WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Macaca fascicularis CAEC00000000.1 (CAEC01) 76 6 15 22 30 0 0 3
Macaca fascicularis AQIA00000000.1 (AQIA01) 292 67 48 66 44 56 7 4
Macaca fascicularis AEHL00000000.1 (AEHL01) 190 23 29 38 43 46 7 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Macaca fascicularis V8 iglv CAEC01016990.1 1059 QSVLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCLSLVIVIDPQESLTDFSGSKSGNLASLTITGLWPEDEADYHCQS
Macaca fascicularis V9 iglv CAEC01017021.1 8074 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca fascicularis V10 iglv CAEC01017039.1 8748 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRISGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca fascicularis V11 iglv CAEC01017044.1 794 SLSQPVLTQSPSASASPGASVKLTCTLSSGHSSYAIAWHQQQQGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Macaca fascicularis V12 iglv CAEC01017172.1 906 SLSQPVLTQPSSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Macaca fascicularis V13 iglv CAEC01017181.1 606 SWAQSVLTQPPAASGAPGQSVTISCSGSSSNIGSNDVYWYQQFPGTALKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDDSLSS
Macaca fascicularis V14 iglv CAEC01017186.1 1590 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPHWFQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca fascicularis V15 iglv CAEC01017202.1 1306 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSAWDSSLSG
Macaca fascicularis V16 iglv CAEC01017234.1 1990 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTTPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCLSYDSSLS
Macaca fascicularis V17 iglv CAEC01017251.1 5334 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGFLRGGKAVLAITGAQPEDEAFYYCALW
Macaca fascicularis V18 iglv CAEC01017351.1 10415 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVVYGNNNRPSGIPERFSGSSSGNTASLTITGAQVEDEADYYCDSWDSSGTH
Macaca fascicularis V19 iglv CAEC01017370.1 2422 SAASYELTQPPSVSAASGQTARITCGGDNIGSKNVQWYQQKPAQAPVLVIYGDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Macaca fascicularis V20 iglv CAEC01017389.1 1546 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYADWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca fascicularis V21 iglv CAEC01017391.1 2847 SWAQAAPTQPPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca fascicularis V22 iglv CAEC01017407.1 576 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V56 igkv CAEC01106407.1 5315 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSSP
Macaca fascicularis V57 igkv CAEC01106427.1 50 AKCDIQMTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTDVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Macaca fascicularis V58 igkv CAEC01106446.1 909 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca fascicularis V61 igkv CAEC01111386.1 7967 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPENVATYYCRQDYNTP
Macaca fascicularis V62 igkv CAEC01111416.1 4424 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Macaca fascicularis V63 igkv CAEC01111453.1 9302 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLHWYQQKPGKAPKLLIYAASTLQSGSHQGSAAVDLGQITLSPSAVLQPEDVATYYCQHSYGTP
Macaca fascicularis V111 trav CAEC01590262.1 5243 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca fascicularis V112 trav CAEC01590274.1 1142 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca fascicularis V113 trav CAEC01590300.1 1660 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca fascicularis V114 trav CAEC01590302.1 9494 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca fascicularis V115 trav CAEC01590304.1 6419 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNTDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca fascicularis V116 trav CAEC01590307.1 3328 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca fascicularis V117 trav CAEC01590319.1 2649 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Macaca fascicularis V118 trav CAEC01590319.1 15890 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca fascicularis V119 trav CAEC01590323.1 5561 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Macaca fascicularis V120 trav CAEC01590339.1 2161 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDSGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Macaca fascicularis V121 trav CAEC01590342.1 1276 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca fascicularis V122 trav CAEC01590342.1 15142 VSRGESVGLHLPTVTVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca fascicularis V123 trav CAEC01590343.1 1339 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQISYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca fascicularis V124 trav CAEC01590352.1 5009 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca fascicularis V125 trav CAEC01590353.1 22975 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Macaca fascicularis V126 trav CAEC01590364.1 765 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca fascicularis V127 trav CAEC01590366.1 1044 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVRLVLIRSNEREKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Macaca fascicularis V128 trav CAEC01590380.1 2064 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQEMNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca fascicularis V129 trav CAEC01590388.1 20986 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca fascicularis V130 trav CAEC01590494.1 310 TIIDAKTTQPTSMDCAEGRAVNLPCNHSTIGGNEYIYWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca fascicularis V131 trav CAEC01590501.1 3152 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca fascicularis V132 trav CAEC01590509.1 4695 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca fascicularis V133 trav CAEC01590511.1 3152 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLTASQLSYSGTYFCGAE
Macaca fascicularis V134 trav CAEC01590522.1 1931 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISAPVPSDVGTYFCAG
Macaca fascicularis V135 trav CAEC01590524.1 1653 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGVEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca fascicularis V136 trav CAEC01590537.1 375 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca fascicularis V137 trav CAEC01590551.1 11657 SGMAQTVTQSQQEMSVQEAETVILSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca fascicularis V138 trav CAEC01590555.1 2005 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYR
Macaca fascicularis V139 trav CAEC01590567.1 2943 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca fascicularis V140 trdv CAEC01590580.1 1151 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDAGTYYCASD
Macaca fascicularis V141 trdv CAEC01590582.1 7038 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca fascicularis V192 trav CAEC01009805.1 1451 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Macaca fascicularis V242 igkv CAEC01106447.1 3970 SNGEIVLTQSPTSIAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQGHSI
Macaca fascicularis V243 igkv CAEC01106454.1 750 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca fascicularis V244 igkv CAEC01106456.1 10242 SSGDIVMTQTPLSLPFTPGEPASISCRSSQSLVDSDGNTYLCWYLQKPGQSPRLLTYKVFFNLFSVVPDRFSGSGSETDFTLKISRVEAEDVGFYYCTQS
Macaca fascicularis V245 igkv CAEC01106466.1 10769 AKCDIQMTQSPSSLSASVGDRVTITCQASQSISSWLAWYQQKPGKAPKPLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSAP
Macaca fascicularis V246 igkv CAEC01106515.1 2190 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Macaca fascicularis V247 igkv CAEC01106547.1 318 ARCDIQMSQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYANSLASGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQGNSNP
Macaca fascicularis V248 igkv CAEC01106572.1 11635 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISDYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQGYSTP
Macaca fascicularis V249 igkv CAEC01106572.1 1132 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYYASNRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQQYNNW
Macaca fascicularis V250 igkv CAEC01106577.1 351 TKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNSDP
Macaca fascicularis V251 igkv CAEC01106590.1 12194 TAGEIVMTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca fascicularis V252 igkv CAEC01106644.1 3649 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca fascicularis V253 igkv CAEC01106645.1 1299 VRGDIQMTQSPSSLSASVGDTVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSYP
Macaca fascicularis V254 igkv CAEC01106658.1 3408 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca fascicularis V255 igkv CAEC01106663.1 4232 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca fascicularis V256 igkv CAEC01106667.1 7875 TRCAIQMTQSPSSLSASVGDTVTITCRASQSISSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKCDSAP
Macaca fascicularis V257 igkv CAEC01111323.1 8783 SGDMILNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca fascicularis V291 trdv CAEC01590590.1 6679 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca fascicularis V295 ighv CAEC01611247.1 3260 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNQISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca fascicularis V296 ighv CAEC01611355.1 2711 VQGEVQLVESEGNFVQPGGSLRLSCAVSGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVNSLFAISRGNAKNTLYLQMNSLIAEDTAIYYCVSE
Macaca fascicularis V297 ighv CAEC01611362.1 1308 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDSATYYCAK
Macaca fascicularis V298 ighv CAEC01611381.1 11436 VQCEVQLVESGAGLVQPGGSLRLSCAASGFTFSNSWMSWVRQAPGKGLEWVARIKRKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Macaca fascicularis V299 ighv CAEC01611404.1 4017 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPSRKTLEWLAHIYWGDDKRYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca fascicularis V300 ighv CAEC01611408.1 3380 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Macaca fascicularis V45 iglv AQIA01007566.1 12278 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V46 iglv AQIA01007569.1 1994 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca fascicularis V47 iglv AQIA01007574.1 14069 SWAQAAPTQPPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca fascicularis V48 iglv AQIA01007574.1 37776 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca fascicularis V49 iglv AQIA01007574.1 45214 SVASYELTQPLSVSVALGQMARITCGGNNIGRKYVYWYQQKPDQAPVLVIYEDSKRPSGIPEQFSGSNSGNTATLTIDGAQARDEADYYCQVWDS
Macaca fascicularis V50 iglv AQIA01007574.1 48580 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca fascicularis V51 iglv AQIA01007575.1 6773 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca fascicularis V52 iglv AQIA01007575.1 13646 SVASYELTQPPSVSVSPGQTAKITCSGEILAKKYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTVSGAQAEDEADYYCYSGDDNS
Macaca fascicularis V53 iglv AQIA01007576.1 8745 SAVSYELTQPPSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVLVIYYDSDRPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V54 iglv AQIA01007576.1 13223 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca fascicularis V55 iglv AQIA01007576.1 19714 SWAQAALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Macaca fascicularis V56 iglv AQIA01007576.1 37608 SAASYDVTQPRSVSVSPGQTARITCGGDNIGSKVVHWYQQKPAQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V57 iglv AQIA01007576.1 45244 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVVYGNNNRPSGIPERFSGSSSGNTASLTITGAQVEDEADYYCDSWDSSGTH
Macaca fascicularis V58 iglv AQIA01007576.1 63775 SWAQAALTQPPSVSKSLGQSVTISCAGTSSGIASYSDVSWYQQHPGTAPRLLIYRVSNRPSGVSDRFSGFKSGSTASLTISGLQAEDEAIYYCCSYRSG
Macaca fascicularis V59 iglv AQIA01007576.1 72189 SATSYELTQPPSVSAASGQTARITCGGDNIGSKNVQWYQQKPAQAPVLVIYADSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V60 iglv AQIA01007583.1 3313 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRAGKAVLTITGAQPEDEAFYYCALW
Macaca fascicularis V61 iglv AQIA01007584.1 1281 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca fascicularis V62 iglv AQIA01007585.1 7572 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYHIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Macaca fascicularis V63 iglv AQIA01007586.1 10047 SNSQAVVTQEPSLTVSRGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCL
Macaca fascicularis V64 iglv AQIA01007586.1 17182 SLSQPVLTQPTSLSASPGASARLSCTLSSGINVGSYSIYWYQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Macaca fascicularis V65 iglv AQIA01007586.1 27897 SWAQSVLTQPPSVSAVPGQKVTISCSGSSSNIGRSCVSWYQQVPGTAPKLLIYQDNKRPSGVSDRFSGSKSGTSASLAITGLQTGDEADYYCSAWDSSLS
Macaca fascicularis V66 iglv AQIA01007586.1 32058 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVYWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEAEYYCETWDNSLNG
Macaca fascicularis V67 iglv AQIA01007586.1 37069 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYYVYWYQQFPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDSSLS
Macaca fascicularis V68 iglv AQIA01007586.1 42888 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTTPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCLSYDSSLS
Macaca fascicularis V69 iglv AQIA01007587.1 5321 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca fascicularis V70 iglv AQIA01007587.1 10145 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVNWYQQLSGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDSSLSG
Macaca fascicularis V71 iglv AQIA01007588.1 1408 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNDVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDDSLSS
Macaca fascicularis V72 iglv AQIA01007588.1 10354 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPHWFQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca fascicularis V73 iglv AQIA01007588.1 19882 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGMAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDNSLSG
Macaca fascicularis V74 iglv AQIA01007588.1 28947 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLYYSGA
Macaca fascicularis V75 iglv AQIA01007589.1 4143 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSQSGTSASLTITGLQSEDEADYYCQSYDSSLS
Macaca fascicularis V76 iglv AQIA01007589.1 20048 SLSQPVLTQPSSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Macaca fascicularis V77 iglv AQIA01007589.1 26791 SLSQPVLTQPTSLSASPGASARLTCTLSSGISVGSYRIFWYQQKPGSPPRYLLNYHTDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Macaca fascicularis V78 iglv AQIA01007590.1 12134 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSSYVYWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSG
Macaca fascicularis V79 iglv AQIA01007590.1 50016 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca fascicularis V80 iglv AQIA01007590.1 59343 SWAQSVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVSKRPSGVLDRFSGSQSGTSTTLGITGLQSEDEADYYCSAWDSSLS
Macaca fascicularis V81 iglv AQIA01007599.1 24868 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQQGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Macaca fascicularis V82 iglv AQIA01007600.1 7014 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADGSYN
Macaca fascicularis V83 iglv AQIA01007600.1 47715 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRISGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca fascicularis V84 iglv AQIA01007601.1 22496 QSVLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCLSLVIVIDPQESLTDFSGSKSGNLASLTITGLWPEDEADYHCQS
Macaca fascicularis V85 iglv AQIA01007601.1 95902 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca fascicularis V86 iglv AQIA01007605.1 38319 VDSETVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCTLYMGSGI
Macaca fascicularis V87 ighv AQIA01007915.1 45467 VQCEVQLVEPGGGLVQPGGSMRLSCAASGFTFSSYGMSWVHQTPGKGLEWVSTISGNGVSTWYPDAVKGQFTISRNNTKNSLYLQMNSLSVEDIAVYYCAK
Macaca fascicularis V100 iglv AQIA01009600.1 7839 SWAQSAPTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYGVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Macaca fascicularis V101 iglv AQIA01009600.1 20650 SAASYDLTQPPSVSVSPGQTARITCGGDNIGSEVVNWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDISSDH
Macaca fascicularis V102 iglv AQIA01009600.1 28115 SVVSSGLTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca fascicularis V103 iglv AQIA01009608.1 4450 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNGVSWYQQHSGTAPRLLIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca fascicularis V143 igkv AQIA01017094.1 176239 SSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLVSNRPSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Macaca fascicularis V144 igkv AQIA01017096.1 35524 ARCDIQMTQSPSSLSASVGDRVTVTCRASQGINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDYTLTISSLQPEDVATYYCLQDYNTP
Macaca fascicularis V145 igkv AQIA01017097.1 8075 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca fascicularis V146 igkv AQIA01017097.1 38547 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQPLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQY
Macaca fascicularis V147 igkv AQIA01017097.1 61242 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLVYSDGKTYLYWYLQKPGQSPQLLMYLVSKRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Macaca fascicularis V148 igkv AQIA01017097.1 69343 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYNTP
Macaca fascicularis V149 igkv AQIA01017097.1 77439 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTHLHWYLQKPGQSPQLLMYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Macaca fascicularis V151 igkv AQIA01017099.1 11235 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLFWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQDIQLP
Macaca fascicularis V152 igkv AQIA01017099.1 19463 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSGLAWYQQKPGKAPKLLIYAASRLQSGIPSRFSGSGSGTDFTLTISSLQPEDSAAYYCQQVYSNP
Macaca fascicularis V153 igkv AQIA01017100.1 7492 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Macaca fascicularis V154 igkv AQIA01017105.1 1138 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca fascicularis V155 igkv AQIA01017109.1 27448 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGI
Macaca fascicularis V156 igkv AQIA01017115.1 12705 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLHWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDYTLTISSLQSEDVATYYCQHSYGTP
Macaca fascicularis V157 igkv AQIA01017115.1 28055 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVKAEDVGVYYCMQALQTP
Macaca fascicularis V158 igkv AQIA01017115.1 33050 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYFHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca fascicularis V159 igkv AQIA01017115.1 51968 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca fascicularis V160 igkv AQIA01017115.1 73838 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQHDNSP
Macaca fascicularis V161 igkv AQIA01017115.1 81811 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca fascicularis V163 igkv AQIA01017139.1 12432 SSGDIVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSRFPGVPDRFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQL
Macaca fascicularis V164 igkv AQIA01017139.1 30473 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Macaca fascicularis V165 igkv AQIA01017139.1 39697 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca fascicularis V166 igkv AQIA01017140.1 861 AKCDIQMTQSPTFLSASVGDRVTIACRASQSINKGLAWYQQKPGKAPKLLISYASNLYTDVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Macaca fascicularis V167 igkv AQIA01017142.1 9938 ARAETILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Macaca fascicularis V168 igkv AQIA01017150.1 11180 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYY
Macaca fascicularis V349 trgv AQIA01046502.1 39508 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Macaca fascicularis V350 trgv AQIA01046502.1 44238 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYGSTRSNLRLILRNLIENDSGVYYCANWD
Macaca fascicularis V351 trgv AQIA01046502.1 48632 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Macaca fascicularis V352 trgv AQIA01046502.1 58149 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQVGKAPQRLLYYDTSNSRVVLESGISPGKYDSYGSTRNNLRLRLRNLIENDSGVYYCANWD
Macaca fascicularis V353 trgv AQIA01046502.1 72919 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Macaca fascicularis V354 trgv AQIA01046504.1 29224 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACWD
Macaca fascicularis V355 trgv AQIA01046504.1 31231 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKSYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Macaca fascicularis V372 trbv AQIA01048525.1 36411 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVIFFDNNISEKSEIFEDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Macaca fascicularis V373 trbv AQIA01048525.1 43381 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca fascicularis V374 trbv AQIA01048525.1 48022 PIDSGVTQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKVKKPPEIMFMYNYEKLSINESVPSRFSPECSQSSLFYLHLRALQPEDSALYLCASSQ
Macaca fascicularis V375 trbv AQIA01048525.1 56237 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Macaca fascicularis V376 trbv AQIA01048525.1 63827 SLDTAVSQTPKYLVTQTGKEESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKKLFINETVSNRFSPDSPDKARLILHIKPLELGDSAVYFCASSQ
Macaca fascicularis V377 trbv AQIA01048525.1 72336 HTEPEVTQTPSHQVTRMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVYFYNGEISEKSEIFEDRFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Macaca fascicularis V378 trbv AQIA01048525.1 78856 PLDTAVFQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPESLDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca fascicularis V379 trbv AQIA01048525.1 83220 PTDTGVTQTPKHLVMEMTNKKSLKCEQHMGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca fascicularis V380 trbv AQIA01048525.1 94179 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVYWYQQTPGQGLQFLFEYFSETQRQKGNFSNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca fascicularis V381 trbv AQIA01048526.1 5859 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSATEDTTDPGEVPDGYSVSRLNKKEFLLRLESAALSQTSVYFCASSE
Macaca fascicularis V382 trbv AQIA01048526.1 20531 SLDTAVSQTPKYLVRQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca fascicularis V383 trbv AQIA01048526.1 23962 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFSPECPDSSHLHLHLRALQPEDSALYLCASSQ
Macaca fascicularis V384 trbv AQIA01048526.1 35705 PVNAGVTQTPKFQVLKTGQNMTLKCAQDMNHDRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Macaca fascicularis V385 trbv AQIA01048527.1 3131 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca fascicularis V386 trbv AQIA01048527.1 25702 HTGAGVSQSPSNKVTEKGKDVELRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAVDDSGLRSDRVSATRPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca fascicularis V387 trbv AQIA01048528.1 4387 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQAPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Macaca fascicularis V388 trbv AQIA01048528.1 7070 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDRSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSALYFCASSE
Macaca fascicularis V389 trbv AQIA01048529.1 2065 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca fascicularis V390 trbv AQIA01048530.1 6126 FTEAGVAQSPRYKITGKSQTVTFWCDPISGHATLYWYRQILGQGPELLVQFQNKGVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Macaca fascicularis V391 trbv AQIA01048530.1 27852 LTEAGVAQSPRYKVIEKSQAVTFWCNPISGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca fascicularis V392 trbv AQIA01048530.1 44936 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSD
Macaca fascicularis V393 trbv AQIA01048530.1 49168 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPAFLTYFQDDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca fascicularis V394 trbv AQIA01048530.1 57085 PVQAGVTQSPTHLIKTRGQQVTLRCSPISGHTNVYWYQQALGQGPQFILWYDEEEERDRGTFPHRFSGHQFPNYSSELNVNALEVEDSALYLCASSL
Macaca fascicularis V395 trbv AQIA01048530.1 68529 PTGAGVSQSPRYKVTKRGQDVALRCDPISGHVALYWYRRTLGQGPELLTYFQNDAQPDKSGLPSDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca fascicularis V396 trbv AQIA01048530.1 82297 LVNVGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPLRLESADPSQTSVYICASSY
Macaca fascicularis V397 trbv AQIA01048530.1 86914 HTVARVSQSPRYKVTKRGQDVALRCDPISGHATLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTQQGDSAVYLCASSL
Macaca fascicularis V398 trbv AQIA01048530.1 109107 HTGAGVSQSPRYKVTERGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFNYKAQPDKSGLPNDRFSAERPEGSVSTLKIQRTEQRDSAVYLCASSL
Macaca fascicularis V399 trbv AQIA01048530.1 114176 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYDRKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca fascicularis V400 trbv AQIA01048530.1 120204 LFSAGPGNAGVNQTPKFQVLKTGQSMTLQCAQDMNHECMSWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLRLESAASSQTSVYFCGSSD
Macaca fascicularis V401 trbv AQIA01048531.1 13038 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDAQPDKSGLPNDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca fascicularis V402 trbv AQIA01048531.1 21501 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca fascicularis V403 trbv AQIA01048532.1 3517 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGQGPQFIFQYYEKEERERGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca fascicularis V404 trbv AQIA01048532.1 10806 PVNAGVTQTPKFQVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRKNTEDFLLRLESADPSQTSVYICASSE
Macaca fascicularis V405 trbv AQIA01048532.1 15111 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKAQPDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca fascicularis V406 trbv AQIA01048532.1 23919 PVDAGVVQSPTHLIKTRGQQVTLRCSPISGHNTVYWYQQALGQGPQLIFQYYRGEDRGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Macaca fascicularis V407 trbv AQIA01048532.1 34646 HADAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDSAVYLCASSL
Macaca fascicularis V408 trbv AQIA01048532.1 41463 SVAAGVIQSPRHLIKEKRETATLQCYPLPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASSL
Macaca fascicularis V409 trbv AQIA01048532.1 48706 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESAPRSQTSVYFCASSE
Macaca fascicularis V410 trbv AQIA01048532.1 59746 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca fascicularis V411 trbv AQIA01048532.1 65347 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca fascicularis V412 trbv AQIA01048532.1 68615 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca fascicularis V413 trbv AQIA01048532.1 83969 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca fascicularis V414 trbv AQIA01048532.1 91005 HTEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFLRAYTQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca fascicularis V415 trbv AQIA01048533.1 4088 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHQVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca fascicularis V416 trbv AQIA01048535.1 1474 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGYSYFFWYQWVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca fascicularis V417 trbv AQIA01048536.1 12318 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Macaca fascicularis V418 trbv AQIA01048536.1 15429 TMDGRITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca fascicularis V419 trbv AQIA01048536.1 23368 GSGLAAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca fascicularis V420 trbv AQIA01048536.1 33461 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINKRFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Macaca fascicularis V421 trbv AQIA01048536.1 42437 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca fascicularis V422 trbv AQIA01048536.1 54580 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca fascicularis V423 trbv AQIA01048536.1 62412 LTEADIYQNPRHRVIGTGKKITLECSQTVGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca fascicularis V424 trbv AQIA01048536.1 103281 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSVNVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca fascicularis V425 trbv AQIA01048536.1 108618 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca fascicularis V426 trbv AQIA01048536.1 128403 SVFSAVVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca fascicularis V472 igkv AQIA01058132.1 2778 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIHEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca fascicularis V473 igkv AQIA01058133.1 2031 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca fascicularis V515 trav AQIA01064134.1 48332 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGALTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca fascicularis V516 trav AQIA01064136.1 11392 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca fascicularis V517 trav AQIA01064137.1 6324 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca fascicularis V518 trav AQIA01064137.1 18425 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca fascicularis V519 trav AQIA01064137.1 37157 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNTDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca fascicularis V520 trav AQIA01064137.1 47075 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca fascicularis V521 trav AQIA01064138.1 6179 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Macaca fascicularis V522 trav AQIA01064138.1 19411 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca fascicularis V523 trav AQIA01064144.1 2575 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Macaca fascicularis V524 trav AQIA01064144.1 8017 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca fascicularis V525 trav AQIA01064146.1 4211 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNAHEKKNQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca fascicularis V526 trav AQIA01064146.1 26733 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDSGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLDRASQYVSLLIRDSQLSDSATYLCAV
Macaca fascicularis V527 trav AQIA01064146.1 33222 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPNLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Macaca fascicularis V528 trav AQIA01064146.1 38788 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca fascicularis V529 trav AQIA01064146.1 52630 VSRGESVGLHLPTVTVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca fascicularis V530 trav AQIA01064146.1 58516 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca fascicularis V531 trav AQIA01064146.1 76835 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca fascicularis V532 trav AQIA01064146.1 101456 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Macaca fascicularis V533 trav AQIA01064146.1 114435 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLRLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca fascicularis V534 trav AQIA01064148.1 822 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca fascicularis V535 trav AQIA01064148.1 10273 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Macaca fascicularis V536 trav AQIA01064149.1 7523 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca fascicularis V537 trav AQIA01064149.1 10742 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLVRQNSFDEQNEINGRYYSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Macaca fascicularis V538 trav AQIA01064151.1 18012 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca fascicularis V539 trav AQIA01064151.1 28361 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca fascicularis V540 trav AQIA01064156.1 10501 VIGIQVEQSPPDLILQEGANSTLRCNYSATANNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTKERYSFLHISSSQTTDSGIYFCAVESQCSP
Macaca fascicularis V541 trav AQIA01064159.1 7755 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLITLVKSGEVKKQKRLIFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca fascicularis V542 trav AQIA01064159.1 18643 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca fascicularis V543 trdv AQIA01064165.1 2109 FSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIRQGSSEQNARNGRYSVNFKKEASSIALTISALQLEDSATYFCALRE
Macaca fascicularis V544 trav AQIA01064165.1 10979 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca fascicularis V545 trav AQIA01064165.1 18363 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQSGEAKKNSSLHITATQTTDVGTYFCA
Macaca fascicularis V546 trav AQIA01064166.1 7812 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISANTISANEYIHWYRQFHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca fascicularis V547 trav AQIA01064166.1 16939 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca fascicularis V548 trav AQIA01064166.1 34436 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca fascicularis V549 trav AQIA01064166.1 53435 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Macaca fascicularis V550 trav AQIA01064166.1 76746 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIYWYRQRPSQGPEYVIHGLTSNNNRMASLTITEDRKSSTLILHHATLRDAAVYYCILR
Macaca fascicularis V551 trav AQIA01064166.1 81459 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Macaca fascicularis V552 trav AQIA01064166.1 94378 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca fascicularis V553 trav AQIA01064166.1 99137 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca fascicularis V554 trav AQIA01064166.1 109180 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca fascicularis V555 trav AQIA01064166.1 135911 SGMAQTVTQSQQEMSVQEAETVILSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca fascicularis V556 trav AQIA01064166.1 145404 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYR
Macaca fascicularis V557 trav AQIA01064166.1 168982 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca fascicularis V558 trav AQIA01064167.1 16153 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca fascicularis V559 trdv AQIA01064167.1 101127 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca fascicularis V560 trdv AQIA01064167.1 122517 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca fascicularis V627 ighv AQIA01075814.1 1458 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWNWIRQPPGKGLEWIGYIGGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V629 ighv AQIA01075814.1 38415 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGEINPKTGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V630 ighv AQIA01075814.1 41321 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYGMSWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCT
Macaca fascicularis V631 ighv AQIA01075814.1 48091 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSFISNTGKTIYYADSVKGRFTISRDNAKNSLSLQMSSLRAEDTAVYYCTR
Macaca fascicularis V632 ighv AQIA01075815.1 2732 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPSRKTLEWLAHIYWDDDKRYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca fascicularis V633 ighv AQIA01075818.1 5349 VLSQVQLQESGPGLVKPSETLPLTCTVSGASISSNYWSWIRQPPGKGLEWIGRIYGSGGSTDYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V634 ighv AQIA01075820.1 24545 VQCVEQLVESGGGLVQPGASLRLSCAASEFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca fascicularis V635 ighv AQIA01075821.1 6782 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWGWIRQPPGKGLEWIGSIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V636 ighv AQIA01075823.1 9679 VQCEVQLVESGGGLAKPGGSLRLSCAASGFSFSDYYMYWVRQAPGKGLEWVSGISYTGGSTYYADSVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAR
Macaca fascicularis V637 ighv AQIA01075825.1 15489 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSRISSDGSSTSYADSVKGRFTISRENAKNSLYLQMNSLRAEDTAVYYCAK
Macaca fascicularis V638 ighv AQIA01075825.1 23334 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYETGYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTT
Macaca fascicularis V639 ighv AQIA01075826.1 7444 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGPEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Macaca fascicularis V640 ighv AQIA01075827.1 12750 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYEMHWVRQAPGKGLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCA
Macaca fascicularis V641 ighv AQIA01075830.1 641 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWLRQAPGQRLEWMGGINTNTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Macaca fascicularis V642 ighv AQIA01075832.1 13784 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWSWIRQPPGKGLEWIGYIYGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V643 ighv AQIA01075832.1 26833 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWISAISSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca fascicularis V644 ighv AQIA01075832.1 39069 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYVMHWVRQAPGKGLEWVSVISESGGTIYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Macaca fascicularis V645 ighv AQIA01075832.1 43033 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEYIGYISGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V646 ighv AQIA01075834.1 704 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQSPGKGLEWIGGIYGSGGSTEYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCA
Macaca fascicularis V647 ighv AQIA01075834.1 15810 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQSPGKGLEWIGYIYGSGSSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V648 ighv AQIA01075844.1 4664 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGNIDGNTADTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V649 ighv AQIA01075848.1 16339 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYYINWVRQAPEQVLDWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELNSLRSEDTAVYYCAR
Macaca fascicularis V650 ighv AQIA01075848.1 34899 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGGIIPLVGITNYAEKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V651 ighv AQIA01075855.1 3764 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQLSLKLSSVTAADTAVYYCAR
Macaca fascicularis V652 ighv AQIA01075856.1 13882 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGGYYYWSWIRQPPGKGLEWIGNIYGNSASTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V653 ighv AQIA01075857.1 5235 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGGIYSNSESTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V654 ighv AQIA01075859.1 15557 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISDSYWWSWIRQPPGKGLEWIGYIYGSSTSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V655 ighv AQIA01075860.1 3493 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGNIGGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V656 ighv AQIA01075862.1 11829 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMHWVRQASGKGLEWVSSISNGGGSTWYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAR
Macaca fascicularis V657 ighv AQIA01075862.1 23167 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGRISGSGGSTSYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V658 ighv AQIA01075862.1 31523 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVCQAPGKGLEWVAVISYDGSQKYYADSVKDRFTISRDNSNNMLYLQMNNLKLEDTAVYYCAT
Macaca fascicularis V659 ighv AQIA01075862.1 73171 VQCEVQLVESGGGLVQPGASLRLSCAASGFTFSSTRMNWIRQAPGKRLEWVTDIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca fascicularis V660 ighv AQIA01075862.1 80459 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSSWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFQGHVTISADKSISTTYLQWSSLKASDTATYYCAK
Macaca fascicularis V661 ighv AQIA01075865.1 14326 VQCEVQLVESGGALAQPGGSLRLSCAASGFTFSDYYMDWVHQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca fascicularis V662 ighv AQIA01075867.1 12907 VQCEVQLVESGGGLAKPGGSLRLSCAASGFSFSDYYMYWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSPRAEDTAVYYCAR
Macaca fascicularis V663 ighv AQIA01075867.1 22149 VQCEVQLVESGGGLVQPGGSLRLSCGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRGDSKSIASLQMSSLKTEDTAVYYCAR
Macaca fascicularis V664 ighv AQIA01075868.1 2742 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Macaca fascicularis V665 ighv AQIA01075868.1 14810 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca fascicularis V666 ighv AQIA01075871.1 1081 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNAWMNWVRQAPGKGLVWVARIKSKANGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Macaca fascicularis V727 igkv AQIA01007908.1 5660 ARCDIQMTQSPSSQSASVGDRVTITCQASQSLSNYLNWYQQKPGKIPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca fascicularis V729 trav AQIA01008389.1 31150 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Macaca fascicularis V739 iglv AQIA01009604.1 1482 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V740 iglv AQIA01009605.1 6299 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFILWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V790 igkv AQIA01017094.1 126216 SGDMILNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca fascicularis V791 igkv AQIA01017094.1 67743 TSGAIPLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYEVSNRASGVPERFSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Macaca fascicularis V792 igkv AQIA01017094.1 62858 STGDIVMTQTPLSLPVTLGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQGIEYP
Macaca fascicularis V793 igkv AQIA01017118.1 166186 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNYLSWYQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Macaca fascicularis V794 igkv AQIA01017118.1 160420 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSDGKTYLNWLQQKPGQPPRRLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Macaca fascicularis V795 igkv AQIA01017118.1 143930 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSNGNTYLSWYQQKPGQPPRLLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQG
Macaca fascicularis V796 igkv AQIA01017118.1 133755 SGGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHTDGYTYLDWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQHKALP
Macaca fascicularis V797 igkv AQIA01017118.1 109512 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca fascicularis V798 igkv AQIA01017118.1 101241 TRCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca fascicularis V799 igkv AQIA01017118.1 65496 STGDVVMTQSPLSLPVTLGQPASISCRSSQSLLHSNGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMEG
Macaca fascicularis V800 igkv AQIA01017118.1 49058 SKGEIVLTQSPAFQSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca fascicularis V801 igkv AQIA01017118.1 19826 TTGQVVLTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca fascicularis V802 igkv AQIA01017118.1 14344 VRCDIQMTQAPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca fascicularis V803 igkv AQIA01017120.1 80856 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Macaca fascicularis V804 igkv AQIA01017120.1 64600 VRGDIQMTQSPSSLSASVGDTVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSYP
Macaca fascicularis V805 igkv AQIA01017120.1 49036 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca fascicularis V806 igkv AQIA01017120.1 29727 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSKP
Macaca fascicularis V807 igkv AQIA01017120.1 14980 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNW
Macaca fascicularis V808 igkv AQIA01017120.1 2389 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQPFKNYL
Macaca fascicularis V809 igkv AQIA01017122.1 30052 TAGEIVMTQSPATLSLSPGETATLSCRASQSVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca fascicularis V810 igkv AQIA01017123.1 67031 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca fascicularis V811 igkv AQIA01017123.1 60405 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Macaca fascicularis V812 igkv AQIA01017123.1 43424 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQGYSTP
Macaca fascicularis V813 igkv AQIA01017123.1 32889 TTGETVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTEFTLTISSTLTISSLDPEDVGVYYCQKYNDWP
Macaca fascicularis V814 igkv AQIA01017125.1 528 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca fascicularis V815 igkv AQIA01017126.1 31626 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYANSLASGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNSNP
Macaca fascicularis V816 igkv AQIA01017126.1 13138 TTGEIVMTQSPATLSLSPGETATISCRTSQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Macaca fascicularis V817 igkv AQIA01017128.1 91071 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Macaca fascicularis V818 igkv AQIA01017128.1 84616 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKAPGLQSGVPSMFSGSGSGTEFTLTISSLQPEYFATYYCQQFSSAL
Macaca fascicularis V819 igkv AQIA01017128.1 68186 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Macaca fascicularis V820 igkv AQIA01017128.1 25271 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Macaca fascicularis V821 igkv AQIA01017128.1 6458 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYYCLQRSNW
Macaca fascicularis V822 igkv AQIA01017130.1 8440 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYDNLP
Macaca fascicularis V823 igkv AQIA01017133.1 1022 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSYP
Macaca fascicularis V824 igkv AQIA01017135.1 16844 AKCDIQMTQSPSSLSASVGDKVTITCQASQSISSWLAWYQQKPGKAPKPLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Macaca fascicularis V825 igkv AQIA01017135.1 1194 TTGETVMTQSPATLSLSPGERATLSCRASQSVGSTLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQESNWK
Macaca fascicularis V826 igkv AQIA01017139.1 65226 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca fascicularis V827 igkv AQIA01017139.1 47398 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQAHSI
Macaca fascicularis V1008 trbv AQIA01048541.1 94931 VRSQTVHQWPATLVQPAGSPLSLECTVEGTANPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Macaca fascicularis V1088 trdv AQIA01064169.1 22100 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca fascicularis V1099 ighv AQIA01066357.1 28114 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca fascicularis V1100 ighv AQIA01066360.1 88049 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Macaca fascicularis V1101 ighv AQIA01066360.1 77958 VQCEVQLAESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPEEGLEWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca fascicularis V1102 ighv AQIA01066360.1 63044 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLARIDWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARG
Macaca fascicularis V1103 ighv AQIA01066360.1 38898 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMDSLRAEDTAVYYCAK
Macaca fascicularis V1104 ighv AQIA01066362.1 33035 VQGEVQLVESEGNFVQPGGSLRLSCAASGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVKGRFAISRGNAKNTLYLQMYSLIAEDTAIYYCVSE
Macaca fascicularis V1105 ighv AQIA01066362.1 21989 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Macaca fascicularis V1106 ighv AQIA01066366.1 447 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGFIKNKADGGTADYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCT
Macaca fascicularis V1107 ighv AQIA01066369.1 21390 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDSATYYCAK
Macaca fascicularis V1108 ighv AQIA01066369.1 1260 VQGEVQLVESEGNFVQPGGSLRLSCAASGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVKGRFAISRGNAKNTLYLQMYSLIAEDTAIYYCVSE
Macaca fascicularis V1109 ighv AQIA01066378.1 1590 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWISAINSAGSSTYYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAG
Macaca fascicularis V1110 ighv AQIA01066385.1 15295 AHSEVQLVQSGAELKKPGASVKVSCKVSGYTFTELSMHWVRQVPGKGLEWMGGVDPVYGEIIHAEKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V1111 ighv AQIA01066385.1 1920 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMDWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKNTAYLQMSSLKTEDTAVYYCTR
Macaca fascicularis V1112 ighv AQIA01066387.1 111520 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYGMHWVRQAPGKGLEWVSSISNTGKTIYYADSVKGRFTVSRDNAKNSLSLQMSSLRAEDTAVYYCTR
Macaca fascicularis V1113 ighv AQIA01066387.1 106416 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSAISSGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca fascicularis V1114 ighv AQIA01066387.1 58247 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Macaca fascicularis V1115 ighv AQIA01066387.1 51565 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Macaca fascicularis V1116 ighv AQIA01066387.1 39916 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Macaca fascicularis V1117 ighv AQIA01066387.1 30921 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTISSYWMSWVCQAPGKGLEWLSDIYGSTMYYGDSVKGLFTVSRDNAKNSLYLQMNSLRAEDTAVYYCTR
Macaca fascicularis V1118 ighv AQIA01066387.1 24147 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLASIYWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca fascicularis V1119 ighv AQIA01066387.1 9473 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGRISGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V1120 ighv AQIA01066395.1 11433 VQCEVQLVESGGGLVQPGGSLRPSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATEYAASVKGRFTISRDDSKNTACLQMSSLKTEDTAVYYCAR
Macaca fascicularis V1121 ighv AQIA01066395.1 1503 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMFWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIAYLQMSSLKTEDTAVYYCTR
Macaca fascicularis V1122 ighv AQIA01066397.1 56046 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKGEDTAVYYCAR
Macaca fascicularis V1123 ighv AQIA01066397.1 394 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYMYWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKNTAYLQMSSLKTEDTAVYYCTR
Macaca fascicularis V1165 ighv AQIA01073275.1 9372 DHSEVQLVQSGAEVKKPGASVKISCKASGYTFTDYYLHWVRQAPGKGLEWMGRVDPEDGEADYAQKFQDRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Macaca fascicularis V1166 ighv AQIA01073275.1 1231 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Macaca fascicularis V1169 igkv AQIA01075132.1 1749 TTGETVMTQSPATLSLSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Macaca fascicularis V4 ighv AEHL01004922.1 20143 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSGYEMHWVRQAPGKWLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCTR
Macaca fascicularis V5 ighv AEHL01004922.1 28003 THSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCAYCA
Macaca fascicularis V6 ighv AEHL01004930.1 15463 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWNWIRQHPGKGLEWIGNIYGNSASTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca fascicularis V7 ighv AEHL01004933.1 7113 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYVMHWVRQAPGKGLEWVSVISESGGTTYYADSVKGRFAISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Macaca fascicularis V17 igkv AEHL01012337.1 1649 TAGEIVMTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPRLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca fascicularis V19 igkv AEHL01014103.1 2912 TTGEIVMTQSPATLSLSPGETATISCRTSQSVSSYLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYFCLQSSNW
Macaca fascicularis V21 iglv AEHL01016782.1 15972 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca fascicularis V22 iglv AEHL01016785.1 201 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSADGSYN
Macaca fascicularis V23 iglv AEHL01016791.1 17079 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRISGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca fascicularis V24 trbv AEHL01017597.1 1107 PANADVTQTPKFQILKTGQSMTLKCAQDMNHDSMYWYRQDPGMGLRLIHYSATEDTTDPGEVPDGYSVSRLNKKEFLLRLESAAPSQTSVYLCASSE
Macaca fascicularis V25 trbv AEHL01017598.1 11346 SLDTAVSQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca fascicularis V26 trbv AEHL01017599.1 427 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKEPAENNSVPSRFVPECPDSSHLYLHLRALQPEDSALYLCASSQ
Macaca fascicularis V27 trbv AEHL01017599.1 12016 PVNAGVTQTPKFQILKTGQNMTLKCAQDMNHDRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPDGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Macaca fascicularis V28 trbv AEHL01017599.1 14698 PVNAGVTQTPKFQVLKTGQSMTVQCAQDMKHDYMFWYRQDPGMGLRLIHYSAGEGSTEKGEVPDGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Macaca fascicularis V29 trbv AEHL01017599.1 18434 HTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGKGPEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca fascicularis V30 trbv AEHL01017601.1 1079 HTGAGVSQSPSNKVTEKGKDVELRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAVDDSGLRSDRVSATRPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca fascicularis V31 trbv AEHL01017601.1 8632 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDRSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSALYFCASSE
Macaca fascicularis V32 trbv AEHL01017602.1 1912 HRDAEITQSPRHKLTETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca fascicularis V33 trbv AEHL01017603.1 504 FTEAGVAQSPRYKITEKSQTVAFWCDPVSGHATLYWYRQILGQGPELLVQFQNKGVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca fascicularis V34 trbv AEHL01017604.1 8728 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca fascicularis V35 trbv AEHL01017604.1 34946 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGKGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASS
Macaca fascicularis V36 trbv AEHL01017606.1 4963 PTGAGVSQSPRYKVTKRGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKAQPDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca fascicularis V41 ighv AEHL01023710.1 7393 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca fascicularis V43 trbv AEHL01025375.1 2060 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYYEKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca fascicularis V44 ighv AEHL01027161.1 2675 VQCDVQLVESGGGMVQPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSRISWDGGSTYYADSVKGRFTISRDNAKNTLYLQMDRLRAEDTALYYCSR
Macaca fascicularis V45 ighv AEHL01027165.1 1095 VQCVEQLVESGGGLVQPGASLRLSCAASEFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca fascicularis V49 trav AEHL01036187.1 9145 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSFELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca fascicularis V52 ighv AEHL01038255.1 2224 AHSEVQLVQSGAELKKPGASVKVSCKVSGYTFTELSMHWVRQAPGKGLEWMGGVDTVYGEIIRAEKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V53 iglv AEHL01044256.1 8795 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca fascicularis V55 trbv AEHL01047234.1 3284 PGNADVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRLNTEDFPLRLESAALSQTSVYFCASS
Macaca fascicularis V60 ighv AEHL01051268.1 500 AKSQVQLVQSGAEVKNPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGVIIPLVGVTNYAEKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V73 iglv AEHL01089276.1 3442 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQQGKAPRYLMWLKSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWTTG
Macaca fascicularis V74 iglv AEHL01089311.1 12124 SWAEVVFTQPHSVSGSPGQMVTISCTRSSGSIDNSYVYWYQQRPGSAPTTVIYKDDQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSYDSSG
Macaca fascicularis V75 iglv AEHL01089316.1 12201 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPHWFQQKPGQAPRGLIYNTNSKHSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca fascicularis V76 iglv AEHL01089322.1 5400 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLYYSGA
Macaca fascicularis V77 iglv AEHL01089322.1 13883 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca fascicularis V78 iglv AEHL01089351.1 103 SAASYELTQPRSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVQVIYADSKRPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V79 iglv AEHL01089359.1 20295 SAASYELTQPPSVSVSPGQAARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca fascicularis V80 iglv AEHL01089359.1 30933 SWAQAALTQSPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca fascicularis V81 iglv AEHL01089359.1 54672 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYQQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca fascicularis V82 iglv AEHL01089360.1 813 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYQQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca fascicularis V83 iglv AEHL01089360.1 15020 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPQYIMKVKSDGTHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V141 igkv AEHL01136328.1 5009 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSTP
Macaca fascicularis V142 igkv AEHL01136342.1 13439 ARAEMILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Macaca fascicularis V143 igkv AEHL01136343.1 934 AKCDVQLTQSPTFLSASVGDRVTIACRASQSINKGLAWYQQKPGKAPKLLISYASNLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Macaca fascicularis V144 igkv AEHL01136348.1 5064 TTGQVILPQSPATRSLSPGERATLSCRASQSVSGYLAWCQQKPGQAPKLLIHSASSRATGIPDRFSGSGAGTDFTLTISSLEPEDVGVYHCYQYYSGY
Macaca fascicularis V145 igkv AEHL01136351.1 1003 ARAEMILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca fascicularis V151 igkv AEHL01138573.1 422 SSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Macaca fascicularis V152 igkv AEHL01138585.1 8218 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDIATYYCQQHDNSP
Macaca fascicularis V153 igkv AEHL01138585.1 17653 SSGDIMMTQTLLSLLVTPGKPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca fascicularis V154 igkv AEHL01138585.1 26879 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLYWNLLKPSQSPQLLMYFASYRASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQG
Macaca fascicularis V155 igkv AEHL01138590.1 212 YSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca fascicularis V156 igkv AEHL01138598.1 10334 ARCDIQMTQSPSSLPASVGDTVTITCRASQGINNELAWYQQKPGKALTLLFYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPENVATYYCRQDYNTP
Macaca fascicularis V157 igkv AEHL01138598.1 28315 ARCDTQMTQSPSSQSASVGDRVTITCQASQSLSNYLNWYQQKPGKIPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca fascicularis V158 igkv AEHL01138608.1 9284 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIHEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGGYYCMQGIQLP
Macaca fascicularis V159 igkv AEHL01138609.1 8327 GRCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca fascicularis V160 igkv AEHL01138622.1 4477 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLNWYQQKPGKAPKLLIYKASTLQSGVPSRFSGRGSGTGYTFTISSLQSEDVATYYCQHNYGTP
Macaca fascicularis V161 igkv AEHL01138624.1 4481 SGGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVKAEDVGVYYCMQALQTP
Macaca fascicularis V162 igkv AEHL01138625.1 1971 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca fascicularis V163 igkv AEHL01138625.1 20747 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Macaca fascicularis V164 igkv AEHL01138626.1 11340 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYRASNLEAGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQHDNSP
Macaca fascicularis V165 igkv AEHL01138626.1 19310 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca fascicularis V166 igkv AEHL01138627.1 24568 FSADVVMTQSPLSLPITPGQPASISCRSSQSLVHSNGNTYLSWFQQKPGQPPRRLIYRVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Macaca fascicularis V167 igkv AEHL01138632.1 6975 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSNGNTYLSWYQQKPGQPPRRLIYQVSNRDSGVPDRFSGSGAGTDFALKISRVEAEDVGVYYCGQG
Macaca fascicularis V168 igkv AEHL01138637.1 459 SGGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQHKALP
Macaca fascicularis V169 igkv AEHL01138639.1 1291 SSGDTVMTQTPLSLPVIPGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca fascicularis V170 igkv AEHL01138640.1 7098 TRCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca fascicularis V171 igkv AEHL01138642.1 20758 STGDVAMTQSPLSLPVTPGQPASISCRSSQSLLHSNGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGTGTDFTLKISRVEAEDVGVYYCMEGTHHP
Macaca fascicularis V172 igkv AEHL01138644.1 3322 SKGEIVLTQSPAFQSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca fascicularis V173 igkv AEHL01138645.1 1164 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca fascicularis V174 igkv AEHL01138645.1 6643 VRCDIQMTQAPSFLSASVGDRVTITCQGSQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca fascicularis V175 igkv AEHL01138648.1 5050 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Macaca fascicularis V352 trgv AEHL01292419.1 1391 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Macaca fascicularis V353 trgv AEHL01292419.1 5918 GQKSSNLEGRTKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQSLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Macaca fascicularis V354 trgv AEHL01292419.1 9688 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRSSWILILRNLIENDSGVYYCANWD
Macaca fascicularis V355 trgv AEHL01292419.1 19217 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDSYGSTRNNLRLRLRNLIENDSGVYYCANWD
Macaca fascicularis V356 trgv AEHL01292420.1 3159 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Macaca fascicularis V357 trgv AEHL01292426.1 3314 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACWD
Macaca fascicularis V358 trgv AEHL01292426.1 5322 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKSYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Macaca fascicularis V371 trbv AEHL01303036.1 593 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVIFFDNNISEKSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Macaca fascicularis V372 trbv AEHL01303038.1 2274 SLDTAVSQTPKYLVTQTGKEESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca fascicularis V373 trbv AEHL01303041.1 592 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Macaca fascicularis V374 trbv AEHL01303044.1 7147 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDKISDKSEMFDDQFSVERPDGSNFTLKIQSTKLEDSAMYFCASSE
Macaca fascicularis V375 trbv AEHL01303047.1 5813 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRLKGNFPNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca fascicularis V376 trbv AEHL01303053.1 856 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQAPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHHSEMNVSALELGDSALYLCASSL
Macaca fascicularis V377 trbv AEHL01303058.1 488 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERERGNFPGRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca fascicularis V378 trbv AEHL01303058.1 3796 LVNVGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPLRLESAAPSQTSVYICGSSY
Macaca fascicularis V449 trav AEHL01378825.1 5932 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca fascicularis V450 trav AEHL01378833.1 5574 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca fascicularis V451 trav AEHL01378847.1 175 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWCVQCPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca fascicularis V452 trav AEHL01378849.1 3771 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca fascicularis V453 trav AEHL01378853.1 5906 MSRGEDVEQSLFLSVREGDTSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca fascicularis V454 trav AEHL01378855.1 3134 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca fascicularis V455 trav AEHL01378857.1 4587 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Macaca fascicularis V456 trav AEHL01378858.1 971 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca fascicularis V457 trav AEHL01378860.1 11732 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Macaca fascicularis V458 trav AEHL01378860.1 19041 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca fascicularis V459 trav AEHL01378861.1 232 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca fascicularis V460 trav AEHL01378866.1 6380 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca fascicularis V461 trav AEHL01378869.1 8993 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDSGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Macaca fascicularis V462 trav AEHL01378869.1 15561 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPNLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca fascicularis V463 trav AEHL01378869.1 21182 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca fascicularis V464 trav AEHL01378869.1 35181 VSRGESVGLHLPTVTVQEGDNSVINCTYSDSASDYFFWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca fascicularis V465 trav AEHL01378869.1 41062 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca fascicularis V466 trav AEHL01378872.1 7585 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Macaca fascicularis V467 trav AEHL01378872.1 32387 VWSQQKEVEQDPGPFSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Macaca fascicularis V468 trav AEHL01378875.1 3267 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca fascicularis V469 trav AEHL01378876.1 9812 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca fascicularis V470 trav AEHL01378878.1 1465 VNSQQGEEDPQALSIQEGENATMNCSYKTSITNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTLKKSSSLLITASRAADTASYFCATD
Macaca fascicularis V471 trav AEHL01378880.1 3394 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQEMNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca fascicularis V472 trav AEHL01378881.1 1491 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRENTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYYSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Macaca fascicularis V473 trav AEHL01378884.1 10218 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca fascicularis V474 trav AEHL01378884.1 20700 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca fascicularis V475 trav AEHL01378888.1 876 VIGIQVEQSPPDLILQEGANSTLRCNYSATASSLQWFHQNPWGQLINLFYITSGTKQNGRLSATTVTTERYSFLHISSSQTTDSGIYFCAVESQCSP
Macaca fascicularis V476 trav AEHL01378891.1 10073 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca fascicularis V477 trdv AEHL01378894.1 1670 FSVAQKVTQAQSSVSMPVEKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIHQGSSQQNARNGRYSVNFQKAASSITLTISALQLEDSATYFCALRE
Macaca fascicularis V478 trav AEHL01378896.1 2249 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGQVSVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca fascicularis V479 trav AEHL01378899.1 7806 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca fascicularis V480 trav AEHL01378901.1 3403 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Macaca fascicularis V481 trav AEHL01378905.1 7936 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTITEDRKSSTLILHHATLRDAAVYYCILR
Macaca fascicularis V482 trav AEHL01378905.1 25879 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca fascicularis V483 trav AEHL01378905.1 30685 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca fascicularis V484 trav AEHL01378906.1 1678 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca fascicularis V485 trav AEHL01378910.1 1044 SGMAQTVTQSQQEMSVQEAETVILSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca fascicularis V486 trav AEHL01378911.1 6126 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYRS
Macaca fascicularis V487 trav AEHL01378915.1 421 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca fascicularis V488 trav AEHL01378917.1 3843 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca fascicularis V489 trdv AEHL01378925.1 25191 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca fascicularis V490 trdv AEHL01378925.1 46046 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca fascicularis V552 trbv AEHL01001959.1 7360 SVFSAVISQKPSRDVCQRGTSVKIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca fascicularis V553 trbv AEHL01001963.1 5211 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca fascicularis V554 trbv AEHL01001964.1 2457 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca fascicularis V555 trbv AEHL01001967.1 11609 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca fascicularis V556 trbv AEHL01001967.1 3564 LTEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca fascicularis V557 trbv AEHL01001969.1 5920 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca fascicularis V558 trbv AEHL01001971.1 912 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINKRFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Macaca fascicularis V559 trbv AEHL01001975.1 6379 GSGLAAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca fascicularis V560 trbv AEHL01001978.1 3506 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQVPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAGQEDSAAYFCAS
Macaca fascicularis V561 trbv AEHL01001978.1 447 TMDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca fascicularis V562 trbv AEHL01001980.1 5021 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGYSYFFWYQWVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca fascicularis V563 trbv AEHL01001981.1 4421 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca fascicularis V564 trbv AEHL01001984.1 28064 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca fascicularis V565 trbv AEHL01001984.1 22463 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca fascicularis V566 trbv AEHL01001984.1 18249 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKYPIDDSGMPKDRFSAKMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca fascicularis V567 trbv AEHL01001984.1 17531 HTDAGVIQLPRHEVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca fascicularis V568 trbv AEHL01001984.1 2780 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca fascicularis V569 trbv AEHL01001986.1 11549 SVAAGVTQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Macaca fascicularis V570 trbv AEHL01001986.1 4303 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca fascicularis V571 trbv AEHL01001987.1 1499 HADAGVSQDPRHRITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDSAVYLCASSL
Macaca fascicularis V572 trbv AEHL01001990.1 6202 PVNAGVTQTPKFQILKTGQNMTLKCAQDMNHDYMYWYRQDPGMGLRLIHYSATEDTTDPGEVPDGYSVSRLNKKEFLLRLESAAPSQTSVYFCASSY
Macaca fascicularis V576 iglv AEHL01007065.1 4021 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGFLRGGKAVLTITGAQPEDEAFYYCALW
Macaca fascicularis V577 iglv AEHL01007074.1 2088 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca fascicularis V578 iglv AEHL01007077.1 358 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIHWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Macaca fascicularis V579 iglv AEHL01007079.1 12450 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTTPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCLSYDSSLS
Macaca fascicularis V580 iglv AEHL01007081.1 6397 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVYWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEAEYYCETWDNSLNG
Macaca fascicularis V581 iglv AEHL01007083.1 4720 SLSQPVLTQPTSLSASPGASARLSCTLSSGINVGSYSIFWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Macaca fascicularis V589 ighv AEHL01020291.1 3022 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGVIIPLVGITNYAEKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V590 ighv AEHL01020296.1 5955 GQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYNINWVRQAPGQGLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELNSLRSEDTAVYYCAR
Macaca fascicularis V594 ighv AEHL01023690.1 354 VQCEVQLVESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLKLEDTAVYYCAR
Macaca fascicularis V597 iglv AEHL01024921.1 11362 QSVLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCSSLVIVTDPQESLTDFSGSKSGNLASLTITGLWPEDEADYHCQS
Macaca fascicularis V598 iglv AEHL01024929.1 7465 VDSETVVTQEPSLSVSSGGTVTLTCGLSSGLVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMGSGI
Macaca fascicularis V602 igkv AEHL01029881.1 8534 TTGEIVMTQSPATLALSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYYCLQSSNW
Macaca fascicularis V604 iglv AEHL01031362.1 493 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca fascicularis V605 iglv AEHL01036197.1 4435 SAASYELTQPRSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVQVIYADSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V606 iglv AEHL01036203.1 17805 SAASYELTQPRSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVQVIYADSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca fascicularis V607 iglv AEHL01036203.1 10372 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVVYGNNNRPSGIPERFSGSWSGNTASLTITGAQGEDEADYYCDSWDSSGTH
Macaca fascicularis V608 ighv AEHL01040206.1 11960 VQCDVQLVESGGGMVQPGGSLRLSCAASGFTFSSTRMNWIRQAPGKRLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca fascicularis V609 ighv AEHL01040796.1 14471 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLKMNSLRAEDTAVYYCAR
Macaca fascicularis V610 ighv AEHL01040796.1 3078 AHSEMQLVQSEAEVKKPGASVKISCKASGYTFTYRYLHWLRQTPGQGLEWMGWITPYNGNTNYAQKFQDRATITRDRSMSTAYMELSSLRSEDTAVYYCAR
Macaca fascicularis V613 iglv AEHL01044485.1 379 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPNWFQQKPGQVPRALIYDTSSKHSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca fascicularis V614 iglv AEHL01049266.1 952 LCALPVLTQPPSASASLGASVKLTCTLSSEPSNYFILWYQQRPGRSPQYIMKVKSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca fascicularis V615 trbv AEHL01077352.1 302 HIEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRDMGKEIKFLIYFLRASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca fascicularis V616 trav AEHL01077631.1 558 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca fascicularis V618 trav AEHL01080075.1 649 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQSGEAKKNSSLHITATQTTDEGSYFCA
Macaca fascicularis V625 trav AEHL01085433.1 2209 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Macaca fascicularis V679 igkv AEHL01136351.1 8382 IVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISNMEAEDAANYYCQQAHSI
Macaca fascicularis V680 igkv AEHL01136355.1 3304 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca fascicularis V681 igkv AEHL01136364.1 3441 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNYLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSNP
Macaca fascicularis V682 igkv AEHL01136366.1 12265 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISDYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Macaca fascicularis V687 igkv AEHL01138562.1 10186 SGDIILSQTPASLTAPPGETVSISCQASAHVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGNGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca fascicularis V863 trbv AEHL01303077.1 1080 VRSQTVHQWPATLVQPAGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Macaca fascicularis V930 trdv AEHL01378935.1 6787 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca fascicularis V937 ighv AEHL01389837.1 15119 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWVRQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMDSLRAEDTAGYYCAK
Macaca fascicularis V938 ighv AEHL01389840.1 10073 VQCEVQLVESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPEEGLVWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca fascicularis V939 ighv AEHL01389842.1 6590 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Macaca fascicularis V940 ighv AEHL01389852.1 2114 VQGEVQLVESEGNFVQPGGSVRLSCAVSGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVKGRFAISRGNAKNTLYLQMYSLIAEDTAIYYCVSEASG
Macaca fascicularis V941 ighv AEHL01389853.1 6840 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSYWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Macaca fascicularis V942 ighv AEHL01389861.1 850 VQCEVQLVAYGGGLEQPGGSLRLSCGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLNTEDTAMYYCAR
Macaca fascicularis V943 ighv AEHL01389866.1 13726 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca fascicularis V944 ighv AEHL01389873.1 3547 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSSTTYGMNWVRQDPRQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKAEDTAVYYCAR