WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Bos indicus AGFL00000000.1 (AGFL01) 97 0 7 2 40 29 8 11
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Bos indicus V48 trgv AGFL01039639.1 2343 GLGLSKVEQAQISLSTEVKKSINIRCKIESTNFESETVYWYRQKKDQALEHLVYVTSTTTAARNQVDGKNKIEARKDARMFTSTLTVNFIEKEDVGIYYCAGWS
Bos indicus V49 trgv AGFL01039647.1 1676 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLFVLDTPALNDLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWLL
Bos indicus V50 trgv AGFL01039672.1 300 TQVSSNMEEDKLSVMRATGSSVVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVYYSKVVLGSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos indicus V51 trgv AGFL01039673.1 7775 TQVSSNMEEDKLSVMRATGSSIVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVSNSKAVLDSGISEGKYHAYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos indicus V52 trgv AGFL01039673.1 27623 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bos indicus V55 trbv AGFL01041430.1 41328 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVGNETVPSRFSPESPDKAHLNLHIDSLEPGDSAMYFCASS
Bos indicus V56 trbv AGFL01041435.1 8932 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGPQFLVQYYNQKVRGESHLLDRFSGKQFSDSRSELNLSSLELTDSAMYLCASSE
Bos indicus V57 trbv AGFL01041437.1 101 AVYAGVTQDPSFQVVRKGLNVTLTCTQDLGHDSMYWYRQDLGHGLRLIHYSDGPPTTVKGDVPEGYSVSRPSKKDFPLTLKSANHSQTSVYFCASSY
Bos indicus V58 trbv AGFL01041440.1 8425 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVQYYSQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos indicus V59 trbv AGFL01041445.1 129 AVHAGVTQDPRCQVVKTGQKATLKCSQDLGHDRMYWYRQDPEHGLRLIHYSAAAPTTEKGDMPEGYSVSRLSTENFALTLESANRSQTSVYFCASSY
Bos indicus V60 trbv AGFL01041445.1 2392 LVDSGVTQTPEYLIKSRKQQVTLRCSPESGHLSVFWYQQALGQSPQFLVQYYDGKVYQKGNISDRVSGKQFSDAASELSLTPLELTDSAVYLCASSQ
Bos indicus V61 trbv AGFL01041446.1 263 AVHAGVTQDPRFQVVRRGQSATLKCTQDLGHDRMYWYRQDLGHGLRLIYYSAGVRSSEPGDVPDGYSVSRSNTENFPLTLKSANRSQTSVYFCASSY
Bos indicus V62 trbv AGFL01041448.1 138 AVHAGVSKDPILHVVRRGQSATLTCTQDLSFSYMYWYRQDPGNGLRLIHYSVIPPSMEKGAVPEGYRFSRPSTENFPLTLESANCSLTSVYFCTCGY
Bos indicus V63 trbv AGFL01041448.1 3770 AVHAGVTQDPRFQVVRTGQKATLTCTQDLDHNCMYWYRQDLGQGLRLIHYSVAAPNTVKGDIPEGYSVSRPSTKDFPLTLESANHSQTSVYFCASSY
Bos indicus V64 trbv AGFL01041451.1 5669 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHLSVFWYQQALGQGPQFLVQYYDGKVYQKGNISDRVSGKQFSDAASELSLTPLELTDSAVYLCASSQ
Bos indicus V65 trbv AGFL01041454.1 96 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos indicus V66 trbv AGFL01041455.1 769 TVYAGVTQDPRYQVVRRGQSTTLTCTQDLDHNSMYWYRQDPGHGLRLIHYSAGPPSTEKGDMPDGYSVSRSRKENFPLTLESANHSQTSVYFCASSYSMA
Bos indicus V67 trbv AGFL01041458.1 824 AVHAGVSKDPIFHVVRRGQSATLTCTQDLSFSYMYWYRQDPGNGLRLIHYSVIPPSMEKGPVPEGYRFSRPSTENFPLTLESANCSLTSVYFCTCGY
Bos indicus V68 trbv AGFL01041466.1 149 AVHAGVTQDPRFQVVRRGQSTTLTCAQDLGHNYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVLDRYSVSRSNTENFPLTLKSANRSQTSVYFCASSY
Bos indicus V69 trbv AGFL01041470.1 113 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos indicus V70 trbv AGFL01041472.1 162 AVYAGVSQDPRYQVVRRGQSTTLTCTQDLDHNSMYWYRQDPGHGLRLIHYSAGPPSTEKGDMPDGYTVSRSRKENFPLTLESANPSQTSVYFCASSYSMA
Bos indicus V71 trbv AGFL01041475.1 163 AVHAGVSKDPIFHVVRRGQSATLTCTQDLNFSYMYWYRQDPGNGLRLIHYSVIPPSMEKGPVPEGYRFSRPSTENFPLTLESANCSLTSVYFCTCGY
Bos indicus V72 trbv AGFL01041479.1 665 AVHAGVTQDPRFQVVRTGQKATLTCTQDLGHNCMYWYRQDLGQGLRLIHYSVAAPDTVKGDIPEGYRVSRPSTKDFPLTLESANHSQTSVYFCASSY
Bos indicus V73 trbv AGFL01041479.1 2892 LVDSGVTQTPRHLIKARGQRGTLGCSPVLGHLSVYWYQQALGQGPEFLVEYYRQEVRGEAQLLDGFSGKQFSDFHSELNLSLLELTDSAAYLCASSQ
Bos indicus V74 trbv AGFL01041480.1 13243 AVHAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASST
Bos indicus V75 trbv AGFL01041484.1 7265 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGLEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bos indicus V76 trbv AGFL01041492.1 13973 FLEAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTKEFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQPTEPQDSAMYFCASSD
Bos indicus V77 trbv AGFL01041494.1 6497 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQKQDIVKGTEVFKERFSAECPQNSPCSLEINSTEAVDAALYFCASSQ
Bos indicus V78 trbv AGFL01041495.1 7392 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYHQFPKLGLVLMATSNVGSDATYEQGYNKDKIPISQPNVTFSSLTVTRVDPADSGLYFCGAR
Bos indicus V79 trbv AGFL01041503.1 772 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQKQDIVKGTEVFKERFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos indicus V80 trbv AGFL01041508.1 12852 SMDNEVTQSPSHLVKGKGQKAKMDCVPIKGHVNVYWYRRKLEEAFEFLVYFQEQDIVEGTEVFKERCSAECPQNSPCSLEINSTEAVDSALYFCASSQ
Bos indicus V81 trbv AGFL01041512.1 1341 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQATTVFWYRQFPKQGLMLMATSNAGSDATYEQGYNKDKFPISHPDRTFSSLTVTRVDPADSSLYFCGAR
Bos indicus V82 trbv AGFL01041519.1 7737 PMDAEIYQIRFLLTEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSARTNQTAVYLCSG
Bos indicus V83 trbv AGFL01041522.1 1042 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Bos indicus V145 trdv AGFL01091536.1 5920 KGVLCNQVTQSSPEQRVASGSEVTLLCTFQTTYSDPDLYWYRKRPDGVFQFVLYRDNTRSYDADFARGRFTVLHSMSQKTFHLVISSVRPEDTATYYCALRL
Bos indicus V146 trav AGFL01091649.1 9749 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVWWYLQKPWGRHLIYIPSGTRQGGRLNATTVLKERRSSLHISFLRTTDSGTYFCAVQHCAPR
Bos indicus V147 trdv AGFL01091805.1 6648 SSVAQRVAQDQPDISSQVGEVVTLNCQYDTRLSSFRIFWYKQLASGEMIYLIGQVSSSQKARDGRYTTDIQRSRKSISLTISDLQLEDSAKYFCAVWE
Bos indicus V148 trdv AGFL01091835.1 1960 SGVAQKVTQDQPVISSQVGQSVTLNCRYETSYWSYYNLFWYKQLPNGQMTYLIEQYSEYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos indicus V149 trav AGFL01091844.1 336 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASIYFFWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATNPGDSATYFCATR
Bos indicus V150 trav AGFL01091852.1 6159 QTHGNSVTQMDGQVSRSEGTSVTINCTYSISGYPNLFWYVQYLGEGPELLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Bos indicus V151 trav AGFL01091854.1 93 SSIAQKVTQDQPPMSVQEKETVTLNCTYDTSGTTYSPFWYKQHSSGVMAFLIPQDSYNKPNAAEGHYSLNFQKASKFITLTISASQLGDSAVYFCALSE
Bos indicus V152 trav AGFL01091859.1 4732 QTCGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGTNKGFEATYNKETTSFHLEKASVQESDSAVYYCALS
Bos indicus V153 trav AGFL01091865.1 1294 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLVWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRE
Bos indicus V154 trav AGFL01091880.1 3672 GTRGDLVTQTEGVVTLPEKASLTLNCTYQSSYSGFLFWYVQYQNRELEMLLQSSLGNQKVTNRGFEATHISRDSSFHLQKSSVQTSDSALYYCALS
Bos indicus V155 trav AGFL01091885.1 15499 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos indicus V156 trav AGFL01091886.1 1443 VQGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVIWYLQNSGGHLIQLFYIPSGTKQDGRLMATTVPKERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos indicus V157 trav AGFL01091927.1 8902 TVTDAKNAQPSSMDYPEGQDVTLSCNHSTIGRNEYIYWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos indicus V158 trdv AGFL01091933.1 144 SSVAQRVAQDQPDISSQVGEVVTLNCQYETRLSSFRIFWYKQLASGEMIYLIGQVSSSQKARDGRYTTDIQRSRKSISLTISDLQLEDSAKYFCAVWE
Bos indicus V159 trdv AGFL01091957.1 416 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSYWSYYNLFWYKQLPNGQMTYLIEQYSEYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos indicus V160 trav AGFL01091963.1 290 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos indicus V161 trav AGFL01091965.1 395 VQGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVIWYLQNSGGHLIQLFYIPSGTKQDGRLMATTVPKERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos indicus V162 trav AGFL01091972.1 5121 TVTDAKTTQPSSMDYPEGQDVTLSCNHSTIGRNEYICWYQQNPNQSPQYVVHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVPRE
Bos indicus V163 trdv AGFL01091979.1 345 SSVAQRVAQDQPDISSQVGEVVTLRCQYETRLSSFRIFWYKQLPSGEMIYLIGQVSSSQKARDGRYTTDIQRSRKSISLTISDLQLEDSAKYFCAVWE
Bos indicus V164 trav AGFL01091986.1 674 MNGQQIKHFPEFLLLQEGENFTTYCNSSSILSSLQWYKQRPGGSPVLLMILAKGGEVKTEQRLTDRLGETRQHSSLYLAAAQLSDAGTYFCA
Bos indicus V165 trav AGFL01091991.1 5312 TVINAKTTQPGSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQTPQYVIHGLRGTVNSSMASLTVASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos indicus V185 igkv AGFL01102192.1 1320 SSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGKTYLNWIPYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDP
Bos indicus V186 igkv AGFL01102192.1 16740 ARCDIQVTQSPSYLSASLGDRVSITCQANQSVSHYLNWYQQKPGEAPKLLIYYATSRYTRVPSRFSGSGSGTDFTLTISSLEADDAANYYCQQDYS
Bos indicus V250 iglv AGFL01146904.1 3896 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNCVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bos indicus V251 iglv AGFL01146917.1 3105 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVSWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos indicus V252 iglv AGFL01146917.1 14980 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSN
Bos indicus V253 iglv AGFL01146942.1 1705 SWAQSGLTQPSSVSGNLGQTVITSCAGTSSYVGSYNGVGWYQQLLGSAPKTLIYNVSKRPSGIPDRFSGSKSGNTATLTVSGLQAEDEADYYCSSYKSGGS
Bos indicus V254 iglv AGFL01146946.1 3884 SWAQSGLTQPSSVSGNLGQTVTISCAGTSSDVGAYNGVGWYQQLPGSAPKTLIYNLNKRSSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSLKSGGS
Bos indicus V255 iglv AGFL01146948.1 7665 HLASSQLTQPPAVSVSLGQTASITCQGDDLESYYAHWYQQKPSQAPVLVIYESSERPSGIPDRFSGSSSGNTATLTISGAQTEDEADYYCQSYDSSGD
Bos indicus V256 iglv AGFL01146955.1 10001 SVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bos indicus V380 trgv AGFL01037139.1 9490 IPQEIRVFQRSVMVGHAGGALTMPCQISKSVDYVHWFRQLESQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWGS
Bos indicus V388 trgv AGFL01039608.1 403 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLFVLDTPALNDLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWLL
Bos indicus V389 trgv AGFL01039617.1 819 GLGLSKVEQAQISLSTEVKKSINIRCKIESTNFESETVYWYRQKKDQALEHLVYVTSTTTAARNQVDGKNKIEARKDARMFTSTLTVNFIEKEDVGIYYCAGWD
Bos indicus V449 trdv AGFL01091560.1 10493 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGGFKGKIDTSKNQYVLNIQKTTIKDVGTYYCGS
Bos indicus V450 trav AGFL01091595.1 7368 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPSDTALYLCALE
Bos indicus V451 trav AGFL01091612.1 5678 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPSDTALYLCALE
Bos indicus V452 trav AGFL01091655.1 26695 TVIDAKTTQPSSMDCAEGEDVNLPCNHSTICGNVYIHWYRQNPNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos indicus V453 trav AGFL01091655.1 5316 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVRWYLQKPGGRHLIYIPSGTRQGGRLNATTVLKERRSSLHISFLRTTDSGTYFCAVQHCAPQ
Bos indicus V454 trav AGFL01091660.1 3883 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKSLKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos indicus V455 trav AGFL01091669.1 1781 VSRLLTVEQHPLLLWVQEGESTNFTCTFPSSSFYALHWYIWKPAKGPKNLIVISVNGDEKKQGRVRVTLNTKEGYSSMYIRRSQPEDSATYLCA
Bos indicus V456 trdv AGFL01091670.1 5634 SGVAQKVTQDQPDISSEAGEAVTLNCRYETSWSSYNTFWYKLFASGEMTFLIGQGSYSLNARDGCYSINFQKSRKAISLTISDLQLEDSAKYFCTLWE
Bos indicus V457 trav AGFL01091676.1 5662 NVFDAKTTQPSSMDYPEGEDVTLPCNHSTISGNEYIHWYRQNPSQSPQYIIHGFRDTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos indicus V458 trav AGFL01091677.1 3187 LSDEDQVEQSPQTLRIQEGDSLSLNCSYSSFRRLQWYRQDPGKGPELLFLLYSVGDEKQKKRLKATLLKKGSSMHIEAPKHEDSATYHCAVQTQCSP
Bos indicus V459 trav AGFL01091679.1 1481 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos indicus V460 trav AGFL01091701.1 321 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHLEKDSGQESDSAVYYCAWR
Bos indicus V461 trav AGFL01091703.1 7021 DSRGQSVTQPNDPVFVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSDFSFNLRKFSAHWSDSAEYFCALS
Bos indicus V462 trdv AGFL01091707.1 2660 SGVAQKVIQDQPYITSQIEQSVILKCRYELSQSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYFVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bos indicus V463 trav AGFL01091712.1 14867 VNNQQGKQKLQTLSIQEGENVTMNCSYKSITLTALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDNSIKSSSLSIMASQTEDTATYLCAP
Bos indicus V464 trav AGFL01091718.1 2235 QTCGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGTNKGFEATYNKETTSFHLEKASVQESDSAVYYCALS
Bos indicus V465 trav AGFL01091720.1 1865 SSIAQKVTQDQPPMSVQEKETVTLNCTYDTSGTTYSPFWYKQHSSGVMAFLIPQDSYNKPNAAEGHYSLNFQKASKFITLTISASQLGDSAVYFCALSE
Bos indicus V466 trav AGFL01091721.1 1638 VSLGNKVEQSPTLSVQEGNSTFITCTYTDGNSNYFPWYKQEPGKGPQLLIAIHSNKAKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAS
Bos indicus V467 trav AGFL01091726.1 1489 QTHGNSVTQMDGQVSRSEGTSVTINCTYSTSGYPNLFWYVQYLGEGPELLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Bos indicus V468 trav AGFL01091902.1 346 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLVWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRE
Bos indicus V469 trav AGFL01091920.1 412 KSRGEKVEQYSSFQSVQEGDNCVINCTYIDSASIYFFWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATNPGDSATYFCATR
Bos indicus V470 trdv AGFL01092006.1 2058 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYINTYYIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCALRE
Bos indicus V471 trav AGFL01092010.1 1734 VNGQQISQIPQFLPLQEGENFTTYCNSSSTFYRLQWYKQSPGGIPVFLMILAKDGDVKTQQRLTGRFGETRKHGSLHLAAAQLSDAGTYFCAE
Bos indicus V472 trav AGFL01092013.1 15396 VRGMDVAQSPPALSLQEGASSTLRCNFSTFADSMQWYLQNPGGRLIHLFYVPSGTKRDGRLNATTVPTERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos indicus V473 trav AGFL01092013.1 6383 QVKQSPQPLTVQEGEISILNCSYEKSAFDYFPWYWQYPGKGPAFLIAIHSVVNEMKDGRLTIFLNKSAKQLSLHIATSQPGDSATYFCAASAQCSP
Bos indicus V474 trav AGFL01092025.1 1542 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVLGSPYLFWYVQHRNLGLQFLLKYISGDTLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos indicus V475 trav AGFL01092043.1 25759 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYAQYRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVQGSDSALYFCAVR
Bos indicus V476 trav AGFL01092043.1 8588 GLRAQSVTQPEAEVSVAEGDPVTVKCTYTVSGSPYLFWYVQHRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSTLYFCAVS
Bos indicus V540 trdv AGFL01129678.1 14161 AQAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Bos indicus V640 trav AGFL01203183.1 1720 VNGQQISQIPQFLPLQEGENFTTYCNSSSTFYRLQWYKQSPGGIPVFLMILAKDGDVKTQQRLTGRFGETRKHGSLHLAAAQLSDAGTYFCAE