVSSLALEDSALYLCASSL
Tupaia chinensis V165 trbv ALAR01033745.1 4557 LAASEVTQTPKHLIKARGQQGTLRCSPVSGHLSVYWYQQTSDQGLQFLVQHYNGEERERGNIPDRFSAQQFSNSSSELNLSSLTVGDSALYLCASSL
Tupaia chinensis V166 trbv ALAR01033745.1 9103 PVEAGVTQTPRHLIKTKGQKVTLRCSPISGHESVSWYQQILGQGPQFLFEYYREEERAKGNFPSRFSAHQFRNYSSEMNVSSLALEDSALYLCASSL
Tupaia chinensis V167 trbv ALAR01033745.1 12765 LAASEVTQMPKHLIKARGQQGTLRCSPVSGHTSVYWYQQVSDQGPQFLIQYYNEEEGEKGNIPDRFSARQFSNYSSELNLSSLTVGDSALYLCASSL
Tupaia chinensis V168 trbv ALAR01033746.1 7645 DTDAGVSQSPRHRVTVKGQNVTLRCDPISGHTTLYWYQQTMGQGLEFLLYFQGMDILDKSRLLSDRFSAERPENSYSNLKIQPAEPGDSAVYLCSSS
Tupaia chinensis V169 trbv ALAR01033747.1 9862 PVEAGVTQTPRHLIKTKGQKVTLRCSPMSGHNNVYWYQQILGQGLQFIFEYYREEQGAKGNFPSRFSAHQFRDYSSEMNVSSLQLEDSALYLCASSL
Tupaia chinensis V170 trbv ALAR01033750.1 1666 SVDVGVTQTPRYLIREKKGQATLKCYPISGHKSIYWYQKALDQGPQFLVSYYEKTEYSKGIITDRFLAEQFSDYHSEMNMSSLELGDSAVYLCASSV
Tupaia chinensis V171 trbv ALAR01033750.1 7734 SMDARITQSPRHKVTMVGKTVTLRCQQTYKHDYMYWYRQDLGHGLRLIHYSYDVNDTQKGDIPDGYSVSRSNTEDFPLTLESPTRSQTSVYFCASS
Tupaia chinensis V172 trbv ALAR01033750.1 11668 DADTGVSQSPKYRITVRGQNVTLWCDPISGHAVLYWYRQTLGQSPEYLLYFQNNFMSDNSGLPSDRFSAERAGGSSSTLRIQPAEAGDSALYLCASSL
Tupaia chinensis V173 trbv ALAR01033752.1 4494 SADVGVTQTPRYLITEKRGEATLKCYPVPGHATVYWYKQAPDQGLQFLISYYEKTENEKGIIPDRFSAKQFSDYHSEMNMSSLELGDSASYLCASSV
Tupaia chinensis V174 trbv ALAR01033752.1 7598 PMDARITQSPRYKVTVKGQNVTLRCHQNDNHNAMYWYRQDLGHGLRLIHYSVAALSTAEGDIPDGYRVSRSNTEDFPLILESPTPSQTSVYFCASSN
Tupaia chinensis V175 trbv ALAR01033752.1 13498 SVDVGVIQTPRYLITEKRGQATLKCFPVPGHSYVYWYQQAPHHQSLQFLSSYYKEREYAKGIIPDRFSAEHFSDNHSEMNMSSLELGDSALYLCASSV
Tupaia chinensis V176 trbv ALAR01033752.1 19667 PADAGITQSPRHKVTVKGKNVTLRCHQNDNHYYMYWYRQDLGHGLRLIHYSLDVNSTTKGDIPDGYRVSRANTEDFPLTLESPTPSQTSVYFCATSD
Tupaia chinensis V177 trbv ALAR01033752.1 28481 SVDVGVIQTPRYLITEKRGQATLKCYPFPGHDTVYWYQQTPGQGPQFLISYYAKMEYGKGNIPDRFSAEQFSDHHSEMNMSSLELGDSALYLCASSI
Tupaia chinensis V178 trbv ALAR01033753.1 2629 PVDARITQSPRHKVTVKGKNMILRCHQNDNHNYMYWYRQDLGHGLRLIHYSYGVNSTTKGDIPDGYRVSRSNTEDFPLTLESATPSQTSVYFCASS
Tupaia chinensis V179 trbv ALAR01033753.1 7620 HTDVGVSQYPRYRVTVRGQNVTLKCDPISGHTRLYWYQQTVKQGLEFLLYFQGTDIPDKSGLPSDRFSPERPKGSSSALKIQPAEPEDSAMYLCASSL
Tupaia chinensis V180 trbv ALAR01033753.1 17594 PVDGGITQSPRHKVTVKGKNVTLRCHQNDNHYYMYWYRQDLGYGLRLIHYSYGVNSTTKGDIPDGYRVSRSNTEDFPLILELPTPSQTSVYFCASSN
Tupaia chinensis V181 trbv ALAR01033753.1 26397 SVDVGVTQTPRYLITEKRGQASLKCYPIPGHNYVYWYQLARDQGPQFLISFYEKMLREKGIIPDRFSVEQFGDYHSEMNMSSLELGDSASYLCASSV
Tupaia chinensis V182 trbv ALAR01033753.1 33950 YTDAGVSQSPKHRVTVRGQNVTLKCDPISGHDFLYWYRQTLGQSLEFLAYFQNKYLSDKSGLPSDRFTPERPEGSFSMLRIQPAEPGDSALYLCASSL
Tupaia chinensis V183 trbv ALAR01033753.1 40051 SVNIGVTQSPRYVITEKKGQATLKCYPISGHKSVSWYQKAPDQGPQFLVSYFEESEYYKGIISDRFSAKQFSDNHSEMNMSSLELGDSASYLCASSL
Tupaia chinensis V184 trbv ALAR01033753.1 42533 SVNIGVTQSPRYLITEKKGQATLKCYPISGHKSVSWYQKAPDQGPQFLVSYFEESEYYKGIISDRFSAKQFSDNHSEMNMSSLELGDSASYLCASSL
Tupaia chinensis V185 trbv ALAR01033753.1 46632 PTDAGITQSPRQKVTVKGKNVTLQCHQNDNHGYMYWYRQDLGHGLRLIHYSFGVNDTNKGDIPDGYRVSRSKTENFPLTLESPTPSQTSVYFCATSD
Tupaia chinensis V186 trbv ALAR01033753.1 51027 LIAAGVTQSPRLKISEKGQIIAFWCDPISGYNTLYWYRQRPGQGPELLTYFQNEAMVGESLLPKDRFSAERPKGADSTLKILRAELGDSAVYLCASSL
