WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Choloepus hoffmanni ABVD00000000.2 (ABVD02) 235 43 92 18 42 27 5 8
Choloepus hoffmanni ABVD00000000.1 (ABVD01) 122 24 39 11 26 14 5 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Choloepus hoffmanni V1 iglv ABVD02002548.1 5752 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNLVSWYQQHPGTAPKLLIYRVNKRPSGIPDHFSGSKSGNTASLSITGLLSEDEADYYCASYAGSNN
Choloepus hoffmanni V2 iglv ABVD02005091.1 3284 SWAQSGMVQEALDSGSPGHTVTITCKGSNIVLGALGAGWYQQLPGGVPKTVMFGTSQPSGIPAQFSGSKTSGRASLTISGLQPEDKAVYYCSAFDA
Choloepus hoffmanni V3 iglv ABVD02005223.1 1970 SWAQSGLTQEASVSGSLGQTVTITCKGSSPFLSALGAGWYQQIPGDTLKTVMLGTSRPSGIPDRFSGSKASGTASLTISGIQPEDEAVYYCSTFDP
Choloepus hoffmanni V6 iglv ABVD02011071.1 1241 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVHWYQQLPGKAPKLLIYGSSNRPSGVPDRFSGSRSGNSGSLSITGLQPEDEADYYCSVWDSSIRG
Choloepus hoffmanni V7 igkv ABVD02011497.1 787 ASGDITLTQSPDSVAGSQRETVTISCKSSQSVSNYLHWYQQKPGQAPKLLIYAASTQASGVPDRFTGSGSGTDFTLTINKFQPEDVASYYCQQSSSYP
Choloepus hoffmanni V8 iglv ABVD02011562.1 26224 SWAQSALTQPPSVSGSLGQMVTISCAGSSSDIGGHNYVSWYQQHLGTAPKLLIYRVSNRPSGIPDRFSGSKSGNTASLRISGLQPEDETDYFCA
Choloepus hoffmanni V17 iglv ABVD02020696.1 689 SWAQAVLTQPPSVSGALGRKVTISCSGSSTNISGGYAVHWYQQLPGTAPKLLIYGNSNRPSGVLDRFSGSKSGNSGSLSITGLQPEDEADYYCSSWDSSISG
Choloepus hoffmanni V21 iglv ABVD02024851.1 9343 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGSNSVSWYQQHPGTAPKLLIYRVSNRPSGIPDRFPGSKSGNTASLTITGLLSEDEADYHCASYASTSY
Choloepus hoffmanni V22 iglv ABVD02027877.1 2992 SWAQSGLTQEASVSGSLGQTVTLTCKGISPVLSALGAGWYQQLPGGTLKTVMLGTSRPSGIPDQFSGSKASGTASLTISGIQAEDEAVYYCSTFDP
Choloepus hoffmanni V31 iglv ABVD02042734.1 81 SVASFELTQPRSVSVALGQTASLTCSGGKFEKNYVYWYQQKPDQAPKLVIYKDSERPSGIPDRFSGSSSGNTATLTISGAQNEDEADYYCLSSESDSDA
Choloepus hoffmanni V37 iglv ABVD02050255.1 2557 SWAQSGLTQEASVSGSLGQTVTITCKGSSSDLGAYGAGWYQQLPGGTPKTVMLGTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V39 iglv ABVD02054143.1 8070 SWAQSGLTQEASVSGSLGQTVTLTCKGSSPALRAFGAGWYQQIPGGTLKTVMLGTSRPSGIPARFSGSKASGTASLTISGIQAEDEAVYYCSTFDPSSSA
Choloepus hoffmanni V42 iglv ABVD02073425.1 4680 SVASFELTQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQTPKLVIYEDSKRPSGIPDRLSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V47 iglv ABVD02088332.1 542 SVASFELTQPHSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRLSGSSSGNTATVTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V49 iglv ABVD02096531.1 474 SLSQPVLTQPPSASASLGASVKLTCTLSSEHSSYWIEWFQQRPGKGPQYVMQVKSDGSQSKGDGIPDRFLGSSSGADCYLTISSLQAEDEADYFCGVSYSSGY
Choloepus hoffmanni V57 iglv ABVD02140748.1 288 SLSQPVLTQPPSLSASLGTTARLSCTMSSGANVGGFYIHWYQQKPGSAPRYFLYYYSNSDKQLGPGVPSRVSGSKDTSSNAAYLHISGLQPGDEADYYCPI
Choloepus hoffmanni V59 iglv ABVD02163348.1 2622 SWAQSGLTQEASVSGSLGQTVTITCKGSSSDLGAYGAGWYQQLPGGTPKTVMLGTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V61 iglv ABVD02164972.1 694 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVHWYQQLPGKAPKLLIYGSSNRPSGVPDRFSGSRSGNSGSLSITGLQPEDEADYYCSVWDSSIRG
Choloepus hoffmanni V62 iglv ABVD02165700.1 2211 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIRDDVMGDYVSWYQQHPGTAPKTIIYEVRKQPSGIPDHFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V64 iglv ABVD02198319.1 127 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGSHNYVSWYQQPPGTAPKLLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLLSEDEADYHCASYTSS
Choloepus hoffmanni V74 iglv ABVD02246749.1 37 SVASFELTQPRSVSVAVGQTARLTCSGGKLENNYAHWYQQKPDQAPKLVIYKDSEWPSGIPDQFSGSSSGNTATLTISGAQNEDEADYYCQSWDSDSDV
Choloepus hoffmanni V76 ighv ABVD02251866.1 158 VLSQVQLMELGPGLVKLLQNLYLTCSVSRSTLTSIYMHWIHQALGKGLEWVVRITSGGSTYYKPNLQSQLSITRDTSKNEVYLKLSSVTPEDTATYYCER
Choloepus hoffmanni V77 trav ABVD02251913.1 825 VSRGEKVEQQPSILSIQEGSSSIINCTYSDSGSEYIPWYKQERGRGPHLIIYIRSNVNIKQDQRLTVRRNKKDRHFSLEIADTLPGDSATYFCATS
Choloepus hoffmanni V80 iglv ABVD02254970.1 3198 SMASYELTQPHSVSVALGQTARLTCSGENIGSEYTQWYRQRPGHAPAFIISGDSNHPSGIPDWFSGSSSGNTATLTISGAQAKDEAEYYCQVWDIDSSA
Choloepus hoffmanni V81 igkv ABVD02254983.1 25959 TSGDTVMTQSPDSVVGSPGETITMSCKSNESVSDYVAWYKQKPGEVPKLLIYDADNQASGVPDRFSGSGSGRDFTFTITSVQPEDAGHYYCQQGY
Choloepus hoffmanni V82 igkv ABVD02254984.1 15375 AIGDTVMTQSPASLAVSPGETATINCKSSQSILYSSDKKNYLNWFQKKPGQSPKLLIYYASTRASGIPDRFSGSGSGTDFTLTISSFQPEDVADYYCQQSYSSP
Choloepus hoffmanni V95 ighv ABVD02258696.1 7268 VLSQVQLKESGSGLVKPSQTLSLTCSVSGYSITTNYCWSWIRQPPGKGLQWIGCIYYNGNTYYSSSLKSRSSVTRDTSKNQFSLQLSSVTAEDTATYYCAR
Choloepus hoffmanni V99 iglv ABVD02259745.1 2950 SWAQAVLTQPPSVSGALGQKVTISCSGSSTNIGGGYAVKWYQQLPGTAPKLLIYDNSKRPSGVSDRFSGSKSGNSGSLSITGLLPEDEADYYCQSYDKSLGA
Choloepus hoffmanni V105 trav ABVD02261195.1 28247 VLRAQSVTQPEDQITVTEGDLLTMKCTYSLSGTPYLFWYVQYPNQGLQFLLKYITGNHLVKGSYGFEAEFNKSQNSFHLKKSSVLGSDSALYFCAVR
Choloepus hoffmanni V106 trav ABVD02261195.1 34138 TLSLAKTMQPISVDSYEGQEVNISCSHADIATNEFIFWYRQFLNEGPQFIIQGYKTNVANEVASLFVSKDRKSSTLSLPWAALRDTAVYYCIVRV
Choloepus hoffmanni V107 trav ABVD02261195.1 42237 GTRAQAVTQPDALVTVAEGDPLELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYVSGNSLVTGIKGFKAEFRKSETSFHLGKASAQWSDSAMYFCVLS
Choloepus hoffmanni V108 trav ABVD02261195.1 51163 GVTGVKVDQSPSALSLQEGTSFTLRCNYSTTVSNVQWFQQIPGGGLISLFFMATGTKQSGRLKSTINSKELYSTLHIMPSQLEDSATYLCAVE
Choloepus hoffmanni V109 trav ABVD02261195.1 60812 VNSQEVEQTPQVLSIREGEKSTLTCNYTGTPVVLQWYRQDPGRGPIFLVLIHGNEGQKQKDRLRVTFNATVKQSSFQISDSQPVDSATYLCAA
Choloepus hoffmanni V110 trav ABVD02261195.1 65875 GTTGDSVTQTEGLITLLEEAPLTLNCTYQSSYSPFLFWYVQHPNKAPQLLLKSSSENQEVDSRGFQATHVKSDSSFHLWKPSVQTSDSAVYYCVLS
Choloepus hoffmanni V111 trav ABVD02261195.1 92178 DVRAQSVSQPQVHISISEGAFLELRCNYSYVGTPYLFWYVQYSSQGLQLLLKYFPGNTLIKGINNFEAEFQKNESSFHLRKPSIHWSNAAEYFCAVS
Choloepus hoffmanni V112 trav ABVD02261195.1 97868 GTSGDLVTQTEGQVTLSEEAFLSVNCSYTSKQYPSLFWYVQYPGEGPQLLLKAMMANEKGSNKGFEATYNKETNSFHLEKASVQESDSAMYYCALS
Choloepus hoffmanni V113 trav ABVD02261197.1 8966 EARAQSVSQPQVHISTLEGSSLELGCNYSYGATPYLFWYVQYPSQGLQLLLKYTSGDNEVKGIKGFEAEFQKSKSSFNLKKHFVLWSDSAVYFCALS
Choloepus hoffmanni V114 iglv ABVD02261298.1 14116 SRAQSRLTQEASVSGSPGQTVTITCKGSSPVLSALGAGWYQQLPGGAPKTVMLGSSRPSGIPARFSGSKASGTASLTITGLQPEDKAVYYCSTVDI
Choloepus hoffmanni V115 iglv ABVD02261298.1 17206 SWAQSALTQPPSVSGSLGQTVSISCAGSSSDIGGYNYVYWYQQHPGTAPKLLIYEVNKRASGIPDRFSASKSGNTASLTISGLLSEDEADYHCE
Choloepus hoffmanni V118 igkv ABVD02262079.1 2229 ASGDIVMTQSPASLAVTPGETTTINCKSSQSVLYSSNQKNYLAWYQKKTGQSPKLLIYDASTRASGVPDRFSGSGSGTDFTLTINRVQPEDVAEYYCQQYYSSP
Choloepus hoffmanni V129 iglv ABVD02263246.1 7382 SWAQSGLTQEASVSGSPGQTVTLTCKGSSSYLGAYGAGWYQQFPGGTPKTVMLGTSRPSGIPARFSGSKASGTASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V132 igkv ABVD02263891.1 4526 ASGDIVMIQSPDSLAVTPGETTTINCKSSQSVLYSSNQKNYLAWYQKKTGQSPKLLIYDASTRASGVPDRFSGSGSGTDFTLTINRVQPEDVAEYYCQQYYSSP
Choloepus hoffmanni V133 iglv ABVD02263968.1 7472 SLSQPVVTQPPSLSASLGSSVRLPCTLSSGINVGGYHIHWYQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGSKDTSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V136 iglv ABVD02264693.1 23907 SLSQPVLTQPPSISASSVRLPCTLSSGINVGEYTICWYQQKPGSPPQYLLSYDTDSNKHQGSGAPSCFSGSKDASANAGLLLISGLQPEDEADYYCQI
Choloepus hoffmanni V137 iglv ABVD02264693.1 34029 SVASFELTQPRSVSVAVGQTARLTCSGGKLENNYAHWYQQKPDQAPKLVIYKDSEWPSGIPDQFSGSSSGNTATLTISGAQNEDEADYYCQSSESDSNA
Choloepus hoffmanni V139 iglv ABVD02265047.1 5758 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGHNYVFWYQQHPGTAPKLLIYYVNKRPSGIPDRFSGSKSGNTASLTITGLLSEDEADYHCASYASTSY
Choloepus hoffmanni V143 iglv ABVD02267010.1 4846 SWAQSGLTQEASVSGSLGQTVTLTCKGISPVLSALGAGWYQQLPGGTLKTVMLGTSRPSGIPDQFSGSKASGTASLTISGIQAEDEAVYYCSTFDP
Choloepus hoffmanni V145 iglv ABVD02267681.1 796 SLSQPVLTQPPSASASLGASVKFTCTLSSEHSSYYIEWFQQRPRKGPQYVMQVKSDGSQSKGDGIPDCFSGSSSGADRYLTISNLQAEDEADYFCGVGDSSGY
Choloepus hoffmanni V146 iglv ABVD02267682.1 561 SLSQSVLTQPPSASASLGASVKLPCTLSSEHSSYWIEWFQQRPRKGPQYVMQVKSDGSQSKGDGIPDCFSGSSSGADRYLTISNLQAEDEADYFCGVGYSSGY
Choloepus hoffmanni V147 iglv ABVD02268992.1 215 SVASYEVTQPCSVSVALGQTARLTCGGNNIGRKSVQWYQQTPGQAPVLLIYADNQRPSGIPDRSSGSNSGNTATQTISRVQTEDEADYYCFAAGSGV
Choloepus hoffmanni V150 igkv ABVD02272558.1 8897 ASGDIMLTQSPESVAKSPGETVTISCKSSQGISSYVAWYQQKRGQAPKLLIYDASNRVSGVPDRFSGSGSGTDFTFTISKFQAEDVADYYCQQRQSY
Choloepus hoffmanni V167 igkv ABVD02277002.1 9878 ASGDIVMTQSPVSVAGSPGETITMSCKSSQGVSNDVGWYQQKPGQAPKSLIYDASTRFSGVPDRFSGSYSGTEFTLTIRSFQPEDVAVYYCMQRNSN
Choloepus hoffmanni V183 trbv ABVD02280426.1 554 PVDAGITQTPRYHIIQTGKKTVLQCFQDMDHLAMYWYLQNPGQGLWLIHYSGGTDSTDNGDVPDGYSVSRKKKDRFPLTLESASTNQTSFYLCASSL
Choloepus hoffmanni V184 trbv ABVD02280427.1 113 LVDSGVTQTPRHLIKTRGQKVILRCSPISGHVSVFWYQQALSKTPQFLFQFYENLQRAKGDVPDRFSAEQFRDYSSELNVSSLQLEDSALYLCASSL
Choloepus hoffmanni V185 trbv ABVD02280427.1 6229 HTGAGVSQSPRHRVIESGQAVTLRCDPISGHIYLYWYLKIPGQGLEFLTYLRYNEALDKSEMPEDRFSAEKTDGSDSVLKIQPAELRDSAVYLCASSE
Choloepus hoffmanni V186 trbv ABVD02280427.1 11126 SVDAGVIQSPRYLIKGKPGKAILKCYPMARHRSVYWYQQDLGQGPQFLIEYFEKTQRNKGNIPDQFSVQQFDDYSSELNMSSLEVEDSALYLCASSL
Choloepus hoffmanni V187 trbv ABVD02280427.1 17347 HMEAEIIQSPRHKVAKTGKEVILRCHQNKNHEYMYWYRQDLGQALRLIYYSTGVNITDKGEIHDGYGVSRSKTEDFSLTMESAASSQTSVYFCASSD
Choloepus hoffmanni V188 trbv ABVD02280429.1 16056 SVDAGVIQSPRYLIKGKPGKAILQCYPMAGHRSVYWYKQDLGQGPQFLVEYFEKTQRDKGNIPDRFSVQQFDDYSAELNMSSLEVEDSALYLCASSL
Choloepus hoffmanni V189 trbv ABVD02280429.1 22233 HMEAEITQSPRHRVAKTGKEVILRCHQNKNHDYMYWYQQDLGQALRLIYYSAGVNITDKGEVHDVYSVSRPKIEHFSLTMESAAPSQTSVYFCASSD
Choloepus hoffmanni V190 trbv ABVD02280429.1 38210 HTDAGVIQTPRNKVVEMKRAVTLRCEPIPGHTTIFWYRQTLGQGLQLLIYFRNQAPVDDTGMPKPRFSAEMPEKSSSILKIQPTEPEDSAVYLCASSL
Choloepus hoffmanni V191 trbv ABVD02280429.1 53036 QVDAMVTQSPRYRVTRMGKPVNLSCSQNLKHDVMYWYQQKLNQGPKLLFYYYDTQFNKEADTSDNFQSSRPNTSFCSLGIRSPGLGDSATYLCASSR
Choloepus hoffmanni V192 trbv ABVD02280429.1 68703 PTNAGVTQNPRYLITGKGQEATLRCSPVEGHSHFYWYRQLPEKGLKFMIYLQKEQIVDDSGKPTNRLSAEFSKEGLSILKFQLAELADSAVYFCASSL
Choloepus hoffmanni V193 trbv ABVD02280429.1 73949 PMDGGITQTPKYLFREEGQNVILECEQNLNNDAMYWYRQDPGQGLRLIYYSPVTNDVQKGDLSEGYRASREKKTQFHLTVTSTHKNQTALYLCASSM
Choloepus hoffmanni V194 trbv ABVD02280429.1 77130 SGLGGLVSQHPGTVICKSGTSVKILCHLVGLQVPTVFWYHQYPKQSFILIATSNGVSSIAHENDFTEAKFPISHPNLTFSTLMVTSVQPEDSSFYFCSAS
Choloepus hoffmanni V195 trbv ABVD02280429.1 90448 SRDTEVTQNPRYLVKGKKQTAEMNCVPIKGHSYVYWYRKKLEEELKLMIYFQNEDVIDKSGIPREQFLAQCSKNLNCSLEIQSTEQEDSALYFCASSQ
Choloepus hoffmanni V196 trbv ABVD02280429.1 108592 SMDSGVTQTPRNGIIKTGKNIVLECTQTKGHDAMYWYRQDPGLGLRLIYYSLDVKDINKGEVSDGYSVSREKQPKFSLSLETAVPNQTALYFCASSY
Choloepus hoffmanni V197 trbv ABVD02280429.1 125918 PTEAEVTQSPRHLIIGTTKEVKVTCSQDMNHEAMYWYRQDPGMGLKLIYYSNNVDIINDGDVPDGYNVSRKEKRNFPLTLKSSSTNQTSLYLCASSL
Choloepus hoffmanni V198 trbv ABVD02280429.1 135347 LMNAKVTQTPSYLITRIGNKVSLECVQHMGHERMFWYRQDPAQGLRLIYSSYDVDSKEKGDVPNGYSVSRKKREEFTLTLESPSTNQTSVYFCASSL
Choloepus hoffmanni V199 trbv ABVD02280429.1 147263 FVSGVLLSQRPSRDICKSGTSVTIQCHQVDRQDVFMFWYLQPPGQSLLMVATANQDSEATYESGFTNAKYPISRPKLTFSTLTVSNASHEDSGLYLCSSG
Choloepus hoffmanni V212 iglv ABVD02282463.1 5602 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNLVSWYQQHPGTAPKLLIYYISKRPSGIPDRFSGSKSGNTASLTISGLLSEDEADYYCMSWTSS
Choloepus hoffmanni V238 iglv ABVD02287290.1 565 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVHWYQQLPGKAPKLLIYGSSNRPSGVPDRFSGSRSGNSGSLSITGLQPEDEADYYCSVWDSSIRG
Choloepus hoffmanni V250 iglv ABVD02288947.1 8617 SVASYEVTQPRSVSVALGQTARLTCGGDNIGNKAVHWYQHMPGQTPVLLIYTDKNRPSGIPDRFSGSNSGNTATLTISGVQAGDEADYYCQAADSGA
Choloepus hoffmanni V275 iglv ABVD02295531.1 477 SVASFELTQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRFSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSV
Choloepus hoffmanni V312 iglv ABVD02303267.1 14005 FVASFELTQPRSVSVALGQTARLTCSGGKFEDRYAFWYQQKPDQAPKLVIYEDSKRPSGIPDRFSGSSSGNTATLTISGVQTEDEADYYCLSSESESSA
Choloepus hoffmanni V323 igkv ABVD02305206.1 10123 ASGDIVMTQSPASLALSPGETTTLNCKSSQSVFHSSYKTSYLNWYQKKPGQPPKLLIYMASTRQSGVPDRFSGSGSGTDFTLTISSFQPEDVADYYCQHSYSSP
Choloepus hoffmanni V324 igkv ABVD02305210.1 54374 ACGDIVMTQSPVSVAGSPGETITMSCKTSQGVSDDVSWYQQKPGQAPKLLIHDASHRFSGVPDRFTGSYSGTEFTLTISSFQPEDAGHYYCQQDN
Choloepus hoffmanni V341 ighv ABVD02308784.1 38998 VLTEVQLVQSGAEVKKPGEPLTIACKASGYSFTSYWIHWVRQPPGKGLEWVGRIYPGDADTNYSPSFRGQVTISTENSASTAYLKFTHLKDSDTAVYYCAR
Choloepus hoffmanni V359 iglv ABVD02312238.1 4207 SVASYEVTQPRSVSVALGQTARLTCGGDNIGNKAVHWYQQMPGQAPVLLIYSDDSRPSGIPDRFSGSNSGNTATLTISGVQTEDEADYYCFAAGSGA
Choloepus hoffmanni V367 iglv ABVD02314285.1 1196 SVASFELTQPHSVSVALGQTASLTCSGGKFEKNYVYWYQQKPDQAPKLVIYKDSERPSGIPDRFSGSSSGNTATLTISGAQNEDEADYYCQSSKSDSDA
Choloepus hoffmanni V373 ighv ABVD02315902.1 15338 VLSQVQLKESGPGQVKASQTLSLTCSVSGISLTYYAVAWKRHAPGKGEENVGVISRYGSTNYNPAFQSRVTITRDTSKNEFYLKLSSVTPEDMATYYCGI
Choloepus hoffmanni V374 ighv ABVD02315903.1 5082 VLSHVQVKESGPGLVSPSQTLSLTCSVSGSSVTSIYIHWIQQALGKGLEWVGVIIRGGSTNYNPTLKSQVTITRDNSKNKVYLKLSSMASKDMATYYCAR
Choloepus hoffmanni V382 iglv ABVD02317348.1 2211 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIRDDVMGDYVSWYQQHPGTAPKTIIYEVRKQPSGIPDHFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V402 iglv ABVD02323378.1 83 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGSYNYVYWYQQHPGTAPKLLIYDVSKRPSGIPDRFSGSKSGNTASLRISGLQTEDEADYHCASYTSS
Choloepus hoffmanni V403 iglv ABVD02323378.1 18506 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGHNYVSWYQQHPGTAPKLLIYRVSNRPSGIPDSFSGSKSGNTASLTISGLHTEDEADYYCMSWTSS
Choloepus hoffmanni V417 igkv ABVD02328005.1 17843 ACGDIVMTQTPDSVAGSPGEKITMKCKSSQSVSSYLAWYQQKPGQAPKLLIYGASSQASGVPDRFSGSGSGTDFTFTISSFQPEDVGLYYCQQYNSYT
Choloepus hoffmanni V418 iglv ABVD02328171.1 81 SVASFELTQPRSVSVALGQTASLTCSGGKLEKNYAHWYQQKPDQAPKLVIYKDSERPSGIPDQFSGSSSGNTATLTISGAQNEDEADYYCQSSESDSDA
Choloepus hoffmanni V422 iglv ABVD02328660.1 255 SVASYEVTQPCSVSVALGQTARLTCGGNNIGRKSVQWYQQTPGQAPVLLIYADNQRPSGIPDRFSGSNSGNTATQTISGVQTEDEADYYCFAAGSGV
Choloepus hoffmanni V446 trgv ABVD02333613.1 21202 SQSAPNLEWRRRSVTGQTGATVEITCDIVVQTSTYLHWYRHLEGKAPQRLLYYYPRSSKFWVDSGIDQRKYDAYTNRDNSYKLQVRNLEESDSGVYYCAVWD
Choloepus hoffmanni V447 trgv ABVD02333614.1 11633 SQSAPNLEWRKRSVTREIGETVVITCDIVGQNSYYVHWYRHQEGKAPQRLLYYQPSTSKFWVDSRIKQSKYDAYTGRDRSYKLVVQKLEESDSGVYYCAVWD
Choloepus hoffmanni V448 trgv ABVD02333614.1 19822 KLEQPQLSSTKMRLKTARLECVVSGVLISAISIHWYQEKPGEAMQHLLYISSDNTVKMESGITQDKFEVDKIPEMSTSTLTIHSVEKQDSAIYYCASWE
Choloepus hoffmanni V453 ighv ABVD02334337.1 3957 VLSQVCLQESGPGLMKPFQTLGLTCIVSGFSVTASGSCWNWIHQPPGKGLQWLSRTCSNDDTYYNPSLKSRLPIPRGTSRNQFSVQLSSICAEDMAMYYCVR
Choloepus hoffmanni V454 iglv ABVD02334368.1 6437 SWAQSGLTQEASVSGSPGQTVTLTCKGSSSYLGAYGAGWYQQFPGGTPKTVMLGTSRPSGIPARFSGSKASGTASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V465 ighv ABVD02336843.1 10149 ALSQVQLKESGPGLVKPSQTLSLTCSTSGFSLTSYSVHWIRQFPGKGLEWVGVISYTGSAYFNPTLKSRLSITRNSSKNEASLKLSSLRTEDMATYYCAK
Choloepus hoffmanni V474 trdv ABVD02339518.1 117968 KGVFCNSVNQPGSPDRTVKWGDKVVLPCTYETQYTNPDLFWYRMRADRSYQFVLYRDNTRSRDADFTQGRFSVENHKTQRIFHLVISSARPEDSATYYCAL
Choloepus hoffmanni V506 ighv ABVD02347577.1 48699 VLSQVQLKESGPGLVKPSQTLSLTCSTSGFSLTSNGVHWIRQAPGKGLEWVGLMGYDGNTYFNPTLKSRLSITRDTSKNEVSLKLSSLRTKDTATYYCAR
Choloepus hoffmanni V507 ighv ABVD02347577.1 116562 VLSQVQLQESGPGLVKPSQTLTLTCSFSGFSITTNAYSLEWIRQPPGKGFQWVGAIWYDGSTYYNPSLKSRSSISRDTSNSQFSLQLSSMTSEDTATYYCAK
Choloepus hoffmanni V508 ighv ABVD02347582.1 14507 ALSQVQLKESGPGLVKPSQTLSLTCSVSGFSVTSNGVHWIRQAPGKGLEWVALISYSGSTYFNPTLKSRLSITRDTSKNEVSLKVSSLRTEDTATYYCAK
Choloepus hoffmanni V509 ighv ABVD02347585.1 65674 VLSQVQLQESGRGLVKPSQTLSLTCSVSGFSITTSSYCWEWIHQSPGKGLQWIGHICHNGNTYYSPSLKSHSCITRDTSKNQFSLQLSSMTAEDRATYYCVR
Choloepus hoffmanni V519 iglv ABVD02350097.1 7044 SWAQAVLTQPPSVSGALGQKVTISCSGSSTNIGGGYAVKWYQQLPGTAPKLLIYDNSKRPSGVSDRFSGSKSGNSGSLSITGLLPEDEADYYCQSYDKSLGA
Choloepus hoffmanni V520 iglv ABVD02350299.1 6566 SWAQSALTQPPSVCGSLGQTVTISCAGSSSDIRDDVMGDYVSWYQQHPGTAPKTIIYEVRKQPSGIPDHFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V537 igkv ABVD02353961.1 21834 CREQIILTQSPETLAASPGNFVSITCRSSSSVGTSMAWYQQKPNEAPRLLLFGASARAAGILSRFRGSGSGFDFSLGIHGVEAEDIRVYYCQ
Choloepus hoffmanni V553 iglv ABVD02358256.1 30266 SVASYELTQPRSVSVALGQTARLTCSGGQLEKRYAAWYQQKPDQAPKLVIYKDSERPSGIPDRFSGSNSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V560 iglv ABVD02360397.1 16760 SVASFELTQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRLSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V578 iglv ABVD02000558.1 872 SWAQSGLTQEASVSGSLGQTVTITCKGSSSDLGAYGAGWYQQLPGGTPKTVMLGTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V579 iglv ABVD02000622.1 1687 SVASFELTQPHSVSVALGQTTRLTCSGGQLEKKYAYWYQQKTDQSPKLVIYEDSKPPSGISDRFSGSTSGNMATLIINGVQNEDEAEYYCLSSDSDSNA
Choloepus hoffmanni V597 iglv ABVD02026842.1 4306 SLSQPVLTQPPSLSASLGSSVRLPCTLSSDVNVGTYRIYWYQQKPGSPPWYLLNYYSDSNKHQGSGVPSRFSGSKDTSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V599 iglv ABVD02028157.1 1109 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNYVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLTISGLKPKDEAGYYCMSVSSIYP
Choloepus hoffmanni V602 iglv ABVD02032213.1 880 SLSQPVVTQPPSLSASLGSSVRLPCTLSSGINVGGYHIHWYQQKPGNPPRYLLYYYSDSNKHQGSGVPSRFSGSKDSSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V604 trgv ABVD02037921.1 380 SHSAPNLEWRKRSVTGKTGATVEITCDIVVQTSTYLHWYRHLEGKAPQRLLYYNTHSSKFWVDSGINEVKYDGYTGRDRSYKLKLRNLEESDSGVYYCAVWD
Choloepus hoffmanni V616 iglv ABVD02078779.1 703 SVASYEVTQPRSVSVALGQTARLTCGGNNIGRKSVQWYQQTPGQAPVLLIYSDDSRASGIPDRFSGSNSGNTATLTISKVEAGDEADYYCQVWDSDSSA
Choloepus hoffmanni V624 iglv ABVD02094251.1 4315 SVASFELTQPRSVSVALGQTASLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRLSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V626 iglv ABVD02097416.1 3833 SWAQSGLTQEASVSGSVGQTVTLTCKGSSSYLGTYGVGWYQQLPGGVPKTVMLGTSRPSGIPDRFSGSMASGTASLTIAGLQPEDEAVYYCSAADTSRNE
Choloepus hoffmanni V627 igkv ABVD02097910.1 31717 ANGDIMMTQSPDSVAGSPGETITLSCKSSQGISSYLAWYQQKPGQAPKLLIYGASSRASGIPDQFSGSGSGTDYTLTISRFQPDDVAYYYCQQYSSSP
Choloepus hoffmanni V634 iglv ABVD02124161.1 4472 SVASFELTQPHSVSVALGQTTRITCSGGQLEKKYAYWYQQKTDQSPKLVIYEDSKPPSGISDRFSGSTSGNMATLIINGVQNEDEAEYYCLSSDSDSNA
Choloepus hoffmanni V636 iglv ABVD02138152.1 3008 SLSQPVLTQPPSLSASLGTTARLSCTMSSGANVGGFYIHWYQQKPGSAPRYFLYYYSNSDKQLGPGVPSRVSGSKDTSSNAAYLHISGLQPGDEADYYCPI
Choloepus hoffmanni V637 iglv ABVD02139602.1 322 SVASYEVTQPRSVSVALGQTARLTCGGDNIGNKAVHWYQQMPGQAPVLLIYSDDSRPSGIPDRFSGSNSGNTATLTISGVQTEDEADYYCFAAGSGA
Choloepus hoffmanni V638 iglv ABVD02140631.1 3009 SLSQPVLTQPPSLSASLGTTARLSCTMSSGANVGGFYIHWYQQKPGSAPRYFLYYYSNSDKQLGPGVPSRVSGSKDTSSNAAYLHISGLQPGDEADYYCPI
Choloepus hoffmanni V639 iglv ABVD02151722.1 427 SVASYEVTQPCSVSVALGQTARLTCGGDNIGNKAVHWYQQMPGQAPVLLIYSDDSRPSGIPDRFSGSNSGNTATLTISGVQTEDEADYYCFAAGSGA
Choloepus hoffmanni V654 trav ABVD02220317.1 41008 VSQGENVKQQPFVLSVQEGSSSTINCTYSDSGSEYFPWYKQEHGKGPQFIVDIRSNVEVKKGPRLTVRLNKKDRHFSLEIAATLPGDSATYFCAAS
Choloepus hoffmanni V655 trav ABVD02220317.1 32454 SSIAQNVTQTQPAMLAKEKETVTLNCTYDTRESSYGLFWYKQPSSGEMIFLILQESYNQQNATEGRFSVNFQKAIRSINLVISASQLGDSAVYFCALKE
Choloepus hoffmanni V656 trav ABVD02220317.1 25892 GTSGDLVTQMEGQVALSEGALLTVNCTYTAAGYPFLFWYVQRPGEGPQLLLKAMKANEKGRNKGFEATYNKESTSFHLEKPSVQVSDSAVYYCALS
Choloepus hoffmanni V657 trav ABVD02220317.1 4915 VKGQVEQNPHAMNTQEGENVTLNCHYKTSIYNIQWYRQDSGRGLSLLILILSNEREKHGGRLRATLDTSTQRSSLIITASQTADTGAYFCAV
Choloepus hoffmanni V665 iglv ABVD02244354.1 935 SWAQSGLTQEASVSGSLGQTVTITCKGSSSDLGAYGAGWYQQLPGGTPKTVMLGTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V668 igkv ABVD02255582.1 13131 ATGDIVMTQSPASLAVSPGETTTINCKSSQSVFHNTDKKTYFYWFQKKPGQPPKLLIYYASTRASGVPDRFTGSGSGTDFTLTISRFQPEDVADYYCMQATSYP
Choloepus hoffmanni V672 iglv ABVD02256142.1 23051 SLSQPVVTQSPSLSASLGSSVRLPCTLSSGFSVGRYTIYWYQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDTSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V686 iglv ABVD02262535.1 999 SVASFELTQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQTPKLVIYEDSKRPSGIPDRLSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V687 iglv ABVD02262905.1 3175 SWAQSGLTQEASVSGSLGQTVTLTCKGGSSYLGSYGAGWYQQLPGGTPKTVMLRTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V691 iglv ABVD02263516.1 10894 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNRVSWYQQHPGTAPKLLIYEVSKRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYFCA
Choloepus hoffmanni V694 iglv ABVD02264398.1 4861 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVNWYQQLPGTAPKLLIYGNSNRPSGVLDRFSGSKSGNSGSLSITGLQPEDEADYYCSSWDSSISG
Choloepus hoffmanni V695 iglv ABVD02264423.1 2340 SLSQPVLTQPPSASASLGASVKFTCTLSSEHSSYWIEWFQQGPGKGPQYVMQVKSDGSQSKGDGIPDRFLGSSSGADRYLTISSLQLEDEADYFCSAGDSSGY
Choloepus hoffmanni V697 iglv ABVD02264754.1 18214 SWAQAVLTQPPSVSGALGQKVTISCSGSSTNIGGGYAVKWYQQLPGTAPKLLIYDNSKRPSGVSDRFSGSKSGNSGSLSITGLLRGGGADYYCQSMPMSWC
Choloepus hoffmanni V700 iglv ABVD02268500.1 5884 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNYVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V701 iglv ABVD02268501.1 5195 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNYVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V705 iglv ABVD02272841.1 11317 SVASYEVTQPRSVSVALGQTARLTCGGNNIGNKAVHWYQQMPGQTPVLLIYADSQRPSGIPDRFSGSNSGNTATLTISGVQAGDEADYYCQAADSGA
Choloepus hoffmanni V706 iglv ABVD02272946.1 8793 SWAQSALTQPPSVSGSLGQTVSISCAGSSNDIGYYDYVSWYQQHLGAAPKLLIYEVNKRASGIPDRFSGSKSGNTASLTISGLQPEDEADYFCA
Choloepus hoffmanni V717 trav ABVD02276373.1 49501 GQQVKQSPPSLRVQEGGISILNCDYSNALFDYFLWYRKYPAKSPEFLTSVHSGVDSNEDGRFTVFLNKSAQHLSLNITAAHPEDSALYFCAAS
Choloepus hoffmanni V718 trav ABVD02276373.1 35978 VRSQEPEQSPQPLIIQEGEDVTINCNSSKTLYSLQWYRQKHGEGPIFLMLLLKGGEEKNLDNILAKFNENKQQSTLTMTASQPSHSGTYFCGVE
Choloepus hoffmanni V719 trdv ABVD02276373.1 14368 FSMAQNVTQARITVTMQEGEAATLDCMYETKSSVYSLYWYKQPPSGGMVYLIHQDSSKPNAKQDRYSVNLQKARKSISLTISSLQLSDSAKYFCALWD
Choloepus hoffmanni V720 trav ABVD02276375.1 4662 IRVHLEVKQSPQVLIFQEGRNSSLMCNSSIAITSVQWFKQNPGGHLITLFYIASGMQQNGRLKVTVNTKGSYSHLYIRDSRPGDSATYICAME
Choloepus hoffmanni V721 trav ABVD02276376.1 257674 VSRGEKVEQQPSILSIQEGSSSIINCTYSDSGSEYFPWYKQERGRGPHLIIYIRSNVNIKQDQRLTVRRNKKDRHFSLEIADTLPGDSATYFCATS
Choloepus hoffmanni V722 trav ABVD02276376.1 235766 KTLTQMEGQVTLSKWDLLTVNCTYTTTSYPTLFWYVRYPGDSPQLLLKATKAKEKGSNKGFEATYNEETTSFHLEKPSIQESDSAMYFCALS
Choloepus hoffmanni V723 trav ABVD02276376.1 220183 VNSQVEQNPQAMNIQEGENATMNCNYKTSIDNLQWYRQDSGRGLSRLILIRSNEKEKHSGRLRATLDTSTQRSSLIITTSQTADTAAYFCAV
Choloepus hoffmanni V724 trav ABVD02276376.1 200829 DARAQTVSQPQVHISISEEASLELKCNYSYSGFPSLFWYIQYPSQGLQLLLKYVSGDNKVKGIKGFEAEFQKSQSSFNLRKHLVHWSDSAVYFCALG
Choloepus hoffmanni V725 trav ABVD02276376.1 174612 VSRGEKVEQQPSVLSVREGSSSIINCAYSDSGSDYFPWYKQEHGKCPHLIVDILSNVNIKQGPRLTVRLNKTDRHFSLEIADTLPGDSATYFCAAS
Choloepus hoffmanni V726 trdv ABVD02276376.1 157994 SSVAQKVTQTQPAMLVQEKKTVTLNCTYDTRDSTYSLFWYKQPSSGEMIFLIRQDSYNQQNATEGRYSVNFQKASKSINLVISASQLGDSAVYFCALRE
Choloepus hoffmanni V727 trav ABVD02276376.1 147474 GTNGDSVTQMEGEVTLSVGDLLTVNCTYTAAGYPTLFWYVQHPGEGPQLLLKATKASEKGRNKGFEATYDKETTSFHLEKASVQESDSAVYFCALS
Choloepus hoffmanni V728 trav ABVD02276376.1 134846 VRGKNQVEQSPQSLIILEGENCTLQCKYTVSPFNNLRWYKQDTGSSPVSLTIMNSAISEKSIGRYTVTLDENAKHSSLHITDSQLSDSASYICAVS
Choloepus hoffmanni V729 trav ABVD02276376.1 121217 VRSQQKAVKQTAASRSILEGTIASFNCTYEDRASQYFTWYRQDSGKGPVLLMFIYSNGDKTEGRFTVQLNKARQFVSLLITDTQPSDSATYLCAV
Choloepus hoffmanni V730 trav ABVD02276376.1 115034 GMLAQTVTQPEDLISVFEGDPVQLRCNYSYSGSPVLSWYVQYPRQSLQLLLRHISGERIRGFMADLDKGKASFHLKKPAAHEEDSAMYYCALS
Choloepus hoffmanni V731 trav ABVD02276376.1 101007 VNGQVEQNPQAMDIQEGENATINCNYKSAINSLQWYRQDSSKGLSLLILIRSNEKKKHSGRLRATLDTSTKLGSLIITASQTADTATYFCSE
Choloepus hoffmanni V732 trav ABVD02276376.1 95272 RTKGESVTQAKGLITLLEEAPLTLNCTYQSRYSTVLFWYVQHQNKAPQLLLKSSSENQEVDSRGFQATHVKSDSSFHLQKPSVQTSDSAVYYCVLS
Choloepus hoffmanni V733 trav ABVD02276376.1 72067 LSGEDQVEQHPQTLRVQEGDSSSLKCSYSVSNFRGLQWYRQDPGKSPELLFILYSVGDAKQKDGIKAALSKKESSLHISDSKTEDSASYLCAVE
Choloepus hoffmanni V734 trav ABVD02276376.1 55873 VSSKEEVKQSPLALNVQEGETLVLDCNYTDSAIYFLQWYWQDPGKGLTSLLIFQSSQREQKSGRLKALPDKSSRQGALYLMASQPGDSATYFCAV
Choloepus hoffmanni V735 trav ABVD02276376.1 41413 GTGAQTVTQPDALIAVAEGDPLELRCNYSSSVPPYLFWYVQSPNQGLQLLLKYTSGNSLISGIKGFESEFKKSENSFPLRKASAQWSDSAVYFCALS
Choloepus hoffmanni V736 trav ABVD02276376.1 36728 VRSLQVEQSPPALSLQEGASCMLRCRFSASVNSVQWFRQKPGRHLINLFYNPSGTQQRGRLSSTTVTRERYTTLNISSSQTTDSAIYFCAAEAQCSP
Choloepus hoffmanni V737 trdv ABVD02276376.1 16286 ASMAQKATQVQSVISMQEGAAVTVDCRYETSWSDYAILWYKQRSSTELVFLILQRSIDHNANNGRYSINFQKQDKSISLTISPLELKDSAMYFCALR
Choloepus hoffmanni V738 trav ABVD02276376.1 3512 VSTQQLEQSPRFLRIQEGEDFAVCCNSSSNFPSFQWYRQVPEEGPVLLMTLVKGGDMKKQKRLMAQFGESRKDSSLHIKATQPGDAGIYLCAGQRCCQ
Choloepus hoffmanni V739 trav ABVD02276378.1 10007 DARAQSVSQPQGHISVSEGASLELRCNYSYGATAYLFWYIQYPSRGLQLLLKYVSGDNLVKGIKDFEAEFQKSKSSFNLKKHSVQWSDSAVYFCALN
Choloepus hoffmanni V749 iglv ABVD02277745.1 8893 SVASFELTQPHSVSVALGQTARLTCSGGKFENIYVHWYQQKPDQAPKLVIYEDSKRPSGIPERFSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V761 trbv ABVD02278612.1 1016 LVDSGVTQTPRHLIKTRGQKVILRCSPISGHVSVFWYQQALSKTPQFLFQFYENLQRAKGDVPDRFSAEQFRDYSSELNVSSLQLEDSALYLCASSL
Choloepus hoffmanni V762 trbv ABVD02278613.1 41705 HVDSGVIQTPRHLIKAKGQRVTLKCSPMSGHDNLFWYQQALGQGPRFLGRYYNGEESERGNFSDRFSAQQFSNHSSELNVSSLQLEDSALYLCASSL
Choloepus hoffmanni V763 trbv ABVD02278613.1 38392 PADSGVIQTPRHLIKAKGQQVTLKCSPMSGHDNVFWYQQALGQGLQFLIQHYREEESERGKFPDRFSAKQFSDYRSELNMSSLQLEDSALYLCASRF
Choloepus hoffmanni V764 trbv ABVD02278613.1 12074 PVDAGITQTRKYHVMQTGQSMTLTCTRNMNHDSMFWYQQDPGLRLRLIHYSVGVDVTDKGEVPDKYNVSRTNKEHFPLLLESATPSQTSVYFCASSD
Choloepus hoffmanni V765 trbv ABVD02278613.1 4091 HTGAAGVSQSPRHRVTGSGQTVELRCDPVSGHATLFWYRQTLGQGLEFLTYFQNSEELDKSGMPNDRFSALRTEGSNSTLKIQPAKQEDSAVYLCASSK
Choloepus hoffmanni V766 trbv ABVD02278613.1 885 PVDAGITQTPRYHIIQTGKKTVLQCFQDMDHLAMYWYLQNPGQGLWLIHYSGGTDSTDNGDVPDGYSVSRKKKDRFPLTLESASTNQTSFYLCASSL
Choloepus hoffmanni V767 trbv ABVD02278614.1 18063 CMDTGITQTPKFLIIGMRNKTLKCEQHLGHNAMYWYKQNSKKPPELMFVYNYEKLVQNESVPSRFSLECPDSSKLYLHVDGLEPDDSATYFCASSK
Choloepus hoffmanni V769 trbv ABVD02278614.1 4388 PIDTGITQEPKYLVIGMGNKTLKCEQHLGHNAMYWYKQNSKKPPEFMFAYNLKELVQNETVPIRFSLKCPDSSKLYLHVDGLEPDDPATYLCASSK
Choloepus hoffmanni V770 trbv ABVD02278614.1 1857 YMETGVNQTPSHSITQRGQRVALRCNPVSGHLYLYWYRHTPEKGLEFLTSFYNKVPSEKADFFKGRLSAEMPDGSLSILNIQLAELGDSAMYLCASS
Choloepus hoffmanni V776 iglv ABVD02279556.1 4875 SWAQSGLTQEASVSGSPGQTVTITCKGSSVYLEAIGAGWYQQLPGGTLKTVMLGTSRPSGIPDRFSGSKGSGSASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V778 trbv ABVD02280429.1 191056 VRAQTIHQWPATKVQLVGSPVSLECTVKGTSAPTLYWYRQDTGKALQLLFHSISTEQIDPEGSQYVSASRPQDGQFSLSFKKLLLSDTGFYLCAWR
Choloepus hoffmanni V806 trgv ABVD02285963.1 12405 SQSAPNLEWRRRSVTGQTGATVEITCDIVVQTSTYLHWYRHLEGKAPQRLLYYNTHSSKFWVDSGINEVKYDGYTGRDKSYKLKLRNLEESDSGVYYCAVWD
Choloepus hoffmanni V810 iglv ABVD02286768.1 20234 SVASFELPQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRFSGSSSGNTATLTISGVQTEDEADYYCLSSESESSA
Choloepus hoffmanni V811 iglv ABVD02286768.1 10456 SVASYEVTQLRSVSVALGQTARLTCGGNNIGNKDVHWYQQMPGQAPVLLIYGDSKQHSGIPDRFSGSNSGNTATLTISGVQAGDETDYYCQAEDGSA
Choloepus hoffmanni V815 iglv ABVD02287358.1 2440 CGDSAAPPPRIPGTSVRLPCTLSSGFSVGDFWIHWFQQKPGSSPRYLLRFKSDSDKQQGSRVPSCFSGAKDALTNSGVLHISGLQPEDEADYYCCAGHEGSKT
Choloepus hoffmanni V832 igkv ABVD02290755.1 15111 ASGDIVMTQSPASLAVSPGETITINCKSSQSIFYSSNQNFLAWYQKKTGQAPKLLISWGSTRASGVPNRFTGSGSGTDFTLTISKFQPEDVADYYCQQHYSSP
Choloepus hoffmanni V839 iglv ABVD02291609.1 9643 AMSQAVVTQETSLSTSPGWKVTLTCSSSAGAVTTSNYVSWVQQKPYQVPWGLIGYTTHQVPGVPARFSGSLLGDKATLTIMGAQPEDVAMYYCALLYGNH
Choloepus hoffmanni V857 igkv ABVD02294879.1 29139 ASGDIVITQSPASLAVSPGETATINCKSSQSIFHSSDKKTYLNWIQKKPGQPPKRLIYYASTRASGVPDRFTGSGSGTDFTLTISRFQPEDVADYYCMQGYSYP
Choloepus hoffmanni V874 iglv ABVD02297956.1 5712 YLSQSVLTQPPSASASLGTSVKFTCTLSSEHSSYWIEWFQQGPGKGPQYVMQVKSDGSQSKGDGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGADYSSWY
Choloepus hoffmanni V896 iglv ABVD02304376.1 4363 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGYYDYVSWYQQHPGAAPKLLIYEVNKRASGIPDRFSGSKSGNTASLTISGLLSEDEADYHCASYTSS
Choloepus hoffmanni V903 ighv ABVD02306398.1 29674 VLSQVQLKESGPVLVKPSQTLSLTCSASGFSLSSNAMGWIRQAPGKGLEWVGAINSGGSTYYNPTLKSRVTITKDNSKNEVYLKLSSLSPEDTAVYYCAR
Choloepus hoffmanni V904 ighv ABVD02306400.1 7152 VFSQVTLTEPGSGLVKPAQTLTLTCTISGFPISTSGIGVSWIHQPPRKAMEWLAIIYWDDDKSYEASLKSWLTISKDNDRNQVFLAMTNMNPVDTAMYYCARR
Choloepus hoffmanni V929 ighv ABVD02312783.1 9796 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYGMSWIRQAPGKELEWVAEITGGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAA
Choloepus hoffmanni V930 ighv ABVD02312792.1 22802 VLSQVQLKESGPGLVKPSQTLSLICSVSGFSLTSYEVHWFRQAPGNGLEWVGRITIGGSTNCNPTLKSRLSITRDTSKNEVYSKLSSVTPEDTATYYCAK
Choloepus hoffmanni V939 ighv ABVD02315050.1 90500 VLSQVQLKESGPGLVKPSQTLSLTCSISGFSLTSYGVNWIRQVPGKGLEWVGLIRYDGNTYFNPTLQSRLSITRDTTKNVVYLQLSSLRTEDAAMYYCAK
Choloepus hoffmanni V940 ighv ABVD02315051.1 24082 VLSQVQLQESGPGLVQPSQTLSLMCSVSGFSITTGDYGQEWICQTPGKELQRVGEIWNDQGRNYSPSLKSHSSITRDTPKNQFSLQLSSMTPEVMATYYCA
Choloepus hoffmanni V947 ighv ABVD02316280.1 3120 VLSQVQLKESGSGLVKPSQTLSLTCSVSGFSITTSYYCWAWIRQSPGKGLQWIGCIYYNGNTYYSSSLKSRSSITRDTSKNQFSLQLSSVTAEDTATYYCAR
Choloepus hoffmanni V948 ighv ABVD02316287.1 31959 VLSQVQLKESGSGLVKPSQTLSLTCSVSGFSITTNYCWAWIRQSPGKGLQWIGYICYNGNTYYSSSLKSRSSITRDTSKNQFSLQLSSVTAEDTATYYCAR
Choloepus hoffmanni V949 ighv ABVD02316287.1 21862 VLTQVQLKESGPGLVKPSQTLSLTCSVSGFSLTDNAVNWIRQAPGKGLEWVGLINYAGSTSYKPTLQSRLTITRDTSKNEVYLKLSSLRTEDTATYYCAR
Choloepus hoffmanni V950 ighv ABVD02316288.1 85663 VLSELTLRESGQGLVKPSQTLSLTCTATGGSVTSSNIWHWIRQRPGKGLEWMGYWSGSTYYNPAFQGRITINADTSKNQFSLQLNSMSVEDTATYYCAK
Choloepus hoffmanni V951 ighv ABVD02316288.1 70972 VLSELTLKESGQGLVKPSQTLSLTCTATGGSVTSSYYWHWIRQRPGKGLEWMGYWSGSTSYNPAFQGRITINADTSKNQFSLKLNSMTVEDTATYYCAK
Choloepus hoffmanni V952 ighv ABVD02316288.1 28638 VLSQVQLKESGPGLVKPSETLSLTCSVSGFSLTDYAVSWVRQAPGKGLEWVSGIAYDGSTYFQPTLQSRLTITRDTSKNEVYLKLKSVRTEDTATYYCAR
Choloepus hoffmanni V955 ighv ABVD02316290.1 9993 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTDYAVSWVRQAPGKGLEWVSSIAYDGSTYFQPTLQSRLTITRDTSKNEVYLKLKSVRTEDTATYYCAE
Choloepus hoffmanni V956 ighv ABVD02316301.1 12946 VLSQVQVKESGPSQVEASQTLSLTCSVSDIYSTTYDVKWKRQSPGKGQEEVGTIWSDGSTYYNPALQSRVTITRDNSKNEVYLKLSSVTPEDTATYYCGI
Choloepus hoffmanni V957 ighv ABVD02316302.1 13058 VLSQVQLKESGPGLVKPSQTLSLTCSVSGGSLSSYYMSWIRQAPGKGLEWVGWISSSGSTTYNSTLKSRVTITKDNSKNEVYLKLSSLSPEDTAVYYCAR
Choloepus hoffmanni V958 ighv ABVD02316303.1 100159 VRSQVLMKESGPALVKPSQSLCITCSLSGFSLTNNSVQWNNKSPGKGLEWVGVISRGGRTYYNPSPWAQLDITRDNSNDEIYVKMSSLRAKDMATYYCPR
Choloepus hoffmanni V959 ighv ABVD02316303.1 61332 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLTSYHVDWIRQAPGKGLEWVGRITSGGSTYYNPSLQSRLSITKDTSKNEVYSNLSSVTTEDMATYYCAR
Choloepus hoffmanni V960 ighv ABVD02316303.1 7813 VLSQVQLMELGPGLVKLLQNLYLTCSVSRSTLTSIYMHWIHQALGKGLEWVVRITSGGSTYYKPNLQSQLSITRDTSKNEVYLKLSSVTPEDTATYYCER
Choloepus hoffmanni V961 ighv ABVD02316304.1 15695 VLSQVQVKESGPGLVKASQTLSLTCSVSESSYTIVNMKWKRQAPGKAQEHIEVISSYGSTNYNPAFQSRATITRDTSKKEFYLKLSSVTPEDTATYYCGI
Choloepus hoffmanni V967 iglv ABVD02317634.1 4254 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGDDVMGDYVSWYQQNPGKAPKTIIYEVNKRASGIPDRFSVSKSGNTASLRISGLQPEDEADYHCM
Choloepus hoffmanni V979 iglv ABVD02324101.1 20128 SVASFELTQPRSVSVAVGQTARLTCSGGKLENNYAHWYQQKPDQAPKLVIYKDSEWPSGIPDQFSGSSSGNTATLTISGAQNEDEADYYCQSWDSDSDV
Choloepus hoffmanni V995 iglv ABVD02328596.1 12873 SWAQAVLTQPPSVSGALGQRVTISCSESSTSIGDGYSVHWCEHLPRTAPKLLNFGNSNGLSGVSDHFSISKPGMSGSLSITGLQPEDEADYYCSSWDKSISG
Choloepus hoffmanni V1023 iglv ABVD02337899.1 2626 SLSQPVLTQPPSASASLGASAKFTCTLSSEHSSYWIEWFQQRPGKGPQYVMQVKSDGSQSKGSGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGVGDSSGY
Choloepus hoffmanni V1033 trav ABVD02339519.1 194285 LSGEVKVEQRPLSLSTREGEDCVIYCRYSGTTSARLYWYRQAHGKSLESLFSLVSNGAVKQEGQLTALLDTKASLSTLNMTASQLGLEATYFCAVE
Choloepus hoffmanni V1034 trav ABVD02339519.1 156655 ARDKNEAQQSPPFLHAQEGELLAINCSYSTGMTTLQWLQQNPGGGFVSLFILSLEMKKKGRLRATINTKDSRSTLHITAAQPGDSATYLCAVE
Choloepus hoffmanni V1035 trdv ABVD02339519.1 134671 SSNAQVSQQIAVMTKKVGESVTLDCQITVSFSNYYMYWYQQTSTGKMTSLISLYSTNERSSNGRYSVVFQKASKTLKLTISSLVPGDSAVYFCAVAE
Choloepus hoffmanni V1036 trdv ABVD02339519.1 86557 ISLDIILELEVKTLTVLAGEPAAFRCSITGGDLKNCRMSWYKKNEDNFLILIYTPSNNYNDIRNNFKGEVDVLKSQFTLEIPKATTKDVGTYYCGSD
Choloepus hoffmanni V1037 trdv ABVD02339519.1 70307 VMSAVVLVPQKQVVTVSVGESVTLKCSMEGDTISKYYMYWYRKTQDNLLTFIYREGNHYGPGFQNRFHGNNDASGNQAVLEIHEASLRDEGSYYCGYN
Choloepus hoffmanni V1038 trav ABVD02339520.1 90755 IMGDAQTTQPDSMASTEGETVNLPCNHPTISGINYIYWYRQILHQGPEYVIHGFKTNVTNEMASLTIPADRKSSTLVLPRVTLRSTAVYYCILI
Choloepus hoffmanni V1039 trdv ABVD02339520.1 73338 FSMAENVTQARITVMMQEGEAVTLDCVYETTWSVYSLYWYKQPPSGGMVYLIHQDSSKPNAKQDRYSVNLQKASKSISFTISSLQLSDSAKYFCAFWD
Choloepus hoffmanni V1040 trav ABVD02339520.1 65071 IMGDAKTTQPDSMASTEGEAVNLPCNHPTISGRDYIYWYRQILYQGPEYVIHGIKTNVTNEMASLTIPADRKSSTLVLPRVTLRSTAVYYCILR
Choloepus hoffmanni V1041 trav ABVD02339520.1 52542 VNGQELNQSPKSVSIQEGEDFTMNCNSSSTFNIFLWYKQDPGEAPALLITLYKAAESTRIGKMTAQFGATRKESFLNISASEPDDAGTYFCAG
Choloepus hoffmanni V1042 trav ABVD02339520.1 37045 VNCGDKVTQSPPTLAVHEGDSATLNCSYEVTSFQSLYWYKQEEKAPTFLFTLISEGAGKKAGRLSGTLDRKKFLSTLHITDSQPGDSATYLCAVE
Choloepus hoffmanni V1043 trav ABVD02339520.1 8861 PSLAQTVTQSQPEMSVQEAETVTLKCTYDTSENQYYLFWYKQLPSGRMIFIILQDAYKQQNATENRFSVNFQKAAKSFSLKISDSQLEDAAVYFCAFRG
Choloepus hoffmanni V1044 trav ABVD02339520.1 433 PSLAQTVTQSQPEMAVQEAETVTLKCTYDTSDTNYYLFWYKQLPSRRMIFIILQDAYKQQNATENRFSVNFQKAAKSFSLKISDSQLEDAAVYFCAFRG
Choloepus hoffmanni V1080 iglv ABVD02350476.1 5221 SLSQPVLTQPPSASASLGASVKFTCTLSSEHSSYRIEWFQQRPGKGPQYVMQVKSDGSQSKGDGIPDRFLGSSSGADRYLTISSLQAEDEADYFCGVSYNSGY
Choloepus hoffmanni V1099 igkv ABVD02355030.1 76916 ASGDITLTQSPDSVAGSQGETVTISCKSSQSVSNYLHWYQQKPGQAPKLLIYYASTRASGVPDRFTGSGSGTDYTLTISRFQPEDVADYYCQHGYSSP
Choloepus hoffmanni V1100 igkv ABVD02355030.1 16527 ASGDIVLTQSPDSVAESPGETITMNCKSSQSVSSSNLHWYQQKPGQPPKLLICDASTWASGVPDRFSGSGSGTDFTLTIGRFQPEDVASYYCQYD
Choloepus hoffmanni V1110 ighv ABVD02357391.1 56539 VFSQVTLKETGAGLVKPAQTLTLTCTFSGFSISTSGIGVAWIRQPPGKALEWLATIYWDDDKYYAASLKSRLTISKDNARSQVSLAMTNMNPVDTAMYYCARR
Choloepus hoffmanni V1111 ighv ABVD02357391.1 38235 VLTQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSNDMSWIRQAPGKGLEWVAVIYGGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAR
Choloepus hoffmanni V1112 ighv ABVD02357391.1 3778 VLSQLQLKESGPSQVKASQTLSLTCSVSGFSLTYYAVGWKRQAPGKGQEEVGTIWSSGSTNYNPALQSRVTITRDNSKNEFYLKLNSVTPEDTATYYCGT
Choloepus hoffmanni V1113 ighv ABVD02357395.1 125593 VFSQVTLKETGPGLVKPAQTLTLTCTFSGFSISTSGIGVAWIRQPPGKALELLATIYWDDDKRYAASLKSRLTISKDNARSQVSLAMTNMNPVDTAMYYCARR
Choloepus hoffmanni V1114 ighv ABVD02357395.1 65124 VLSQVQVKESGPGLVKPSQTLSLTCSVSGFSLTSYAVHWIRQAPGKGLEWVGAIWSDGSTNYNPSLKSRLTITRDTSKKEVYSKLNSMTPEDTATYYCA
Choloepus hoffmanni V1116 ighv ABVD02357402.1 40987 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYAMDWIRQAPGKGLEWVAEITSGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAR
Choloepus hoffmanni V1117 ighv ABVD02357407.1 20778 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYDMGWIRQAPGKGLEWVGAISSGGSTYYNPTLKSRVTITKDNSKNEVYLKLSSLNPEDTAVYYCAK
Choloepus hoffmanni V1118 ighv ABVD02357409.1 41998 VLSQVQVKESGPGLVKASQTLSLTCSVSGSSFTISNMKWKRQAPGKGQEDVGAIWSDGSTNYNPAFQSRVTITRDTSKNEFYLKLSSVTPEDSATYYCGI
Choloepus hoffmanni V1124 iglv ABVD02359849.1 9718 SLSQPVVTQPPSLSASLGSSVRLPCTLSSDVNVGTYRIYWYQQKPGSPPRYLLNYYSDSNKHQGSGVPSRFSGSKDTSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V1125 iglv ABVD02360061.1 25420 SWAQSALTQPPSVSGSLGQTVSISCAGSSSDIGGYNGVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLTISGLLSEDEADYHCASYTSS
Choloepus hoffmanni V1129 iglv ABVD02360378.1 19684 SWAQSGLTQEASVSGSPGQTVTLTCKGSSSYLGAYGAGWYQQFPGGTPKTVMLGTSRPSGIPARFSGSKASGTASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V1130 igkv ABVD02360570.1 116503 ASGNVMLTQSPDSVAMSPGESVTISCKSSESVSSYLNWYQQKPGQVPKVLIYYASTRAPGVPDRFTGSGSGTDFTLTISRFQPEDVASYYCQQYKSYL
Choloepus hoffmanni V1134 iglv ABVD02362172.1 1003 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIRDDVMGDYVSWYQQHPGTAPKTIIYEVRKQPSGIPDHFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V1139 ighv ABVD02362552.1 54065 VLSQVQLKESGPGLVKPSQTLSLICSVSGLSLSSYSMSWIRQAPGKGLEYIGWITSGGSTYYNPSLKSRVTITKDNSKNEVYLKLSSLSPEDTAVYYCAI
Choloepus hoffmanni V1140 ighv ABVD02362552.1 30511 VLSQVQLKESGPGLVKPSQTLSLTCTVSGFSLSSNAMHWIRQAPGKGLEWVGAIGSSGSTYYNPTLKSRVTITKDNSKNEIYLKLSSLSPEDTAVYYCAR
Choloepus hoffmanni V1141 ighv ABVD02362555.1 8040 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYGMSWIRQAPGKGLEWVAVIYGGGSTYYNPTLKSRVTITKDNSKSEVYLKLSGLKSEDTATYYCAK
Choloepus hoffmanni V1142 ighv ABVD02362561.1 31269 VLSQVQLKESGPGLVKPSQTLSLTCSASGLSLSSHYMTWIRQAPGKGLEWVGRITSSGSTNYNPNLKSRVTINKDNSKNEVYLKLSSLIPEDTAVYYCAT
Choloepus hoffmanni V1143 ighv ABVD02362564.1 1291 VLTEVQLVQSGAEVKRPGEPLTISCKASEYSFTSYWIGWVRQQPGKGLEWVGSIYPGDSDTRYSPSFKGQVTISTENSASTAYLKWTSLKDSDTVVYYCAR
Choloepus hoffmanni V5 trav ABVD01009840.1 8030 VNGQVEQNPHAMDIQEGENATINCNYKSAINSLQWYRQDSSKGLSLLILIRSNEKKKHSGRLRATLDTSTKLGSLIITASQTADTATYFCSE
Choloepus hoffmanni V6 trav ABVD01009840.1 13770 RTKGESVTQAKGLITLLEEAPLTLNCTYQSRYSTVLFWYVQHQNKAPQLLLKSSSENQEVDSRGFQATHVKSDSSFHLQKPSVQTSDSAVYYCVLS
Choloepus hoffmanni V7 trav ABVD01009847.1 4414 LSGEDQVEQHPQTLRVQEGDSSSLKCSYSVSNFRGLQWYRQDPGKSPELLFILYSVGDAKQKDGIKAALSKKESSLHISDSKTEDSASYLCAVE
Choloepus hoffmanni V8 trav ABVD01009851.1 1346 VSSKEEVKQSPLALNVQEGETLVLDCNYTDSAIYFLQWYWQDPGKGLTSLLIFQSSQREQKSGRLKALPDKSSRQGALYLMASQPGDSATYFCAV
Choloepus hoffmanni V10 trav ABVD01013827.1 6850 PSLAQTVTQSQPEMSVQEAETVTLKCTYDTSENQYYLFWYKQLPSGRMIFIILQDAYKQQNATENRFSVNFQKAAKSFSLKISDSQLEDAAVYFCAFRG
Choloepus hoffmanni V11 trav ABVD01013833.1 2396 LSGEVKVEQRPLSLSTREGEDCVIYCRYSGTTSARLYWYRQAHGKSLESLFSLVSNGAVKQEGQLTALLDTKASLSTLNMTASQLGLEATYFCAVE
Choloepus hoffmanni V18 trdv ABVD01034503.1 2477 ISLDIILELEVKTLTVLAGEPAAFRCSITGGDLKNCRMSWYKKNEDNFLILIYTPSNNYNDIRNNFKGEVDVLKSQFTLEIPKATTKDVGTYYCGSD
Choloepus hoffmanni V23 iglv ABVD01051296.1 7344 SWAQSGLTQEASVSGSLGQTVTITCKGSSPFLSALGAGWYQQIPGDTLKTVMLGTSRPSGIPDRFSGSKASGTASLTISGIQPEDEAVYYCSTFDP
Choloepus hoffmanni V29 trav ABVD01066796.1 1304 IMGDAQTTQPDSMASTEGEAVNLPCNHPTISGRDYIYWYRQILYQGPEYVIHGIKTNVTNEMASLTIPADRKSSTLVLPRVTLRSTAVYYCILR
Choloepus hoffmanni V30 trav ABVD01066798.1 2245 VNGQELNQSPKSVSIQEGEDFTMNCNSSSTFNIFLWYKQDPGEAPALLITLYKAAESTRIGKMTAQFGATRKESFLNISASEPDDAGTYFCAG
Choloepus hoffmanni V36 iglv ABVD01088682.1 304 SWAQAVLTQPPSVSGALGQKVTISCSGSSTNIGGGYAVKWYQQLPGTAPKLLIYDNSKRPSGVSDRFSGSKSGNSGSLSITGLLPEDEADYYCQSYDKSLGA
Choloepus hoffmanni V40 trdv ABVD01106723.1 309 VMSAVVLVPQKQVVTVSVGESVTLKCSMEGDTISKYYMYWYRKTQDNLLTFIYREGNHYGPGFQNRFHGNNDASGNQAVLEIHEASLRDEGSYYCGYN
Choloepus hoffmanni V43 iglv ABVD01111954.1 9091 SWAQSGLTQEASVSGSLGQTVTITCKGSSSDLGAYGAGWYQQLPGGTPKTVMLGTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V52 iglv ABVD01136339.1 1158 SWAQSGLTQEASVSGSPGQTVTLTCKGSSSYLGAYGAGWYQQLPGGTLKTVMLGTSRPSGIPDRFSGSKGSGSASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V53 iglv ABVD01136339.1 6438 SLSQPVLTQPPSLGSSVRLTCTLSSGFNVGDYAIPWYQQKPGSPPQYLLSFQRDSNKNQGSGLPSRFSGSKDASANAGLLLISGLQPEDKSEYYCNVYHDRPDA
Choloepus hoffmanni V63 ighv ABVD01155913.1 2920 VLTQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSNDMSWIRQAPGKGLEWVAVIYGGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAK
Choloepus hoffmanni V64 iglv ABVD01160726.1 11516 SVASYEVTQPCSVSVALGQTARLTCGGNNIGRKSVQWYQQTPGQAPVLLIYADNQRPSGIPDRFSGSNSGNTATQTISGVQTEDEADYYCFAAGSGV
Choloepus hoffmanni V69 iglv ABVD01174842.1 1277 SLSQPVLTQPPSLSASLRSSVRLPCTLSSDVNVGTYRIYWYQQKPGSPPWYLLNYYSDSNKHQGSGVPSRFSGSKDTSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V73 iglv ABVD01185437.1 2844 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVNWYQQLPGTAPKLLIYGNSNRPSGVLDRFSGSKSGNSGSLSITGLQPEDEADYYCSSWDSSIRG
Choloepus hoffmanni V79 trav ABVD01201513.1 234 SSIAQNVTQTQPAMLAKEKETVTLNCTYDTRESSYGLFWYKQPSSGEMIFLILQESYNQQNATEGRFSVNFQKAIRSINLVISASQLGDSAVYFCALKE
Choloepus hoffmanni V80 trav ABVD01201515.1 2015 GTSGDLVTQMEGQVALSEGALLTVNCTYTAAGYPFLFWYVQRPGEGPQLLLKAMKANEKGRNKGFEATYNKESTSFHLEKPSVQVSDSAVYYCALS
Choloepus hoffmanni V83 ighv ABVD01211498.1 9839 VLSQVQVKESGPSQVEASQTLSLTCSVSDIYSTTYDVKWKRQSPGKGQEEVGTIWSDGSTYYNPALQSRVTITRDNSKNEVYLKLSSVTPEDTATYYCGI
Choloepus hoffmanni V86 iglv ABVD01215751.1 2746 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVHWYQQLPGKAPKLLIYGSSNRPSGVPDRFSGSRSGNSGSLSITGLQPEDEADYYCSVWDSSIRG
Choloepus hoffmanni V87 ighv ABVD01215960.1 6129 ALSQVQLKESGPGLVKPSQTLSLTCSTSGFSLTSYSVHWIRQFPGKGLEWVGVISYTGSAYFNPTLKSRLSITRNSSKNEASLKLSSLRTEDMATYYCAK
Choloepus hoffmanni V94 iglv ABVD01241942.1 460 SWAQAVLTQPPSVSGALGQRVTISCSGSSTNIGGGYAVNWYQQLPGTAPKLLIYGNSNRPSGVLDRFSGSKSGNSGSLSITGLQPEDEADYYCSSWDSSISG
Choloepus hoffmanni V96 ighv ABVD01246359.1 6124 VFSQVTLKETGAGLVKPAQTLTLTCTFSGFSISTSGIGVAWIRQPPGKALEWLATIYWDDDKYYAASLKSRLTISKDNARSQVSLAMTNMNPVDTAMYYCARR
Choloepus hoffmanni V97 iglv ABVD01246447.1 6944 SLSQPVVTQPPSLSASLGSSVRLPCTLSSGINVGGYHIHWYQQKPGNPPRYLLYYYSDSNKHQGSGVPSRFSGSKDSSANAGLLLISGLQAEDEADYYCAI
Choloepus hoffmanni V99 iglv ABVD01248633.1 5243 SLSQSVLTQPPSASASLGASVKLPCTLSSEHSSYWIEWFQQRPRKGPQYVMQVKSDGSQSKGDGIPDCFSGSSSGADRYLTISNLQAEDEADYFCGVGYSSGY
Choloepus hoffmanni V104 igkv ABVD01255704.1 900 ASGDIVMTQSPASLALSPGETTTLNCKSSQSVFHSSYKTSYLNWYQKKPGQPPKLLIYMASTRQSGVPDRFSGSGSGTDFTLTISSFQPEDVADYYCQHSYSSP
Choloepus hoffmanni V106 trav ABVD01262899.1 1201 GTTGDSVTQTEGLITLLEEAPLTLNCTYQSSYSPFLFWYVQHPNKAPQLLLKSSSENQEVDSRGFQATHVKSDSSFHLWKPSVQTSDSAVYYCVLS
Choloepus hoffmanni V111 ighv ABVD01274430.1 482 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYGMSWIRQAPGKELEWVAEITGGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAA
Choloepus hoffmanni V112 trav ABVD01278576.1 2114 DARAQSVSQPQGHISVSEGASLELRCNYSYGATAYLFWYIQYPSRGLQLLLKYVSGDNLVKGIKDFEAEFQKSKSSFNLKKHSVQWSDSAVYFCALN
Choloepus hoffmanni V115 ighv ABVD01284802.1 1736 VLSQVCLQESGPGLMKPFQTLGLTCIVSGFSVTASGSCWNWIHQPPGKGLQWLSRTCSNDDTYYIHPSEPSSYPQSTSRSVLSQLSSFCAEDMACYYCVR
Choloepus hoffmanni V117 iglv ABVD01290724.1 4054 SVASYEVTQPRSVSVALGQTARLTCGGDNIGNKAVHWYQQMPGQAPVLLIYSDDSRPSGIPDRFSGSNSGNTATLTISGVQTEDEADYYCFAAGSGA
Choloepus hoffmanni V123 igkv ABVD01303795.1 199 ACGDIVMTQTPDSVAGSPGEKITMKCKSSQSVSSYLAWYQQKPGQAPKLLIYGASSQASGVPDRFSGSGSGTDFTFTISSFQPEDVGLYYCQQYNSYT
Choloepus hoffmanni V126 igkv ABVD01310389.1 3366 ATGDIVMTQSPASLAVSPGETTTINCKSSQSVFHNTDKKTYFYWFQKKPGQPPKLLIYYASTRASGVPDRFTGSGSGTDFTLTISRFQPEDVADYYCMQATSYP
Choloepus hoffmanni V130 trav ABVD01322994.1 4476 VRSQQKAVKQTAASRSILEGTIASFNCTYEDRASQYFTWYRQDSGKGPVLLMFIYSNGDKTEGRFTVQLNKARQFVSLLITDTQPSDSATYLCAV
Choloepus hoffmanni V135 trav ABVD01339238.1 636 ARDKNEAQQSPPFLHAQEGELLAINCSYSTGMTTLQWLQQNPGGGFVSLFILSLEMKKKGRLRATINTKDSRSTLHITAAQPGDSATYLCAVE
Choloepus hoffmanni V136 iglv ABVD01340208.1 2159 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNYVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V138 iglv ABVD01343300.1 514 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGHNYVSWYQQHPGTAPKLLIYRVSNRPSGIPDSFSGSKSGNTASLTISGLHTEDEADYYCMSWTSS
Choloepus hoffmanni V147 trav ABVD01366911.1 1477 IRVHLEVKQSPQVLIFQEGRNSSLMCNSSIAITSVQWFKQNPGGHLITLFYIASGMQQNGRLKVTVNTKGSYSHLYIRDSRPGDSATYICAME
Choloepus hoffmanni V148 trbv ABVD01367711.1 1136 SGLGGLVSQHPGTVICKSGTSVKILCHLVGLQVPTVFWYRQYPKQSFILIATSNGVSSIAHENDFTEAKFPISHPNLTFSTLMVTSVQPEDSSFYFCSAS
Choloepus hoffmanni V150 trav ABVD01369242.1 1332 VRSQEPEQSPQPLIIQEGEDVTINCNSSKTLYSLQWYRQKHGEGPIFLMLLLKGGEEKNLDNILAKFNENKQQSTLTMTASQPSHSGTYFCGVE
Choloepus hoffmanni V151 trav ABVD01370191.1 321 GQQVKQSPPSLRVQEGGISILNCDYSNALFDYFLWYRKYPAKSPEFLTSVHSGVDSNEDGRFTVFLNKSAQHLSLNITAAHPEDSALYFCAAS
Choloepus hoffmanni V153 iglv ABVD01373988.1 1819 SLSQPVLTQPPSASASLGASVKFTCTLSSEHSSYRIEWFQQRPGKGPQYVMQVKSDGSQSKGDGIPDRFLGSSSGADRYLTISSLQAEDEADYFCGVSYNSGY
Choloepus hoffmanni V156 trbv ABVD01375453.1 96 VRAQTIHQWPATKVQLVGSPVSLECTVKGTSAPTLYWYRQDTGKALQLLFHSISTEQIDPEGSQYVSASRPQDGQFSLSFKKLLLSDTGFYLCAWR
Choloepus hoffmanni V157 iglv ABVD01376864.1 1491 FVASYVLTQSSSVSVALGQTARITCSGDNLGGKYVSWYQQEPGKAPVLLIYVNNKRHSGISDQFSGSNSGNTVTLTISSAQAKDEADYYCASSDGSGSS
Choloepus hoffmanni V158 trav ABVD01380831.1 1146 TLSLAKTMQPISVDSYEGQEVNISCSHADIATNEFIFWYRQFLNEGPQFIIQGYKTNVANEVASLFVSKDRKSSTLSLPWAALRDTAVYYCIVRV
Choloepus hoffmanni V161 trav ABVD01386926.1 2150 DVRAQSVSQPQVHISISEGAFLELRCNYSYVGTPYLFWYVQYSSQGLQLLLKYFPGNTLIKGINNFEAEFQKNESSFHLRKPSIHWSNAAEYFCAVS
Choloepus hoffmanni V162 iglv ABVD01388943.1 6522 SWAQSGLTQEASVSGSPGQTVTLTCKGSSSYLGAYGAGWYQQFPGGTPKTVMLGTSRPSGIPARFSGSKASGTASLTITGLQPEDEAVYYCSTAD
Choloepus hoffmanni V164 trbv ABVD01395059.1 3415 PIDTGITQEPKYLVIGMGNKTLKCEQHLGHNAMYWYKQNSKKPPEFMFAYNLKELVQNETVPIRFSLKCPDSSKLYLHVDGLEPDDPATYLCASSK
Choloepus hoffmanni V167 ighv ABVD01403044.1 5729 VLTEVQLVQSGAEVKRPGEPLTISCKASEYSFTSYWIGWVRQQPGKGLEWVGSIYPGDSDTRYSPSFKGQVTISTENSASTAYLKWTSLKDSDTVVYYCAR
Choloepus hoffmanni V171 ighv ABVD01417551.1 756 VLTQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSNDMSWIRQAPGKGLEWVAEITSGGSTYYNPTLKSRVTITKDNSKNEVYLKLSGLKSEDTATYYCAR
Choloepus hoffmanni V176 igkv ABVD01443940.1 3767 ASGDIVLTQSPDSVAESPGETITMNCKSSQSVSSSNLHWYQQKPGQPPKLLICDASTWASGVPDRFSGSGSGTDFTLTIGRFQPEDVASYYCQYD
Choloepus hoffmanni V178 igkv ABVD01448194.1 1757 ASGNVMLTQSPDSVAMSPGESVTISCKSSESVSSYLNWYQQKPGQVPKVLIYYASTRAPGVPDRFTGSGSGTDFTLTISRFQPEDVASYYCQQYKSYL
Choloepus hoffmanni V185 trav ABVD01458358.1 3008 VKGQVEQNPHAMNTQEGENVTLNCHYKTSIYNIQWYRQDSGRGLSRLILIRSNEKEKHSGRLRATLDTSTQRSSLIITASQTADTGAYFCAV
Choloepus hoffmanni V188 iglv ABVD01472454.1 1065 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGSNSVSWYQQHPGTAPKLLIYRVSNRPSGIPDRFPGSKSGNTASLTITGLLSEDEADYHCASYASTSY
Choloepus hoffmanni V189 iglv ABVD01473132.1 635 CGDSAAPPPRIPGTSVRLPCTLSSGFSVGDFWIHWFQQKPGSSPRYLLRFKSDSDKQQGSRVPSCFSGAKDALTNSGVLHISGLQPEDEADYYCCAGHEGSKT
Choloepus hoffmanni V196 trgv ABVD01491734.1 2859 SHSAPNLEWRKRSVTGKTGATVEITCDIVVQTSTYLHWYRHLEGKAPQRLLYYNTHSSKFWVDSGINEVKYDGYTGRDKSYKLKLRNLEESDSGVYYCAVWD
Choloepus hoffmanni V197 trbv ABVD01493182.1 223 HMEAEIIQSPRHKVAKTGKEVILRCHQNKNHEYMYWYRQDLGQALRLIYYSTGVNITDKGEIHDGYGVSRSKTEDFSLTMESAASSQTSVYFCASSD
Choloepus hoffmanni V203 trav ABVD01505061.1 605 GTNGDSVTQMEGEVTLSVGDLLTVNCTYTAAGYPTLFWYVQHPGEGPQLLLKATKASEKGRNKGFEATYDKETTSFHLEKASVQESDSAVYFCALS
Choloepus hoffmanni V221 trav ABVD01570220.1 2021 VRSLQVEQSPPALSLQEGASCMLRCRFSASVNSVQWFRQKPGRHLINLFYNPSGTQQRGRLSSTTVTRERYTTLNISSSQTTDSAIYFCAAEAQCSP
Choloepus hoffmanni V228 iglv ABVD01619669.1 654 SLSQPVLTQPPSASASLGASAKFTCTLSSEHSSYWIEWFQQRPGKGPQYVMQVKSDGSQSKGSGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGVGDSSGY
Choloepus hoffmanni V240 iglv ABVD01678075.1 869 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNYVSWYQQHPGTAPKLLIYNVNKRPSGIPDRFSGSKSGNTASLSISRLQPEDEAGYYCMSVSSIYP
Choloepus hoffmanni V243 igkv ABVD01691841.1 336 ASGDIVITQSPASLAVSPGETATINCKSSQSIFHSSDKKTYLNWIQKKPGQPPKRLIYYASTRASGVPDRFTGSGSGTDFTLTISRFQPEDVADYYCMQGYSYP
Choloepus hoffmanni V249 iglv ABVD01716799.1 972 SLSQPVLTQPPSASASLGASVKLTCTLSSEHSSYWIEWFQQRPGKGPQYVMQVKSDGSQSKGDGIPDRFLGSSSGADCYLTISSLQAEDEADYFCGVSYSSGY
Choloepus hoffmanni V252 ighv ABVD01722687.1 1197 VLSQVQLKESGSGLVKPSQTLSLTCSVSGYSITTNYCWSWIRQPPGKGLQWIGCIYYNGNTYYSSSLKSRSSVTRDTSKNQFSLQLSSVTAEDTATYYCAR
Choloepus hoffmanni V261 trav ABVD01765551.1 501 GMLAQTVTQPEDLISVFEGDPVQLRCNYSYSGSPVLSWYVQYPRQSLQLLLRHISGERIRGFMADLDKGKASFHLKKPAAHEEDSAMYYCALS
Choloepus hoffmanni V267 iglv ABVD01792822.1 806 SVASFELTQPRSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQTPKLVIYEDSKRPSGIPDRLSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V281 iglv ABVD01927565.1 326 SRAQSALTQPPSVSGSLGQTVTISCAGSSSDIGGYNLVSWYQQHPGTAPKLLIYRVNKRPSGIPDHFSGSKSGNTASLSITGLLSEDEADYYCASYAGSNN
Choloepus hoffmanni V290 iglv ABVD01021197.1 2054 SLSQPVLTQPPSASASLGASVKFTCTLSSEHSSYWIEWFQQRPGKGPQYVMQVKSDGSQSKGSGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGVGDSSGY
Choloepus hoffmanni V291 iglv ABVD01021198.1 8447 SMASYELTQPHSVSVALGQTARLTCSGENIGSEYTQWYRQRPGHAPAFIISGDSNHPSGIPDWFSGSSSGNTATLTISGAQAKDEAEYYCQVWDIDSSA
Choloepus hoffmanni V296 iglv ABVD01037762.1 645 SVASFELTQPHSVSVALGQTASLTCSGGKFENIYVHWYQQKPDQAPKLVIYEDSKRPSGIPERFSGSSSGNTATLTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V298 iglv ABVD01041639.1 1407 SVASFELTQPHSVSVALGQTTRLTCSGGQLEKKYAYWYQQKTDQSPKLVIYEDSKPPSGISDRFSGSTSGNMATLIINGVQNEDEAEYYCLSSDSDSNA
Choloepus hoffmanni V304 iglv ABVD01049734.1 3247 SLSQPVLTQPPSLSASLGTTARLSCTMSSGANVGGFYIHWYQQKPGSAPRYFLYYYSNSDKQLGPGVPSRVSGSKDTSSNAAYLHISGLQPGDEADYYCSI
Choloepus hoffmanni V307 ighv ABVD01051053.1 822 VLSQVQLKESGSGLVKPSQTLSLPCSVSGFSITTNYCWAWIRQSPGKGLQWIGYICYNGNTYYSSSLKSRSSITRDTSKNQFSLQLSSVTAEDTATYYCAR
Choloepus hoffmanni V308 trbv ABVD01051336.1 3438 HTDAGVIQTPRNKVVEMKRAVTLRCEPIPGHTTIFWYRQTLGQGLQLLIYFRNQAPVDDTGMPKPRFSAEMPEKSSSILKIQPTEPEDSAVYLCASSL
Choloepus hoffmanni V309 trbv ABVD01051339.1 5928 SVDAGVIQSPRYLIKGKPGKAILQCYPMAGHRSVYWYKQDLGQGPQFLVEYFEKTQRDKGNIPDRFSVQQFDDYSAELNMSSLEVEDSALYLCASSL
Choloepus hoffmanni V317 ighv ABVD01080141.1 1182 VLSQVQLKESGPGLVKPSQTLSLTCSISGFSLTSYGVNWIRQVPGKGLEWVGLIRYDGNTYFNPTLQSRLSITRDTTKNVVYLQLSSLRTEDAAMYYCAK
Choloepus hoffmanni V323 trbv ABVD01105693.1 3836 PADSGVIQTPRHLIKAKGQQVTLKCSPMSGHDNVFWYQQALGQGLQFLIQHYREEESERGKFPDRFSAKQFSDYRSELNMSSLQLEDSALYLCASRF
Choloepus hoffmanni V324 trbv ABVD01105694.1 1815 HVDSGVIQTPRHLIKAKGQRVTLKCSPMSGHDNLFWYQQALGQGPRFLGRYYNGEESERGNFSDRFSAQQFSNHSSELNVSSLQLEDSALYLCASSL
Choloepus hoffmanni V345 iglv ABVD01160036.1 1570 YLSQSVLTQPPSASASLGTSVKFTCTLSSEHSSYWIEWFQQGPGKGPQYVMQVKSDGSQSKGDGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGADYSSWY
Choloepus hoffmanni V350 trgv ABVD01168789.1 5587 KLEQPQLSSTKMRLKTARLECVVSGVLISAISIHWYQEKPGEAMQHLLYISSDNTVKMESGITQDKFEVDKIPEMSTSTLTIHSVEKQDSAIYYCASWE
Choloepus hoffmanni V351 trgv ABVD01168791.1 980 SQSAPNLEWRKRSVTREIGETVVITCDIVGQNSYYVHWYRHQEGKAPQRLLYYQPSTSKFWVDSRIKQSKYDAYTGRDRSYKLVVQKLEESDSGVYYCAVWD
Choloepus hoffmanni V353 iglv ABVD01170267.1 5542 SWAQSGLTQEASVSGSLGQTVTLTCKGSSPALRAFGAGWYQQIPGGTLKTVMLGTSRPSGIPARFSGSKASGTASLTISGIQAEDEAVYYCSTFDPSSSA
Choloepus hoffmanni V355 trbv ABVD01172426.1 496 LVDSGVTQTPRHLIKTRGQKVILRCSPISGHVSVFWYQQALSKTPQFLFQFYENLQRAKGDVPDRFSAEQFRDYSSELNVSSLQLEDSALYLCASSL
Choloepus hoffmanni V356 trbv ABVD01172427.1 5393 HTGAAGVSQSPRHRVTGSGQTVELRCDPVSGHATLFWYRQTLGQGLEFLTYFQNSEELDKSGMPNDRFSALRTEGSNSTLKIQPAKQEDSAVYLCASSK
Choloepus hoffmanni V357 trbv ABVD01172427.1 2187 PVDAGITQTPRYHIIQTGKKTVLQCFQDMDHLAMYWYLQNPGQGLWLIHYSGGTDSTDNGDVPDGYSVSRKKKDRFPLTLESASTNQTSFYLCASSL
Choloepus hoffmanni V358 iglv ABVD01186033.1 3742 SVASYEVTQPCSVSVALGQTARLTCGGNNIGSKSVQWYQQMPGQAPVLLIYSDDSQPSGIPDLFSGSNSGNTATLTISRVQTEDEADYYCFAAGSGA
Choloepus hoffmanni V359 iglv ABVD01186036.1 1748 SVASFELTQPHSVSVALGQTARLTCSGGKFEDRYVYWYQQKPDQAPKLVIYEDSKRPSGIPDRLSGSSSGNTATVTISGVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V367 ighv ABVD01201501.1 1015 VLSQVQLKESGPGLVKPSQTLSLTCSVSGGSLSSYYMSWIRQAPGKGLEWVGWISSSGSTTYNSTLKSRVTITKDNSKNEVYLKLSSLSPEDTAVYYCAR
Choloepus hoffmanni V368 ighv ABVD01205927.1 1676 VLSQVQLKESGPGLVKPSQTLSLTCTVSGFSLSSNAMHWIRQAPGKGLEWVGAIGSSGSTYYNPTLKSRVTITKDNSKNEVYLKLSSLSPEDTAVYYCAR
Choloepus hoffmanni V375 ighv ABVD01224164.1 1735 VRSQVLMKESGPALVKPSQSLCITCSLSGFSLTNNSVQWNNKSPGKGLEWVGVISRGGRTYYNPSPWAQLDITRDNSNDEIYVKMSSLRAKDMATYYCPR
Choloepus hoffmanni V383 ighv ABVD01242101.1 448 VLTEVQLVQSGAEVKKPGEPLTIACKASGYSFTSYWIHWVRQPPGKGLEWVGRIYPGDADTNYSPSFRGQVTISTENSASTAYLKFTHLKDSDTAVYYCAR
Choloepus hoffmanni V390 ighv ABVD01247746.1 3997 VLSQVQLKESGPGQVKASQTLSLTCSVSGISLTYYAVAWKRHAPGKGEENVGVISRYGSTNYNPAFQSRVTITRDTSKNEFYLKLSSVTPEDMATYYCGI
Choloepus hoffmanni V396 trbv ABVD01275143.1 638 LMNAKVTQTPSYLITRIGNKVSLECVQHMGHERMFWYRQDPAQGLRLIYSSYDVDSKEKGDVPNGYSVSRKKREEFTLTLESPSTNQTSVYFCASSL
Choloepus hoffmanni V402 ighv ABVD01284650.1 1145 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYDMGWIRQAPGKGLEWVGAISSGGSTYYNPTLKSRVTITKDNSKNEVYLKLSSLNPEDTAVYYCAK
Choloepus hoffmanni V406 ighv ABVD01296983.1 4499 VLSELTLKESGQGLVKPSQTLSLTCTATGGSVTSSYYWHWIRQRPGKGLEWMGYWSGSTSYNPAFQGRITINADTSKNQFSLKLNSMTVEDTATYYCAK
Choloepus hoffmanni V408 iglv ABVD01298432.1 6629 SWAQSALTQPPSVSGSLGQTVTISCAGSSSDIGDDVMGDYVSWYQQNPGKAPKTIIYEVNKRASGIPDRFSVSKSGNTASLRISGLQPEDEADYHCM
Choloepus hoffmanni V416 iglv ABVD01314181.1 542 SWAQSGLTQEASVSGSLGQTVTLTCKGGSSYLGSYGAGWYQQLPGGTPKTVMLRTSRPSGIPARFSGSKASGKASLTITGLQPEDEAVYYCSTWDSSISG
Choloepus hoffmanni V420 trgv ABVD01327117.1 808 SQSAPNLEWRRRSVTGQTGATVEITCDIVVQTSTYLHWYRHLEGKAPQRLLYYYPRSSKFWVDSGIDQRKYDAYTNRDRSYKLLVQNLEESDSGVYYCAVWD
Choloepus hoffmanni V422 trbv ABVD01340267.1 386 SVDAGVIQSPRYLIKGKPGKAILKCYPMARHRSVYWYQQDLGQGPQFLIEYFEKTQRNKGNIPDQFSVQQFDDYSSELNMSSLEVEDSALYLCASSL
Choloepus hoffmanni V423 trbv ABVD01340268.1 3263 HTGAGVSQSPRHRVIESGQAVTLRCDPISGHIYLYWYLKIPGQGLEFLTYLRYNEALDKSEMPEDRFSAEKTDGSDSVLKIQPAELRDSAVYLCASSE
Choloepus hoffmanni V437 ighv ABVD01401229.1 1599 VLSQVQLKESGPGLVKPSQTLSLTCSTSGFSLTSNGVHWIRQAPGKGLEWVGLMGYDGNTYFNPTLKSRLSITRDTSKNEVSLKVSSLRTEDTATYYCAR
Choloepus hoffmanni V446 igkv ABVD01425236.1 2716 ASGDITLTQSPDSVAGSQRETVTISCKSSQSVSNYLHWYQQKPGQAPKLLIYAASTQASGVPDRFTGSGSGTDFTLTINKFQPEDVASYYCQQSSSYP
Choloepus hoffmanni V457 ighv ABVD01471445.1 2506 VLSQVQLKESGPGLVKPSQTLSLTCSVSGFSLSSYGMSWIRQAPGKGLEWVAVIYGGGSTYYNPTLKSRVTITKDNSKSEVYLKLSGLKSEDTATYYCAK
Choloepus hoffmanni V462 igkv ABVD01475541.1 4712 ASGDIVMIQSPDSLAVTPGETTTINCKSSQSVLYSSNQKNYLAWYQKKTGQSPKLLIYDASTRASGVPDRFSGSGSGTDFTLTINRVQPEDVAEYYCQQYYSSP
Choloepus hoffmanni V465 trav ABVD01492391.1 713 IMGDAQTTQPDSMASTEGETVNLPCNHPTISGINYIYWYRQILHQGPEYVIHGFKTNVTNEMASLTIPADRKSSTLVLPRVTLRSTAVYYCILI
Choloepus hoffmanni V470 trav ABVD01510666.1 1607 EARAQSVSQPQVHISTLEGSSLELGCNYSYGATPYLFWYVQYPSQGLQLLLKYTSGDNEVKGIKGFEAEFQKSKSSFNLKKHFVLWSDSAVYFCALS
Choloepus hoffmanni V472 ighv ABVD01515092.1 3650 VLSQVQLKESGPGLVKPSQTLSLTCSASGLSLSSHYMTWIRQAPGKGLEWVGRITSSGSTNYNPNLKSRVTINKDNSKNEVYLKLSSLIPEDTAVYYCAT
Choloepus hoffmanni V474 ighv ABVD01520150.1 2688 VLSQVQLKESGPGLVKPSETLSLTCSVSGFSLTDYAVSWVRQAPGKGLEWVSGIAYDGSTYFQPTLQSRLTITRDTSKNEVYLKLKSVRTEDTATYYCAR
Choloepus hoffmanni V487 trav ABVD01570024.1 1387 GTRAQAVTQPDALVTVAEGDPLELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYVSGNSLVTGIKGFKAEFRKSETSFHLGKASAQWSDSAMYFCVLS
Choloepus hoffmanni V489 iglv ABVD01578753.1 482 YLSQSVLTQPPSASASLGTSVKFTCTLSSEHSSYWIEWFQQGPGKGPQYVMQVKSDGSQSKGDGIPDRFSGSSSGADRYLTISSLQAEDEADYFCGADYSSWY
Choloepus hoffmanni V490 iglv ABVD01582709.1 666 SVASYELTQPRSVSVALGQTARLTCSGGQLEKRYAAWYQQKPDQAPKLVIYKDSEWPSGISDRFSGSSSGNTATLTISRVQNEDEADYYCLSSESDSSA
Choloepus hoffmanni V491 igkv ABVD01583400.1 1271 ASGDIMLTQSPESVAKSPGETVTISCKSSQGISSYVAWYQQKRGQAPKLLIYDASNRVSGVPDRFSGSGSGTDFTFTISKFQAEDVADYYCQQRQSY
Choloepus hoffmanni V492 igkv ABVD01586953.1 1563 CREQIILTQSPETLAASPGNFVSITCRSSSSVGTSMAWYQQKPNEAPRLLLFGASARAAGILSRFRGSGSGFDFSLGIHGVEAEDVGVYYCQ
Choloepus hoffmanni V516 igkv ABVD01673027.1 1267 TSGDTVMTQSPDSVVGSPGETITMSCKSNESVSDYVAWYKQKPGEVPKLLIYDADNQASGVPDRFSGSGSGRDFTFTITSVQPEDAGHYYCQQGY
Choloepus hoffmanni V528 ighv ABVD01740961.1 1164 VLSQVQLQESGPGLVKPSQTLTLTCSFSGFSITTNAYSLEWIRQPPGKGFQWVGAIWYDGSTYYNPSLKSRSSISRDTSNSQFSLQLSSMTSEDTATYYCAK
Choloepus hoffmanni V536 trdv ABVD01800221.1 1292 SSNAQVSQQIAVMSKKVGESVTLDCQITVSFSNYYMYWYQQTSTGKMTSLISLYYTNERSSNGRYSVVFQKASKTLKLTISSLVPGESAVYFCAVAE
Choloepus hoffmanni V540 trgv ABVD01818128.1 1254 SQSAPNLEWRKRSVTREIGETVVITCDIVGQNSYYVHWYRHQEGKAPQRLLYYQPSTSKFWVDSRIKQSKYDAYTGRDRSYKLVVQKLEESDSGVYYCAVWD
Choloepus hoffmanni V543 ighv ABVD01847605.1 861 ALSQVQLKESGPGLVKPSQTLSLTCSVSGFSVTSNGVHWIRQAPGKGLEWVALISYSGSTYFNPTLKSRLSITRDTSKNEVSLKVSSLRTEDTATYYCAK
Choloepus hoffmanni V550 iglv ABVD01942323.1 748 SVASYEVTQPRSVSVALGQTARLTCGGNNIGRKSVQWYQQTPGQAPVLLIYSDDSRPSGIPDRFSGSNSGNTATLTISKVEAGDEADYYCQVWDSDSSA