WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Megaderma lyra AWHB00000000.1 (AWHB01) 51 13 4 5 17 6 3 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Megaderma lyra V41 trav AWHB01083294.1 1544 TMGDTKSTQPGTMESTEGKPVHLPCDHPTISGNEYIYWYRQIPRQGPEYVIHGVKDNKTNGMATLTITTDRKLSTLTLPQVTPRDSAVYYCIVRD
Megaderma lyra V58 trbv AWHB01108331.1 84 PMDTGITQTPKHLVMGMSSKKSLKCEQRLGHNAMYWYKQRAQKPLELMFAYNYKKLSDNVTVPSRFSPECPDSSHLYIHVGALDPEDSVVYLCATSR
Megaderma lyra V61 trav AWHB01114105.1 83 TAEQDVQQPTELAAMEGASVQVNCTYQTFGFNGLSWYQQHEGRSPIFISYNVLDGWERRGYQFSSFLSQSDTCSYLLVKELQMKDSASYLCAVR
Megaderma lyra V64 ighv AWHB01118157.1 988 ILSQIQLQESGPGLVKPSQALSLTCTVSGFSLTSNAVNWIRQAPGKRLECVGVIGSSGSTYYNHTLKSQLSITREISKNQVYLALTSLITEDTAMYYCARD
Megaderma lyra V85 trav AWHB01156094.1 4761 SGRTSWIRPQETEVSGTEGKSVNLLCNYGTSSTGFVDLYWFRQYPNQALEYILHRGWGYTGKGDASFATGKFYSESTANATSLHIRTLVPADTALYHCALRE
Megaderma lyra V98 ighv AWHB01176366.1 4813 ILAQVQLVQSGTEVKRPGESLRISCKFSGYSSWISWVCKKPERGLEWMGRIYPSDSDTDYNPSFQGHITISMDNSISTTYLQWSSLKASDTGTYYCAT
Megaderma lyra V107 trav AWHB01189995.1 2594 DARAQSVIQPDSHITVSEGDSLELGCKYVYGATLYLYWYVQYPNKGLQLLLKYFSGNTLVKGINDFEAEFRKDEASFNLSKRFAHGSDSAEYFCAVS
Megaderma lyra V123 trav AWHB01222255.1 3686 QTRGDSVSQMEGEVTLSEGDSLNISCTYVATGYPALVWYVQYPGEGLQLLLKATRAGEKGRNKSFAATYHKQPNSFHLEKASVHESDSAVYYCAVS
Megaderma lyra V128 iglv AWHB01226911.1 361 FQPAVTKPDALLVFPGQVAQLSCMLSPHHATIGDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPPDIPDRFSAANDEAHNACILTISPVQPEDDADYYCSVG
Megaderma lyra V129 ighv AWHB01229035.1 6281 VHCEIQLVESGGNLVQPGGTLRLSCLAYEFTFSSYAMSWVRQPLGKGLEWVSSISSSGSSTYYADSVKGRFTISRDNAKNTLYLQMTNLRAEDTSVYYCAR
Megaderma lyra V132 iglv AWHB01232577.1 2473 SWTQSALTQPHSVSGTPGKSVTISCAGSSNDIGRYDYVSWYQQRPGTAPKLLIYYVKNRPSGIPDRFSGSKSGNTASLSISGLRPEDEADYYCCSYTSS
Megaderma lyra V133 trbv AWHB01235149.1 369 DGGITQTPKYLFSEEGRDVTLECEQNFDHDSMYWYRQDPGHRLRLIYYSITVTDVQKGDLAEGYSASQDKKAFFPLTVTLTQKNQTALYLCASSL
Megaderma lyra V146 trav AWHB01248363.1 296 IMGDTKSTQPGTMESTEGKPVHLPCDHPTISGSESIYWYRQIPCRGPEYVIHGVKDSKTNGMATLTITTDRKLSTLTLHQVTPRDSAVYYCIVS
Megaderma lyra V160 trav AWHB01268813.1 2623 GVRGVKVDQSPSSLTLQEGTSSTLRCNFSTITSYVQWFRQNPGGSLTSLFFMTLSTKTNGRLSSRMNSKELYSTLHIMGSHLEDSATYLCAVE
Megaderma lyra V167 trgv AWHB01277004.1 5074 TQISSNLEGRKMSVTRQIGSSAIITCDTIIESNNYIHWYRYQEGMAPHYLLYYQFSSSKTVVGQGINVRKYHVYEGTGRTCKLVLRNLEESDSGVYYCAFWK
Megaderma lyra V176 ighv AWHB01288257.1 280 IQCEVQLVESGGNLVKPGGSLRLSCTASGFTFSNFWMYWVRQAPGKALEWVGAIKYNGSSTYYADSVKGRFTISRENSKNMLYLQMSSLRAEDTAVYYCAK
Megaderma lyra V181 trav AWHB01294810.1 1942 RTHGDSVSQMEGQVTLSEWASLNVSCTYSATVYLTLFWYVQYPGEGLQLLLKAMRAGEKGSNKGFEATYNKEKNSFHLEKASVHESDSAVYYCALS
Megaderma lyra V195 trav AWHB01319728.1 672 VNGQQINQMPRFLLLQEGENFTSYCNSSTTLSTIQWYMQSPGGSPVLLMILARAGEAPKQTRLTAEFGKTRKDSSLHITAAQTTDVGTYFCAG
Megaderma lyra V197 trgv AWHB01328088.1 5321 TSGDLPITQVITSITKKKGNTAFLECQIKKNILKKNVYIHWYQQKLDKQLKRILYISSNENVVHEQGISEERYEARKQRNDLMASLRIHRVKEEDAGLYYCACWD
Megaderma lyra V198 trgv AWHB01328088.1 7342 GETKMTISQDQLSFTRRLDRTVHISCKLSGVPLENAIVHWYQQKEGEPLTRILYGSTKNYKQDEPNSRLETDKKDNGIFYLIINNVVQSDEATYYCACWD
Megaderma lyra V210 trav AWHB01346149.1 6088 VRSQEVQQSPQSLINQEGEDVIITCKSPKTLYSLQWYLQKHGEGPILLMILRSGGEYKSHGKIVATINEKKQQSSLYITASQPSHSGTYFCGAE
Megaderma lyra V212 iglv AWHB01349383.1 2594 SVTSYELTQPSSQSVAPGQTARLTCGGNNIGSKNVQWYQQKPGQAPVLVIYEDSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSNDK
Megaderma lyra V218 trav AWHB01359423.1 4519 VSGQSGVEQDPQFLSAQEGEFITINCSYSIGMYTLHWLQQNPGGSLVPLFMLKSEMRVNGRVSATINSKERHSSLHITASQPEDSALYFCAL
Megaderma lyra V227 igkv AWHB01379652.1 504 TTGEIVMTQSPASLCLSQGQRAILTCKPSQRVYNNLAWYQQKPGHIPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEAEDAAVYYCQQG
Megaderma lyra V228 igkv AWHB01379656.1 2402 TRTETILTQSPALLSVALGDKGTITCKASQDIDDDMQWYQQKPGEAPMLIIKVANTLLPGVPSRFSGSGYGTDFTLTINNMEREDAAYYFCQQDDN
Megaderma lyra V246 ighv AWHB01424304.1 1470 VLSQVQLQESGPGLVKPSQTLSLTCTISGFSITTSGYCWDWVRQPPGKGLEWIGEICSSGSTYYSPSLKSRTSISRDTSKNQFSVQLNSVTPEDTAVYYCA
Megaderma lyra V267 trav AWHB01005477.1 343 SSVAQTVTQPQPEMSVQETETVTLACTYDTSDSQYYLYWYKQPPNGEMILIIRQESYNQQNAIENRFSVNFQKATKHFSLTISDSQLEDAAMYFCALRE
Megaderma lyra V270 trav AWHB01011846.1 1638 VNSKQEVTQSPEVLTVQEGDSFFLNCSYTDSAIYFLQWFRQDPGKGLTSLLTLSGQKEEEIGRIKAVLDKPSRHSALYIVTPQPSDSATYLCAV
Megaderma lyra V275 ighv AWHB01023397.1 457 GLCEVQLVESGDVRQPGGSLSLSCKASGFTFTDYSMNWVRQAPGKGLEWVAGVSKPSGKNQWYAPSVQGRFTISRDNPTNTASLKMTNLKSEDTAVYYCTR
Megaderma lyra V278 trav AWHB01023727.1 4360 VKGMQVDQRPPAVSLQEGNSSILWCNFSTAVNSVQWFRQNPGGRLINLFYIASGTKVNGRFNAMANLKERHSSLYISSSQTTDSAIYFCAVEPQCSP
Megaderma lyra V282 ighv AWHB01032508.1 988 ILSQVQLQESGLGLVKPSQNFFLTCTDSGFSITTSYYYWIWIQQSLGEGLEWLGYISYYGSSAYNLSLKSCTSNSRDMSKNSLSLQLDSMTTEDTVVYYCE
Megaderma lyra V296 ighv AWHB01058220.1 421 VLCEVQLVESGGDVRQPGGSLSLSCKASGFTFTDYGMHWVRQAPGKGLEWVAGVSQPSGTNQRYAPSVQGRFTISRDKPTNTASLKMTNLKSEDTATYYCTR
Megaderma lyra V297 ighv AWHB01058949.1 5829 IQSEVQLVESGGKLVQPGATLGLSCAASGFNFSSSGMIWVRQAPGKGLEWVAIIWYDGSQKYYADSVKGRFTISRDNAKSMLYLQMTSLRTEDTAVYYCV
Megaderma lyra V311 ighv AWHB01079622.1 3283 VQCEVQLVESGDNLLKPGGSLRLSCTASGFTFNTFWMNWVQQAPGKALEWVGQINPDGSSTYYANSMKGQFTISRDNPKNTLYLQMTRLRAEDTAMYYCEK
Megaderma lyra V338 trbv AWHB01132161.1 6363 RKQHLDDGVTQTPRNSITKTGNSIILECSPIKGHDNMYWYRQDRGLGLRLIYSSFDVNNTNTGELSDGYSASRKEKEKFPLTLQAASPSQTAVYFCASSL
Megaderma lyra V340 trdv AWHB01142336.1 556 KSMLCNTVTQSPPDQTVARGSEVTLFCIYDSEFYSPLLYWYRIMPDHSFQLIVFNRFHDKDFTQGWFSIKHNQTHKSFHLVISSVMTEDTATYYCALN
Megaderma lyra V349 igkv AWHB01161530.1 2778 ASGNIVLTQSPALFSVSLGESVSINCRANDSISDYLTWYQQKPGQAPKILIYDADNQYSGVSPRFTGIQSEKEFILTISKIEADDAASYYCQQDYVFP
Megaderma lyra V376 igkv AWHB01209106.1 6105 ARCDIQMTQSPSSLSASLGDKVTINCKASEGISKNLAWYQQKPGKAPKPLIHAASSLQTGVPSRFSGQGSGTDFTLTISSLQPEDFATYYCQQGNSYP
Megaderma lyra V390 trav AWHB01262979.1 12766 ETCGDSVSQTEGTVTLPEGALLTLKCTYQTSYTEYLFWYVQYQNKEPELLLKSSSGNKVNRGFKADLVKSDSSFHLQKPSVQASDSAVYYCALR
Megaderma lyra V391 trav AWHB01262979.1 1502 GSNGDSVSQTEGSVILSEDSPMILNCNYQTTYSSPYLFWYVQYRNKAPQLLLKSATDNKKTEHHGFEAKLIKSDKTFHLQKSSLQMSDSALYYCVLG
Megaderma lyra V400 ighv AWHB01278891.1 3733 IQCEVQLVESGGKLVQPGGALGLSCAASGFTFSSYHMHWVRQAPGKGLEWVAVIRYDGSEKYYAESVKGRFTISRDNAKNMLYLQMTSLRAEDTAVYYCA
Megaderma lyra V422 trdv AWHB01315795.1 772 CSMAVVVTQAQTTIAVREGEAVTMHCTYDVTWTRYILYWYKQVPSGEMAFLLYQDSSKTNAKKDRYSVNLQKAKKIISLTISPLQRADSAKYFCALSV
Megaderma lyra V424 ighv AWHB01319358.1 7255 VYSQVQLVQSEAEVRKPGTSVKVSCKASGYTFTSYGMQWVRQAPGQRLEYIGWINTNTGKPTYAQGFSDRFVFSMDASVSTAYLQINSLKSEDTAVYYCAR
Megaderma lyra V428 trdv AWHB01333399.1 14773 VSLDIILEPDTKTLTVLDGDTATFGCSVSGADLKNYQMSWYKKNEDNSLTLVYSLSNNSSDNSRSNFKGKIDALKSQYILDIQKTTTKDVGTYYCASY
Megaderma lyra V435 igkv AWHB01346119.1 400 VRCNIQMTQTPSSLYASLGDRVTITCKASQGISNYLDWYQQKAGRAPTLLIYAASNLHTGVPSRFSGQRSGTDFTLTISNLQPEDVATYYCEQYYSTP
Megaderma lyra V452 trav AWHB01385353.1 4381 RTHGDTVSQIKGPMTLSEGASLNVSCTYVAAGYPNLFWYVRYPEEGPQLLLKAMKAGEKGHNEGFEATYNKEQNSFHLEKASVHQSDSAVYYCALS
Megaderma lyra V471 iglv AWHB01425405.1 1651 ATSQAVVTQESLLSTTPGGTVTLTCGTSAGAVTTNNYANWVQQKPYQVPRGLIGGTSNRAPGVPARFSGSLLGNKAALTIAGAQPEDEAEYYCAL
Megaderma lyra V490 trbv AWHB01446913.1 3514 HMGAMITQNPRYQVTRVGKRVTLNCSQDLNHDTMYWYQRKLSQAPKLLFYYYDQEFNNETDTSDNFQPSRPNASFCSLGIRSPGLGDSAVYLCASSR
Megaderma lyra V491 trbv AWHB01446914.1 1604 HGSAGVTQSPRHRVTEKEQAVTLRCDPISGHDTPLWYQHAVGKEVTFLIHFLQKSKQYDSGMPNNQFSAERTEGTYSILRIQPAQVEDSGGYFCASSP
Megaderma lyra V492 trbv AWHB01446915.1 2173 PKAAAGVTQRPRHEVTKMGQTVTMSCKPVSGHNDLYWYRETSVQGLELLIYFRYQKPMDDTGMPKGRFSAQMPNGSLSTLNIQSAEPGDSAVYLCASSL
Megaderma lyra V496 ighv AWHB01450905.1 1021 VVSEVQLQESGPGLVKPSQTLSLTCTVTGYSITNNYYWNWIRQPPGKGLEWMGNIYYTGSTNYNPSLKSRISISRDTSKNQFSLQLNSVATEDTAVYYCAR