Tupaia chinensis V187 trbv ALAR01033753.1 65570 HTDAGVIQTPRHKVTEMGQTVTLNCEPISGHTDLFWYRQTTVQGLELLTYFRSRSPMDEGVMPKDRFFAEMPTGSPSTLRIQPTEPKDSAVYLCASSV
Tupaia chinensis V188 trbv ALAR01033753.1 72140 LMAAGITQSPRLKISEKGQVVTLWCDPISGHVTLYWYRQRPGQGPELLTYFQNAATVDESLLPKEQFSAERPKGADSTLKILRAELGDSAVYLCASSL
Tupaia chinensis V189 trbv ALAR01033753.1 80712 HTDAGVTQTPRHKVTEMGRAVTLNCEPISGHAALLWYRQTIRTLEFLIYFNNKAPVDDSGMPKGRFFAKMPNASLSTLEIQSTEPRDSAVYFCASST
Tupaia chinensis V190 trbv ALAR01033754.1 2877 TTCGSITQTPKYVLREEGQSVNLECEQNLNHDSMYWYRQDPGEGLRLIYYSLVVRDIQKGDLAEGYSTSREKKPSFPLAVTSTQKDHSALYLCASSL
Tupaia chinensis V191 trbv ALAR01033754.1 10823 SGLGALVSQHPSRAICKSGKSVKIECRFTDFQSSTVFWYRQFQKQNFILIATSNMGSSATYEEGFTPTKFPISHPDLTHSTLMVTSEHPEDSGFYFCGAS
Tupaia chinensis V192 trbv ALAR01033754.1 20678 SVDDEVTQSPRFLVKEKEQKAKMDCVPRKGHSYVYWYRKKLEEELKFLVYFQNDEPLEKTDVINERVLAHCPKNSSCSVEIQSAELGDSALYFCASSQ
Tupaia chinensis V193 trbv ALAR01033759.1 4584 SVDTTVTQTPRNKITKTGENITLECSQTKGHDRMFWYRQDPGLGLQLIYYSMGDKDVNKGAISDGYRVSRPEQAKFFLFLETAIPSQTALYLCASRH
Tupaia chinensis V194 trbv ALAR01033761.1 71 FNSAVVLQFPRHRVSKTEKELTLQCSQNMSHLAMYWYRQDPGSGLQLVYYSPGTGITEKGEVSEGYRVSREQIDYFPLTLESASSTQTSVYICASSS
Tupaia chinensis V195 trbv ALAR01033762.1 1658 PMEAQVTQTPRYLITKTGKTLTMTCSQNMDHESMYWYRQDPGLGLKLIYYSINVEIIDKGDIPDGYTVSRKEKKNFPLSLKSPSTNQTSLYLCASSV
Tupaia chinensis V196 trbv ALAR01033762.1 5190 LMDAEVSQTPRHLITTVGKKVFLECLQHMNHERMFWYRQDPGLGLQLIYFSYDKDMNEKGDVPEGYDVSRKKRECFSLILESASTNQTSLYLCASSL
Tupaia chinensis V308 iglv ALAR01070948.1 2223 SWADVTFTQPSSVSGSPGQKVTISCTRSSGNIGDNYVYWYQQRLGSAPTLLIYRDNQRPSGVPNRFSGSIDGSSNSAYLTISDVQPEDEADYYCQSGYGND
Tupaia chinensis V309 iglv ALAR01070949.1 579 SWADVTFTQPSSVSGSPGQKVTISCTRSSGNIGDKYVYWYQQHPGSAPTLLIYRDNQRPSGVPNRFSGSIDGSSNSAYLTISDVQPEDEADYYCLSSYDN
Tupaia chinensis V310 iglv ALAR01070949.1 4013 TVAQARLTQVPSVSQILGHTVTLTCTGNSNNVGYEGAAWLQQHPGLVPKLLTHRNNNRALGVSERFSGSRSGDIASLTISDLQPEDEADYYCTAWDRSVG
Tupaia chinensis V311 iglv ALAR01070949.1 7635 TVAQARLTQVPSVSQILGHTVTLTCTGNSNNVGYEGAAWLQQHPGLVPKLLTHRNNNRALGVSERFSGSRSGDIASLTISDLQPEDEADYYCTAWDRSVG
Tupaia chinensis V312 iglv ALAR01070949.1 12554 TVAQARLTQLPSVSQNLRHTVTLTCKGDSNNVGNQGAAWLQQPPDQVPKLLTHRNNNRPPGVSERFSGSRSGDTASLTISDLQPEDEADYYCTAWDSSEN
Tupaia chinensis V313 iglv ALAR01070949.1 19133 SWAQTVLTQPSSVSGALSERVTISCRGGSSNIGRYDVHWYQQFAGTSPRLLIYDSSNRPSGIEDRFSGSKSGTSASLTISDLQAGDEGIYFCHSYDNSLN
Tupaia chinensis V314 iglv ALAR01070951.1 2034 SGATFVLTQPGSVSGSPGEKVTISCTRDSGSIGSYYVSWYQQRPTSAPTTLIYQYNQRPSGVPDRFSGSIDSSSNAASLTISGLQPEDESIYFCLSYDSNSN
Tupaia chinensis V315 iglv ALAR01070951.1 10347 SLSQPVLTQSPSTSASPGASAKLTCTLSREHSTYTIAWYQQQPGKAPRYVMWLKSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYFCGADHSYNY
Tupaia chinensis V316 iglv ALAR01070951.1 19795 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGYGYNVHWYQQLPEKAPRLLIYENNKRPSGVSDRFSGSKSGNSGSLTISGLQAEDEAVYYCHSYDRNLD
Tupaia chinensis V317 iglv ALAR01070951.1 30370 SLSQPVLTQPPSLSASPGASARLTCALSSGFAVSRYDMYWHQQKPGSPPRYLLRHYTDSDIHQGSGVPSRFSGAKDISANAGVLHISELQPEDEAHYYCGF
Tupaia chinensis V318 iglv ALAR01070952.1 9357 AASQVVVTQEPSLSMTPGGTVTLTCGSSAGAVTTSNHATWVQQMPYQAPRGLISGTNYRIPGVPARFSGSLLGGKAAFTITGAQPEDEAEYFCALWHGDH
Tupaia chinensis V319 iglv ALAR01070952.1 15293 CADPAALLSASPGASVRLTCTLSMGFSVGSYAIFWYQQKSESRPRYLLYYHTDSNKHQGTGVPSRFSGSKDSSANAGVLHISGLQTEDEADYYCMI
Tupaia chinensis V320 iglv ALAR01070953.1 6199 SLSQPVLTQSPSTSASPGASAKLTCTLSSGHSTYYIEWYQQQPGKAPRYVMYVNSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYICGVPDGSNY
Tupaia chinensis V386 ighv ALAR01085935.1 13555 VLSQVQLQESGPGLVKPSQTLSLTCFVSGFSITTSGYYWHWIRQSPGKGLQWVGEISYSGVAKYNPALKSRSSISRDTSKNQLSLQLSSVTPEDTALYYCVG
Tupaia chinensis V423 igkv ALAR01096623.1 39271 TMGEAVLTQTPASLSLSPGERASLTCRASQGISNYVAWYQQKPGQAPRLLIYGASTRASGMPDRFSGSGSGTDFTLTISSLEPEDLALYYCYQYYSG
Tupaia chinensis V424 igkv ALAR01096623.1 44433 SSGDVVLTQTPLSLTVMPGEPASISCRSSHSLLHTDGNTYLSWYVQKPGQFPQLLIYKVSSHVSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYHCQQARHTP
Tupaia chinensis V425 igkv ALAR01096623.1 93912 SSGDVVMTQTPLSLPINPGETVSISCKSSQSLLHSNGNTYLHWLQQKPGQAPQGLIYGVSNRISGVPDRFSGSGSGTDFTLKISRVEAEDAGIYYCAQA
Tupaia chinensis V426 igkv ALAR01096624.1 13646 SSGDIVMTQTPLSLPVILGETVSISCKSSQSLLHSNGNTYLYWLLQKPSQEPRMLLYKVSNRYSGVSDRFSGSGSGTDFTLKISRVEAEDAGVYYCAQSTSWS
Tupaia chinensis V427 igkv ALAR01096625.1 18755 SRGDIVMTQTPLSLPVILGESVSISCRSSRSLLSSDGNTYLNWLLQKPGQAPRLLIYMVSNRFSDVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCLQVIQYP
Tupaia chinensis V428 igkv ALAR01096626.1 3417 SSGDIVMTQTPLSLSINPGEPASISCRSSQSLLHSNGNIYLQWLLHKPGQAPRLLINKASNRLSDVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQDMQQP
Tupaia chinensis V429 igkv ALAR01096626.1 4516 SSGDIVMTQTPLSLSINPGEPASISCRSSQSLLHSNGNIYLQWLLHKPGQAPRLLINKASNRLSDVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQDMQQP
Tupaia chinensis V430 igkv ALAR01096630.1 3394 SSGDVVMTQTPLSLPVIPGETVSISCKSSQSLLHSNGNTYLSWLLQKPGQAPQGLIYKVSNRISGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCVQGTKL
Tupaia chinensis V431 igkv ALAR01096636.1 4550 SSGDVVMTQTPPSLPIIPGETVSISCKSSQSLLHSNGNTYLHWLQQKPGQGPQGLIYDVSNRDSGVPDRFSGSGSGTDFTLKISRVEPEDVGIYFCVQG
Tupaia chinensis V432 igkv ALAR01096644.1 492 SSGDVVMTQTPLSLPVIHGETVSISCKSSQSLLHSDGKTYLYWLQQKPGQAPRRLIYQVSNRDPGVPDRFSGSGSGTDFTLKISRVEAEDAGIYYCAP
Tupaia chinensis V433 igkv ALAR01096645.1 1187 SSGDVVMTQTPLSLPIIPGETVSISCKSSQSLLHSDGNTYLHWLQQKPGQGPQGLIYVVSNRVSGVPDRFSGSGAGTDFTLKISRVEPEDVGIYYCVQG
Tupaia chinensis V434 igkv ALAR01096648.1 3669 SSGDVLMTQTPLSLPINSGETVSISCKSSQSLLHSNGNTYLEWLQQKPGQAPRRLIYGVSNRDSGVPDRFSGSGSGTDFTLKISRVKPEDAGIYYCMQV
Tupaia chinensis V435 igkv ALAR01096651.1 4735 ARCDIQMTQSPSSLPASLGDKVTISCRASQGISSTLHWYQQKPGKSPKLLIYGASSLQTGVPSRFSGSGSGTDFTLTINNLEAEDVGIYFCQQGYSTP
Tupaia chinensis V436 igkv ALAR01096655.1 10554 ARCDIQMTQSPSSLSASLGDRVTISCRASQGISKWLAWYQQKPGKAPKPLIYEASKLHSGVPSRFSGSGSGTDFSLTISNLEPDDFGIYYCQQYNSYP
Tupaia chinensis V437 igkv ALAR01096657.1 3941 ACGDIVMTQSPGSLAASVGQRVTINCKSSQSLLSSSNQKNYLAWHQQKPGQAPKLLISWASTRAPGIPDRFSGSGSGEDFTLTISSLRPEDTAAYYCQQYYSAP
Tupaia chinensis V438 igkv ALAR01096658.1 4823 SSGEIVLTQSPASMAVSQRETVTITCRASESVNNNYLHWYQQKPGVPPKLLIYGTSNLASGVPARFSGSGSGASFSLTISRVETEDFANYYCQQWSSNP
Tupaia chinensis V526 ighv ALAR01163693.1 1330 VLCDVQLVETGGDLRQPGGSLTLSCKASGFTFTDYPMYWVRLSASAHRGLEWVSRGFQSGGINRASLWVQGRFRIARDNPTNTVSLKMDNLKVEDTGLYYCT
Tupaia chinensis V566 iglv ALAR01179378.1 4825 SRSLPVLIQLPSLFAFLGTSARLTCTLGSGFSVGKFWISWYQQKPGNPPRYLLPFHSDSDKHQGSGFPSRFSRTNDASANTGILHISGLQPEDQANYYCRTYHG
Tupaia chinensis V592 ighv ALAR01193937.1 9067 VLSQVQLQELGPGLVKPSETLSLTCTVSGFFLTSYAVHWVCQAPGKGLEWVEVIGTGGSTYYNPALKFRASITRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia chinensis V593 ighv ALAR01193940.1 3124 VLSQVQLQELGPGLVTPSQTLSLTCTLSGFSITTSGYCWEWIRQPPGKGLEWVGRICYNGNTHYTPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCAR
Tupaia chinensis V594 ighv ALAR01193949.1 43 VLSQVQLQESGANLVKPSETLSLTCTVSGFSLTSYHMLWVRQAPRKGLEWIGVIWSSGSTGYNPALKSRASISRDTSKSQSYLSLRSLTPEDTATYFCTR
Tupaia chinensis V605 ighv ALAR01198582.1 1780 RPEGVRSWAGEAWETLTLTCTVSGFSLSTLGIAVSWIRQPPGKRLEWLSLIYWDDDKGYSPSLKSRLAISKDNSKNQVFLKMSIMDPADTVTYYCAR
Tupaia chinensis V623 iglv ALAR01206937.1 3802 ICHLASLSIHWVPGPEGAISCTGSSNNIGDNSVHWYQQLPGTVPNLLIYDDSDGPLQVLDQFSASKSGTLASLAISGLQALDEADYHCQCYD
Tupaia chinensis V629 igkv ALAR01209833.1 11053 SSGDVVMTQTPLSLPVIPGETVSISCKSSQSLLHSDGKTYLNWLLQKPGQAPRRLIYRVSNRDPGVPDRFSGSGAGTDFTLKISRMEAEDAGVYYCLQG
Tupaia chinensis V641 igkv ALAR01216079.1 925 SSGDIVLTQSPALLPGSPGDTVTITCRTSEGISTNLHWYQQKRDQAPKLLIKYASQSVSGVPSRFSGSGSGTDFALTIKNMEAEDAAVYHCHQGNSYL
Tupaia chinensis V648 igkv ALAR01218283.1 1132 ARCDIQMTQSPSSLSASLGDRVTISCRASQGISKWLAWYQQKPGKAPKPLIYEASKLHSGVPSRFSGSGSGTDFTLTINNLEAEDVGIYFCQQGLQYP
Tupaia chinensis V657 ighv ALAR01222023.1 1288 VLAQVVLKESGPGLVKPGETLSLTCTVSGFSLSTSGIGVGWIRQPPGKPLEWLSQIDWEDDKYYNPSLKSRLAISKDNSKNQVFLKMSSMDPADSATYYCARS
Tupaia chinensis V675 igkv ALAR01230430.1 931 TRAETTLTQSPGLVSAVLGDKVDITCKASQDIDDDLHWYQQKPGEAPTLIIKGVSTLISGVPSRLSGSGYGTDFTLTINNVEQEDAAYYFCQQDDN
Tupaia chinensis V681 iglv ALAR01233059.1 7384 SHSQPVLTQPPSLSASPGASARFTCTLSSDFSVGDYWIKWYQQNPESPPWFLLNYYSESNKQQGSRLPSHFSGSKDTLASAGVLHIAGLQPVDEADYFCAI
Tupaia chinensis V703 iglv ALAR01242407.1 156 SVTSSALTQPPALSVTLGETVSIICQGEDLESSYVHWHQQKPGQRPALLIYGDSDRVSGVPDRFSGSSSGGTATLTITGVQAEDEADYYCQSWYDSDNP
Tupaia chinensis V704 iglv ALAR01242408.1 4618 SVESYELTQLSSVSVALGQTATITCSGDLLDKKYTQWYQQHPDRAPVAVIYKDTERPSGVPDRLSGSTSGKTATLTITGAQAEDEADYYCQSSDSDKNY
Tupaia chinensis V705 iglv ALAR01242410.1 1081 AVSSYDLTQPSSVSVALGQTATIACSGDLLDKKYTRWFQQHPGQAPVPVIYKDTERPSGVPDRFSGSSSGKTATLTITGAQAEDEADYYCLSPDSDNN
Tupaia chinensis V790 trdv ALAR01030508.1 29399 KGMLCNQVTQSSRELAVASGSGVVLPCTYSTSYSNPGLYWYREKPDGTFQFILYRDNSRSLNAEFTKGRFSVKRNQNQKTFHLVINPVRMEDSALYFCAL
Tupaia chinensis V791 trdv ALAR01030508.1 24573 KGMLCNQVTQSSRELAVASGSGVVLPCTYSTSYSNPGLYWYREKPDGTFQFILYRDNSRSLNAEFTKGRFSVKRNQNQKTFHLVINPVRMEDSALYFCAL
Tupaia chinensis V798 iglv ALAR01032493.1 6497 SVPSSAVTQSPSVSVALGQTVKITCQGGDLRILPANWYQQKPDQSPALLIYGDSSRASGVPERFSGSRSGGTATLTITGAQAEDEADYFCQSTDSLTL
Tupaia chinensis V799 iglv ALAR01032494.1 18349 FVASSALDQPPSVSVALGETVSLTCQGGGLGNYKAHWEQKKPGQRPVLVLYGDSNLASGVPDRFSGSRSGDTATLTITEAQAEDEADYYCQTLDPSGKT
Tupaia chinensis V800 iglv ALAR01032494.1 12132 SVTSSVLTQPSAVSVALGQTTRITCQGGVLEIIFANWYQQKPGQRPAPLIYYNDDRASGVPERFSGSRSGEMATLTITGAQAEDEADYYCQSWDSSGE
Tupaia chinensis V801 iglv ALAR01032496.1 14172 SVASSALNQQSSVSVALGQTVRLPCQGGGLGSYYSHWYQQKPGQRPALFIYGDSSRASGVPDRFSGSRSGGTATLTITGAQAEDEADYFCQSWD
Tupaia chinensis V802 iglv ALAR01032496.1 1295 SVASSALNQPPSVSVALGQTVRITCQGGGLGSYYSHWYQQKPGQRPALFIYGDSSRASGVPDRFSGSRSGGTATLTITGAQAEDEADYFCQSWDSSGTS
Tupaia chinensis V939 trav ALAR01074092.1 8161 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Tupaia chinensis V1000 iglv ALAR01092218.1 11521 SWAQPVLTQPPSVSGTLGQSVTISCTGSSSNVGGRDVSWYQQLPGTAPKLLIYKDNNRPSGIPDRVSGSKSGSSASLTISGLQVEDEADYHCHAYDYS
Tupaia chinensis V1001 iglv ALAR01092218.1 6770 SLSQPVLTHVLTQPPSPSASPGASVRLTCALSSDISVDGYWINWYQKKATSPRYLLSYYSDSVKHQGTGVPSRFSGSKDTSANAGVLHISGLQPEDEADYYCSI
Tupaia chinensis V1002 iglv ALAR01092218.1 497 SLSQSVLTQPPSLSASPGASVRLTCALTSGFTVSGYHMSWYQQKPGSRPRYLLKYKSDSEKPQGSGVPSRFSGSKDTSANAGVLHISGLQPEDEGDYYCAT
Tupaia chinensis V1003 iglv ALAR01092220.1 8345 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGYGYDVHWYQQLPEMTPRLFIYGNSNRPSGVPDQFSGSKSGISASLTISGLQAEDEADYYCQSWDRNADG
Tupaia chinensis V1004 iglv ALAR01092224.1 1799 SLSQPVLTQPPSLSASPGASARLTCALSSGFSVGGYGISWYQQKPGSTPRYLLYHYSSTALGTGVPSRFSGSKDTSANAGVLHISGLQPEDEADYYCLT
Tupaia chinensis V1005 iglv ALAR01092226.1 4840 SLAQPVLTQSPSTSASPGASAKLTCTLSREHSTYIIEWYQQQPGKAPRFVMQLKSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYICGVSYSNS
Tupaia chinensis V1006 iglv ALAR01092229.1 1119 AASQVVVTQEPSLSMTPGGTVTLTCGSSAGAVTTGNYAAWVQQMPYQAPRGLIGGTSNRYSGVPARFSGSLLGGKAALTITGAQPEDEAEYFCALWYSNH
Tupaia chinensis V1007 iglv ALAR01092235.1 1965 TWAQSVLTQLSSVSGAPGQRVTISCTGSSNNIGGNYVHWYQQLPGTSPRLLIYENSNRPSGIADRFSGSKSGTSASLTISGLQAEDEAVYHCQSYDDSLKA
Tupaia chinensis V1008 iglv ALAR01092237.1 430 PCAQSVLTQPSSVSGALGQRVTTSCAGSSNNTGIFDVHWYQQLPGTTPRLLICENNRQPSGVPVRFSGSKSESSASLPISGLQAEDEAGYHCQSWDLRQNI
Tupaia chinensis V1023 igkv ALAR01096646.1 1875 SSGDVVMTQTPLSLPIIPGETVSISCKSSQSLLHSDGNTYLSWLLQKPGQAPRGLIYQVSNRESGVPDRFSGSGSGTDFTLKIRRVKAEDVGIYYCLQA
Tupaia chinensis V1024 igkv ALAR01096655.1 15756 ASTNTTLTQFPAYLSVSLKESISIICKASQSVSDYVTWYQQKPGQSPKIIIYDADNRYSGVPDRFTGIQSGTEFIFKISSVEAEDTANYYCQQDYSLP
Tupaia chinensis V1025 igkv ALAR01096660.1 2396 SSGDIVMTQTPLTLSVIPGEPASISCRSNQSILHSDGKTYLKWYQQKPGQSPQLLIYEVSNRFSEAPDRFSGSGSETDFTLKISRVEVEDAGVYYCMQG
Tupaia chinensis V1026 igkv ALAR01096661.1 7387 AKCDIQMTQSPSSLPASLGDRVTISCRASQSISKWLAWYQQKPGKAPKLLIYYATSLQTGIPSRFSGSGSGTDFTLTISSLEPEDVGSYYCQQYSSAP
Tupaia chinensis V1115 iglv ALAR01120649.1 25534 SWAQSGLTQPPSVSEALGQSVTLSCTGSSNNIGKDYGVQWYQKLPGTAPRLLIYSNSIRPSGSLHRFSGSKSGTSASLTISGLQAEDEADYYCQSWDSDLR
Tupaia chinensis V1117 iglv ALAR01120653.1 10093 SLSQPGLTQPPSLSASPGASVRLTCTMSGGFSIGSYGIMWYQQKPGSPPHYLLMYHTESIKHQGSGVLSRFYGSQDASANAGVLHISGLQPEDEADYYCQTYH
Tupaia chinensis V1118 iglv ALAR01120656.1 6256 SWAQSVLTQTPLVSGPPGQRVTISCSGHSNNFGSGYSVHWYQQLPGMAPRLIYEDTERPSGAPDRFSSSRFGTSASLTISGLQAEDEADYHCQSWDG
Tupaia chinensis V1119 iglv ALAR01120662.1 1312 SEALGQSVTLSSVSEALGQSITLSCTGSSDNIRKDYGVQWYQQLPGTAPRLFIYSNSIRPSGSLHRFSGSKSGTSASLTISGLQGEDKADYYCQSWDSSLR
Tupaia chinensis V1120 iglv ALAR01120671.1 337 SLSQPVLTQPPSLSASPGASARITCTVSSGFNVGDYWIKWYQQNPESPPRFLLNYYSESNKHQGSGVPSRFSGSKDTSANAGVLHIAGLQPEDEADYYCAI
Tupaia chinensis V1134 trav ALAR01163810.1 1389 DARAQSVTQPDSHVTVSEKASLELRCTYSSSSAPYLFWYVQYPGQGLQLLLRYYSGDSLVKGSNGFEAEFKKSDSSFHLRKPSVHWTDTAEYFCALG
Tupaia chinensis V1135 trav ALAR01163811.1 11727 VRGFQVEQSPSVLRLQEGTDSTLRCNFSATIRNMQWFRQIPGSSLISLFFMTSGIKQNGRLEATVNSKDRYSTLHITASHLEDSGTYLCAAEAQCPQ
Tupaia chinensis V1136 trav ALAR01163811.1 6379 VSRGENVEQRPSTLRVLEGDSSVINCSYSDSASDYFPWYKQEPGKGPQLIIDIRANKDKNHDQRLTVFLDKAKKHFSLHIAATQPGDSAIYFCAAR
Tupaia chinensis V1137 trav ALAR01163812.1 16061 GSKEDSVTQTEGQMTLSEGVSLTINCSYTTTRYPTLFWYVQYPGEGPQLLFKVSKANEKGRNKGFEATYNQEATAFHLQKASVQESDSAVYFCVLG
Tupaia chinensis V1138 trav ALAR01163812.1 9914 DARAQSVTQPDSHVTVSEKASLELRCNYSGTSTPYLFWYVQYPGQGLQLLLKYYSGDTLVKGSNGFEAEFKKSDSSFNLKKSSVHWTDTAEYFCVLR
Tupaia chinensis V1139 trav ALAR01163813.1 12437 LSDTMPPAGPNSYSSDSLNSLELRCNYSYGATPYLFWYIQYPGQGLQLLLKHISGDTLVKGINGFEAEFKKSESSFHLRKPSVHWIDTAEYFCALS
Tupaia chinensis V1140 trav ALAR01163813.1 7706 DTRAQSITQPDSHVTLSEGASLELRCNYSYGATPYLFWYIQYPGQGLQLLLKHISGDTLVKGINGFEAEFKKSESSFHLRKPSVHWIDTAEYFCALS
Tupaia chinensis V1141 trav ALAR01163814.1 1169 DTRAQSITQPDSHVTLSEGASLELRCNYSYGATPYLFWYIQYPGQGLQLLLKHISGDALVKGINGFEAEFKKSESSFHLRKPSVHWIDTAEYFCALS
Tupaia chinensis V1142 trav ALAR01163815.1 28693 TLGLAKTSQPLSMDAYEGQEVNMSCSHSSIATNEYIFWYRQFPNQGPQFFVQGYKTNIMNEASTLFIPGDRKSSILSLHRAALEDTAVYYCIVA
Tupaia chinensis V1143 trav ALAR01163815.1 22643 GTRAQSVTQPDVHVAVPEGAHLELRCNYSSSVPPSLFWYVQYPNQGLQLLLKYTSGNSLVTGIKNFEAEFRKSETSFHLKKTSAHLSDSAGYFCALS
Tupaia chinensis V1144 trav ALAR01163815.1 15225 VTGQKIDQNPQALSIQEGGKASLICNYTNYFPAYMQWYRQDPGKGLVFLLLIRENEGEKQKGRLRVTFDTARKQSSFHVSAAQPADSATYLCAA
Tupaia chinensis V1145 trav ALAR01163815.1 10793 RTHGDSVTQTEGPVTLSEEAALTLNCTYQTSNVVFLFWYVQYVNKAPQLLLKRSLGEDRAENEGFYANHIKDDSSFHLQKRSVQTSDSAVYYCAMR
Tupaia chinensis V1146 trav ALAR01163815.1 5397 ANGENQVEQSPRSLELQEEGASFMSCTYSVSGFNNLQWYRQDSGKGPQHLFSMYSPGDGKSKGRVRATLQKNGSSLHITALQLEDSATYFCAVA
Tupaia chinensis V1147 trav ALAR01163817.1 15768 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSWNPSLFWYVQYPNQGLQFLLKYVTGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia chinensis V1148 trav ALAR01163817.1 9974 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSRSPYLFWYVQYPNQGLQFLLKYISGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia chinensis V1149 trav ALAR01163817.1 6105 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSRSPYLFWYVQYPNQGLQFLLKYISGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia chinensis V1150 trav ALAR01163817.1 2086 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSWSPYLFWYVQYPNQGLQFLLKYISGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia chinensis V1151 trav ALAR01163818.1 11589 AESKDQVFQPSTMASSEGAVVEISCNHSVSNAYTFFWYLHFPGCAPRLLVKGTRPAQQGRYNMTYERFSSSLLIHQVQVADAAVYYCALEDTEAGS
Tupaia chinensis V1152 trav ALAR01163822.1 2900 TAGQSIEQPTELMAMEGAIAQVNCTYQISGFNGLSWYQQHDGKAPIFLSYNVLDGLERRGPFSSFLSRSDGYSYLLLQELHIKDSASYFCAVR
Tupaia chinensis V1156 iglv ALAR01164748.1 1167 SFAQPVLTQPPSLSASPGETVKLGCALSSDVNVGDRNMYWYQQKPGSPPRWFLYYYSDSDKELGPGVPSRVSGSKDKSKNTAFLHISGLQAEDEAVYYCHT
Tupaia chinensis V1170 iglv ALAR01169618.1 20438 SVFPGSLSQPALTQPPSVSASLGQVVTLTCTLNGGYNNYYVEWYQQRPGKGPWFVMTVGISGISGSKGDGIPDCFSGSGSGLDQFLTIQNLQEDEESDYHCGVS
Tupaia chinensis V1171 iglv ALAR01169624.1 6823 SLSQPVLTQPPSLSASPGASVRLTCTLSSGFSVGSYNIYWYQQKPGSPPRYLLWYFSDSSKHQSSSVPSRFSGSKDFSANVGVLHISGLQPEDEANYYCKI
Tupaia chinensis V1185 trav ALAR01174525.1 33863 DTRAQSITQPDSHVTLSEEASLELRCNYSYSVTPSLFWYVQYPGQGLQLLLKHISGDALVKGIKGFEAEFKKSDSSFNLRKPSVHWSDTAEYFCALS
Tupaia chinensis V1186 trav ALAR01174525.1 17120 DARAQSVTQPDSHVTVSEKASLELRCTYSGTSTPYLSWYVQYPGQGLQLLLRYYSGDTLVKGSNGFEAEFKKSDSSFHLRKPSVHWTDTAEYFCALR
Tupaia chinensis V1187 trav ALAR01174525.1 2337 VSRGENVEQHPSTLRVLEGDSSVINCSYSDSASSYFPWYKQEPGKGPQLIIDVRANKDKNYNQRLTVFLDKAKKHFSLHIVATQPGDSAIYFCAAS
Tupaia chinensis V1188 trdv ALAR01174529.1 32394 PSVAQKVVQIQSAVSRPAGTAVTLECAYETSQSSYFLYWYKQLPSGEIVFLISQSSYSQTGNNDRYSVTLRNLAKSISLTISSLQLEDSAKYFCALWE
Tupaia chinensis V1189 trav ALAR01174529.1 24739 GTRAQSVTQPDVHVAVPEGAHLELRCNYSSSVPSYLFWYVQYPNQGLQLLLKYSFGISLVTGIKNFEAEFRKSETSFHLKKTSAHLSNSAGYFCTLSDSA
Tupaia chinensis V1190 trav ALAR01174529.1 22148 VRGFQVEQSPPALSLQEGTDSTLRCNFSATVDNVQWFRQNPGGSLINLFFVASGKKQNGRLEAMVNSKDRYSTLHITASQLEDLGTYLCAAEAQCSQ
Tupaia chinensis V1191 trav ALAR01174529.1 15838 RTHGDSVTQTEGPVTLFEEAALTLNCTYQTSRTVFLFWYVQYVNKAPQLLKSSLDKQKTENEGFYANHIKDDSSFHLQKRSVQTSDSAVYYCAMR
Tupaia chinensis V1192 trav ALAR01174530.1 31384 LSGEDQVKQSPETLRLQEGNNSSLSCSYTVSTFGGVQWYRQDPGKGPELLFVLYSDGDDKQTGRLRATSSKKESTLHITAPMPEDSAMYLCAV
Tupaia chinensis V1194 trav ALAR01174530.1 16508 VSGIQVEQSPSALSLQEGASSTLWCNFSTSVTNVQWFRQNPGGRLITLFYVPSGTKRNGRLNATTVANERHSSLHVSSSQTTDSAVYYCAVGPQRSR
Tupaia chinensis V1195 trav ALAR01174531.1 866 RSNGDSVTQTEGPISLSEGTSLILNCTYQVSGFQTVNIFWYIQYLNKAPQLLLKSSREKQRTENQGFYADFVESKSSFHLQKPSVQTSDSAVYYCALR
Tupaia chinensis V1196 trav ALAR01174532.1 24685 GTGAQSVTQPDRSVSVSEGARLELRCNYSSSVSPYLFWYVQYPNRGLQLVLNYFVGATVVKGINGFQAEIRKSETSFHLEKPSAHLSDSAEYFCALS
Tupaia chinensis V1197 trav ALAR01174532.1 15071 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSDTTYYLFWYKQPPSGEMIALIRQDSYNEKNTSEGRYFLTFLKSARSINLTISASQLTDSAVYFCALR
Tupaia chinensis V1198 trav ALAR01174532.1 3502 RSNGASVTQTEGPITLSEGAPLILNCTYQVSGFQTPFLFWYIQYLSKAPQLLLKSSTGKQRTENQDFHADFVKDNSSFHLQKPSVQTSDSAVYYCALG
Tupaia chinensis V1199 trav ALAR01174532.1 1637 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSDTTYSLFWYKQPPTGEMIALIRQDSYNEKNASEGRYFLTFLKSARSINLTISASQLTDSAVYFCALR
Tupaia chinensis V1200 trav ALAR01174534.1 4961 VRSQQKEVEQSSESLSVAEGAIASLNCTYRDRASSYFAWYRQYSGKGPEMLILTFSSDKEEGRFTMKVNKDSLYVSLIIKDSQLHDSATYFCAV
Tupaia chinensis V1201 trav ALAR01174536.1 4390 VSRGENVEQHPSTLRVLEGDSSVINCSYSDSASSYFPWYKQEPGKGPQFIIDILASKVKNSKQRLTVFLDKAKKQFSLHITATQPGDTAVYFCAAR
Tupaia chinensis V1215 iglv ALAR01180415.1 336 CWAQSALTQLQLPSISGNPGERVSLSCVGSNSDIGSYNDVSWYQQHPETRPKLLIYGVNTRPSGIPDRFSGSKSGNTAFLTVSDIRPEDEATYYCASYRSGGT
Tupaia chinensis V1238 iglv ALAR01189979.1 1733 SVASSALTQPPALSVALGETVSITCQGGDLESNYANWYQQKPNQRPALFIYYDDEQASGVPDRFSGSSSGGTATLTITGAQAEDEADYFCQSAYS
Tupaia chinensis V1239 iglv ALAR01189981.1 30547 SVASSALTQPPAVSVALGETVSITCQGGDLGSYGANWYQQRPSLRPALLIYYDNSRASGVPERFCGSRSGGTTTLTITGAQAEDEADYHCQSLDSSGNL
Tupaia chinensis V1240 iglv ALAR01189981.1 26779 SVVSYDLTQTPSVSVALREMARITCQGNSIGSKNLPWYQQKPGQAPKLVIYGDSTRHSGIPDRFSDSNSGNTAALTISGAQDGDEADYYCQVWDSSDI
Tupaia chinensis V1241 iglv ALAR01189981.1 22841 SVASSALTQPPALSVALGETVSITCQGGDLESRYAHWYQQKPAQSPALLIYYDDEQASGVPDRFSGSSSGGTATLTISGAQAEDEANYYCQSAYSGNL
Tupaia chinensis V1242 iglv ALAR01189981.1 13396 SVASSALSQPLSVSVALGQTARVTCQGGGLGTYTVYWYQKDPGQRPVLIISRDSNRPSGVPDRFSGSRSGGTATLTITGAQAEDEADYFCQSWD
Tupaia chinensis V1243 iglv ALAR01189981.1 7027 FVASYDVTQPSSVSVALGLTARRITCGGDDIERNVVHWYQQTPGLTPKPVIRNNNERPSGVPDRFSGSNSGNTAALTINGAQSEDEADYYCQVWDSSNGI
Tupaia chinensis V1244 iglv ALAR01189981.1 1660 SVTSSVLTQPSTVSVALGQTARVTCQVGNLGSVFFKAHWYQQKPAQRPALLIYRDSNRASGVPDRFSGSRSGGMTTLTITGAQAEDEADYYCQSWGSGNL
Tupaia chinensis V1245 iglv ALAR01189982.1 10793 SVTSSAVTQPPAVSVALGQTARITCQIDGGLISYLFKANWYQQKPHQRPALLIYQDSNRASGVPERFSGSRSGGTATLTITGAQAEDEADYFCQ
Tupaia chinensis V1246 igkv ALAR01189982.1 6587 SAASSALTQPPVLSVALGGTVSITCLGEDLESNYAHWYQQKPGQHPALLIYEDSNRASGAPDRFSRSSSGGTATLAIARAEVDDESIYYCQSWDEEIDL
Tupaia chinensis V1247 iglv ALAR01189983.1 2660 SPVWETTLVGKLYTGTSRARGQTARITCGGDNIGRKSVHWYQQTPGTSPRLVIYDDNKRPSGIPDRFSGSNSGNTAALTISGAQAEDETDYYCHVWDSSNDI
Tupaia chinensis V1248 iglv ALAR01189984.1 14020 SVTSSAVTQPPSVSVALGQTARITCQIDGGLISYLFKANWYQQKPHQRPALLIYQDSNRPSGVPDRFSGSRSGGTATLTITGAQAEDEADYYCQSADSSGTI
Tupaia chinensis V1249 iglv ALAR01189984.1 7551 SVASFVLTQPPALSVALGQTVSITCQGGELEIFGVYWYQQKPAQHPTLLMDYIDFRASGVPERFSGSRSGGTATLTITGAQAEDEADYYCQSMDRSD
Tupaia chinensis V1250 iglv ALAR01189986.1 2434 SVASSALTQSSALSVALGGTVSITCRGGDLESSYAHWYQQKPAQRPALLIYRDSNRESGVPERFSGSSSGGTATLAITEIQVDDEAEYFCQSWDDEDNI
Tupaia chinensis V1251 iglv ALAR01189989.1 15040 SVASYDLTQPSSMSVALGQTARITCGGDNIGSNLVHWYQQTPGQAPRLVIYDDNERPSGIPDRFSGSNSGNTAALTISRTQAGDEADYYCQVRDSSDI
Tupaia chinensis V1252 iglv ALAR01189989.1 10908 SVASSALTQPSALSVALGGTVSITCQGGDFENNYVHWYQQKPAQRPALLIYRDSNLASGVPDRFSGSSSGGTATLAIARAQVEDEAVYFCQSGDDEDNI
Tupaia chinensis V1253 iglv ALAR01189989.1 2946 SVASSALNQPSSVSVALGQTVKITCQGGGIGSYYAHWYQQKPGQRPALLLYDDSKRPSGVPDRFSSSLSGGTATLTLTRAQAEDEADYYCQSWDSSAYA
Tupaia chinensis V1254 iglv ALAR01189990.1 39796 SVTSSVLTQSPAVSVSLGQTARITCQGGELGIVPAHWYQQTPGQSPALLLYNDNNRASGVPDRFSGSRSGGTATLTITGAQAEDEADYFCESLDNSGYV
Tupaia chinensis V1255 iglv ALAR01189990.1 33657 SVTSSALTQPPALSVALGETVRITCQGGDFESYPAHWYQQKPAQRPALFIYDDSNLASGAPDRFSGSSSGGTATLAITGAQVDDEAVYFCQSWYDESYL
Tupaia chinensis V1256 iglv ALAR01189990.1 23017 SVASSALTQPPAVSVALGETVSITCQGGDLGSYGANWYQQRPSLRPALLIYYDNSRASGVPERFSGSRSGGTATLTITGAQAEDEADYYCQSWDSSGEV
Tupaia chinensis V1257 iglv ALAR01189990.1 19292 SVASYDVTQQSSMSVTLGQTARIPCVGDNISWKTLHWYQQKPGTSPRLVIHNNNDRPSGIPDRFSGSTSGNTATLTISGAQDGDEADYYCQVWDSSDI
Tupaia chinensis V1258 iglv ALAR01189990.1 15210 SVASSALNQPFSVSVALGQTVRITCQGGGIGSYYADWFQQKPGQRPALLLYGNNNRPSGVPDRFSSSLSGGTATLTLTRAQAEDEADYYCYSADSSGN
Tupaia chinensis V1259 iglv ALAR01189990.1 8327 SVASSALTQPPSVSVALGQTARITCQGGSLGILSADWYQQKPDQSPALLLYGDSNRGSGVSDRFSGSRSGGTATLTITGAQAEDEADYFCLSLDSSD
Tupaia chinensis V1260 iglv ALAR01189990.1 1833 SVASSGLTQSPAVSVALGETVSITCQGGVIEILGAHWYQQKPGQRPALFIYDDSDRESGVPERFSGSRSGGTATLTITGAQAEDEADYFCQSADSSGNN
Tupaia chinensis V1279 iglv ALAR01195974.1 3903 SWAQSGLTQPPSVSEALGQSVTLSCTGSSNNIGKDYGVQWYQKLPGTAPRLLIYSNSIRPSGSLHRFSGSKSGTSASLTISGLQAEDEADYYCQSWDSDLR
Tupaia chinensis V1280 iglv ALAR01195978.1 1807 SWAQSVLTQPSSVSGALGQKVTISCKGSSSNIGNSNYVHWYQQLPETSPRLLIYENNNRPSEMPDRFSGSKSGTSASLTISGLQAEDEAIYHCHSYDDSLK
Tupaia chinensis V1281 iglv ALAR01195980.1 1297 SLSQPVLTQPPSLSASPGASARLTCALSSGLSVESYGISWYQQKPGSRPRYLLMYYSDSHKHQDSGVPSRFSGSKDTSANAGVLHISGLQPEDEADYFCGT
Tupaia chinensis V1282 iglv ALAR01195981.1 834 SWAQSVLTQPSSVSGALGQRVTISCAGSSDNIASNYVYWYQQLPEKAPRLLIYEDKRRPSGVSDRFSGSKSGNSASLTISGLQAEDEAHYHCLSYDDNLD
Tupaia chinensis V1330 iglv ALAR01212246.1 4413 SVTSSVLTQSPSVSVSLGQTTRITCQGGNLGSYYSHWYQQKPDQRPALLIYLDSNRASGVPDRFSGSRSGGTATLTITGVQAEDEADYFCQSVDSGNL
Tupaia chinensis V1351 ighv ALAR01225499.1 639 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYHMHWVRQAPGKGLEWVGEIWSGGSTDYNPALKSRASISRDTSKSQSYLSLRSLIPEDTAMYFCAR
Tupaia chinensis V1368 igkv ALAR01229520.1 2229 SSGDIVMTQTPLFLLIISGEQASISCRSNQSLLHSDGHTYLHWLLQKPGQAPQCLISKVSNRDAGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQG