WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Tetraodon nigroviridis CAAE00000000.1 (CAAE01) 60 21 1 10 12 15 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Tetraodon nigroviridis Vs139 trbv CAAE01010073.1 2014 VCLCVDVRQSVSDLLTKPGDNVQIFCSHDKPEYTQMLWYQRSPGDTAMKLIGYLNYQDVTMEEQYKRNFNMSGDLRVNNAKNGSLMVQITGRDEDAVYYCAASE
Tetraodon nigroviridis Vs215 igkv CAAE01015143.1 357 ITSTPGSSVSLTCQTNPAVYSGCWNGQSWSGDCMFWFQQKPGQPPKLLVKIVRINHSGTPARFSGSGSRTSFTLTISGVQTEDAAVYYCAGFDGDD
Tetraodon nigroviridis Vs142 igkv CAAE01010083.1 378 CSGELTVTQPAVITSAPGSSVSLTCQTNTAVTTGCWNGQSYSIECMFWYQQKPGQPPKLLVKHIQNHSGTPARFSGSGSSTSFTLTISGVQAEDAAVYYCLG
Tetraodon nigroviridis Vs132 trbv CAAE01009234.1 31552 VSQSVLITQWPQYISSLPDGRAKMHCYQNDTEYEYVYWYKQQKGKSLQFMGSVVAGLANFEGIYQSGFEAAIVTKKHSTLTITRVGREDGAAYLCAAS
Tetraodon nigroviridis Vs130 trbv CAAE01009234.1 33769 LVDGSDVTQPALLWKVKGDNATIDCNHTKDATYYQMYWYRELPGKTMEEVVFTTTVSKAHDFGTFSKEKYSATKVQAESGTFTVKNLEAADTGLYFCAVS
Tetraodon nigroviridis Vs131 trbv CAAE01009234.1 32237 FASPSLVINQSKNLLIKMGNEARLECFHGDSGYPYMYWYQHRQAAGGRRVMELIGWLQYGSPNFQTNFKSHFSLKGHATKKAWLEISDTNQIDSAEYFCAAS
Tetraodon nigroviridis Vs136 trbv CAAE01009234.1 23570 SSFSDQITQIPAQAHYKPEETAEIKCSHTIRNYNNILWYRQTRDQQFQFLGYLIGASSFPESGLGVTLGGSADEGQTCTLTIAGLSLASSAVYYCAAR
Tetraodon nigroviridis Vs137 trbv CAAE01009234.1 21896 RADSVTFEQPSALIVKQGFKELRIDCKHDDSSLATMLWYQHKQSGRTMSLIGYTVIQSEPDYEPQFKERFQMTRVDMLRGHLVIGTAEPADSAVYFCAA
Tetraodon nigroviridis Vs134 trbv CAAE01009234.1 29882 FTLVLLQTGSQLSHPGAVVTLGCEMGPGLSMSSYTMFWYRQSSYRAPLEFVTREYAEDSGRFRPLLDASNNNFSLQINQLLPTDSSTYFCAA
Tetraodon nigroviridis Vs135 trbv CAAE01009234.1 24376 VADGSGVIQADVLWGNKSDSATMDCSHTKGGTYFYMYWFRQLPGETMKLIVFTSVRAEPDFGEFSKEKFSATKAKAESGPLTVKGLEAADSGLYLCAVS
Tetraodon nigroviridis Vs27 trav CAAE01009639.1 4019 LAITQSPSELAITQSPSEFIHSVGTGTPNCSVHTGTCDGEHTVYWFRDSGPSELSLVYSHKGRNNQCEKETNTCFYSLSLKNLNISQTGTYYCAVAAC
Tetraodon nigroviridis Vs26 ighv CAAE01009197.1 38659 GVDAQTLTQSGPVVKSPGESHTLTCTASGFTFSSYDMHWVRQAPGKGLEWISAISSGGSSTYYSESVKGRFTISRNNNRAQLNLQMSSLKTEDSAVYYCARD
Tetraodon nigroviridis Vs25 ighv CAAE01009197.1 36600 VWSERLDQSQSEVKRPGETVKMSCIISGFDMTAYYIHWIRQRPGSALEWVGRMDAGSNSARYGSSFESGYVMTEDVSSSTQYLEISSLTAEDSAVYFCAR
Tetraodon nigroviridis Vs140 trbv CAAE01010073.1 1404 ADDPKRVSQTPPSMVKREADPLVSGINCSHQIPGFQVILWYKQDEHKALKFLGSLNYIVRNLEDDVKGKISFDGDGSSHSSLNISALSLADSGVYFCAAS
Tetraodon nigroviridis Vs23 ighv CAAE01009197.1 34541 GVDAQTLTQSGPVVKRPGESHTLTCTASGFTFSSYYMAWVRQAPGKGLEWIAYIISTGGSSTYYSESVKGRFIISRDNNRAQLNLQMSSLKTEDSAVYYCARD
Tetraodon nigroviridis Vs22 ighv CAAE01009197.1 33397 VKCQQLTQPASVTVQPGQPLTITCQVSYSISSYSTNWIRQPAGKGLKWIGYSYTGASYYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARD
Tetraodon nigroviridis Vs21 ighv CAAE01009197.1 32550 VKCQQLTQPASVTVQPGQPLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGQKYTGASYYKASLQNKFSISLDSSSNTVTLNGVNVQPENTAVYYCARD
Tetraodon nigroviridis Vs20 ighv CAAE01009197.1 31270 GVDAQTLTQSGPVVKSPGESHTLTCTASGFTFSNYWMHWVRQAPGKGLEWISAIKYDGSGTFYPESVKGRFIVSRDNNRAQLNLQMSSLKTEDSAVYYCARW
Tetraodon nigroviridis Vs29 trav CAAE01009663.1 17337 YNINVEGSEMTINQSASESIPSGGSVTLNCSVQTGSCDGDHTVYWFRDSGPSRLGLINNHKGRNNQCEKKTNTCFYSLSLKNLNISQTGTYYCAVAAC
Tetraodon nigroviridis Vs28 trav CAAE01009663.1 5892 YTVIVEGSELSVNQSPSDSFQSGGSGTLNCTVHTGTCDRNHTIYWFRNSKKSELKLAYSHQGRNNQCEKKTNTCFYSLSIKRLNISQTGTYYCAVKAC
Tetraodon nigroviridis Vs1 ighv CAAE01000649.1 207 GVDAQTLTQSGPVVKRPGESHTLTCTASGFTFSIYWMAWVRQAPGKGLEWISSISSSGSYTYYSESVKGRFTISRNNNRAQLNLQMSSLKTEDSAVYYCARG
Tetraodon nigroviridis Vs7 ighv CAAE01008519.1 109 VKCQQLTQPASVTVQPGRPLTITCQVSYSVSSYWTSWIRQPAGKGLEWIGWQRVGNTPAYKPSLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARY
Tetraodon nigroviridis Vs154 igkv CAAE01013187.1 1372 ITSTPGSSVSLTCQTNTAVASNCYNGQSYTDCIGWYQQKPGQPPKLLVRHIINYSGTPARFSGSGSSTSFTLTISGVQTEDAADYYCAGALSDWRL
Tetraodon nigroviridis Vs24 ighv CAAE01009197.1 35806 VKCEQLTQPASVTVQPGRPLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARD
Tetraodon nigroviridis Vs149 ighv CAAE01011639.1 804 GVDAQTLTQSGPVVKRPGESHTLTCTASGFTFSSYYMAWVRQAPGKGLEWIAYIYTGGSSKYYSESVKGRFIVSRDDNRAQLNLQMSSLKTEDSAVYYCARE
Tetraodon nigroviridis Vs109 trav CAAE01008071.1 13398 SRGEDKVIQTSGDVVAAEGDTVTLDCTFQTSDTSAYLLWYKQENNNFPKFLLQVYSRSSQSPSTSQRIYASINQTSAPLKIQKLQLSDSAVYYCALR
Tetraodon nigroviridis Vs129 trbv CAAE01009234.1 36988 RADSVTFEQPSALIVKQGFKELRIDCKHDDSSLATMLWYQHKQSGRTMSLIGYTVIQSEPDYEPQFKERFQMTRVDMLRGHLVIGTAEPADSAVYFCAA
Tetraodon nigroviridis Vs141 trbv CAAE01010073.1 576 LVDGSDVTQPALLWKVKGDNATIDCKHTKDATYYQMYWYRQLPGKTMEEVVFTTTASKDHNFGTFSKEKYSATKVQVESGTFTVKNLEAADTGLYFCAVS
Tetraodon nigroviridis Vs55 iglv CAAE01014593.1 764769 VSAVTVLTQKPPVVSLSTGETVTMDCNLGTVTNYAASWYKQVPGGVPQYVLTWGSRWGAVKYGSGFSSPKFTSTHQSDSDYRLIISNVEEGDSAVYYCQTW
Tetraodon nigroviridis Vs147 ighv CAAE01011638.1 1750 VKCEQLTQPASVTVQPGQPLTITCQVSYSVSSYNTNWIRQPAGKGLEWIGYSSTGASYYKASLKNKFSISVDSSSNTATLNGVNVQPEDTAVYYCARY
Tetraodon nigroviridis Vs148 ighv CAAE01011638.1 538 GVDAQTLTQSGPVVKRPGESHTLTCTASGLDFRGYSMNWFKQAPGKGLESISGINSFGSTDYSESVKGRFIVSRDDNRAQLNLQMSSLKTEDSAVYYCARW
Tetraodon nigroviridis Vs121 igkv CAAE01009027.1 21698 ITSTPGSSVSLTCQTNPAVNNRCYNGQSYSGECLSWFQQKPGQPPKLLVRTVRINHSGTPARFSGSGSSTSFTLTISGVQTEDAAVYYCLCYDSE
Tetraodon nigroviridis Vs120 igkv CAAE01009027.1 26043 CSGELTVTQPAAITFTPGSSVSLTCQTNTAVHSSCWNGQSYSGECMSWFQQKPGQPPKLLVKTVRINYSGTPARFSGSGSSTSFTLTISGVQTEDAAVYYCAG
Tetraodon nigroviridis Vs123 igkv CAAE01009027.1 14586 ITSAPGSSVSLTCQTNPAVYNRCYNGQSYSGDCLSWYLQKPGQAPKLLIYAASTRYSGTPSRFSGSRSGSQFTLSISGVQTEDAAVYYCAGYYSD
Tetraodon nigroviridis Vs122 igkv CAAE01009027.1 17483 IIFTPGSSVSLTCQTNPAVHNRCWNGQSGTGDCMYWFQQKPGQPPKLLIYAASIRHSGTPSRFSGSRSGSQFTLTISGVQAEDAGDYYCLGYPGG
Tetraodon nigroviridis Vs125 trbv CAAE01009234.1 40378 ASKTQSVFQEPPFIIMRAGESLVSGIKCSHTISGYDLIYWYKQDESRTFKFLGYLNVLFATPEDDVKGKINFDGDGRSHSSLNISGLFLNDSGVYFCAAS
Tetraodon nigroviridis Vs127 trbv CAAE01009234.1 39059 ICLSVEVHQSPRAILRRPGDTVQLICSHEKTDFYVMYWFQKPSGATALKRIGHVYYSSIEQEESFKEHFSIKGDMSASTAKTGSLFIANLKAPDHDAVYYCAASD
Tetraodon nigroviridis Vs126 trbv CAAE01009234.1 39723 STLSDQVYQSPADIYKKPGAKAKIRCLHRIPNYNQILWYKKSNQELQLLGYMYFNNPNIENGINATIEGDANKDKTCTLILESLDLHSSAVYFCAAS
Tetraodon nigroviridis Vs34 trav CAAE01011932.1 404 LAITQSPSELAITQSPSEFIHSVGTGTPSCSVHTGTCDGEHTVYWFRNSGPSELSLVYSHKGRNNQCEKETNTCFYSLSMKNLNISQTGTYYCAVAAC
Tetraodon nigroviridis Vs13 igkv CAAE01009027.1 608 ITSAPGSSVSLTCQTNTAVYSSCNNGQSNTDCIGWYQQKPGQPPKLLVKHIINHSGTPARFSGSGSRTSFTLTISGVQTEDAAVYYCAGTTGDGTL
Tetraodon nigroviridis Vs16 ighv CAAE01009197.1 20106 GVDAQTLTQSGPVVKRPGESHTLTCTASGYTFSDHYMVWVRQAPGKGLEWISGISSGGSTYYPESVKGRFIISRDNNRAQLNLQMSSLKTEDSAVYYCARW
Tetraodon nigroviridis Vs14 ighv CAAE01009141.1 10556 GVDAQTLTQSGPVVQRPGESHTLTCTASGFTFSSYWMAWVRQAPGKGLEWIAYISTGGSYTDYSESVKGRFIVSRDDNRAQLNLQMSSLKTEDSAVYYCARY
Tetraodon nigroviridis Vs15 ighv CAAE01009197.1 17758 VKCEQLTQPASVTVQPGRPLTITCQVSYSLSGYWTHWIRQPAGKGLEWIGAHRAGYSPVYKASLQNKFSISSDSSSNTATLNGVNVQPEDTAVYYCARE
Tetraodon nigroviridis Vs18 ighv CAAE01009197.1 26659 VKCEQLTQPASVTVQPGRPLTITCQVSYSVSGYWTHWIRQPAGKGLEWIGAHSVGSTPYYKASLKNKFSISLDSSSKTVTLNGVNVQPEDTAVYYCARE
Tetraodon nigroviridis Vs19 ighv CAAE01009197.1 30194 VKCEQLTQPASVTVQPGRPLTITCQVSYSISSYWTHWIRQPAGKGLEWIGQKSTGGSYYKASLQNKFSISSDSSSKTVTLNGVNVQPEDTAVYYCARE
Tetraodon nigroviridis Vs39 ighv CAAE01012787.1 909 GVDAQTLTQSGPVVKRPGESHTLTCTASGLDFSSYWMAWVRQTPGKGLEWISAISSGGSTYYSESVKGRFIVSRDNNRAQLNLQMSSLKTEDSAVYYCARE
Tetraodon nigroviridis Vs150 ighv CAAE01011640.1 997 VKCEQLTQPASVTVQPGRPLTITCQVSYSLSSYATHWIRQPAGKGLEWIGWHRVGYSGGYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARD
Tetraodon nigroviridis Vs40 ighv CAAE01013374.1 1151 VKCEQLTQPASVTVQPGRPLTITCQVSYSVSSYATNWIRQPAGKGLEWIGAHCSGCTPSYKASLQNKFSISLDSSSKTVTLNGVNVQPEDTVVYYCARE
Tetraodon nigroviridis Vs110 trav CAAE01008071.1 11293 CRGEDKVIQPSGDVVAAEGDTVTLDCTFQSSTNSPYIFWYKQDGTSGPKFILSCNPFSPVKKENEFMERFSSTLNSTTKSAPLKIQKLQLSDSAVYYCALR
Tetraodon nigroviridis Vs111 trav CAAE01008071.1 10185 CRTQGDNVLQPKAEEMAAEDQTVTLDCQYTSTSTNVYIFWYKQDGTSRPKFILSCFSFGGGKTENEFMERLSSTLNSTTKSAPLKIQKLQLSDSAVYYCALR
Tetraodon nigroviridis Vs112 trav CAAE01008071.1 9372 FVSSYNIKAQSSEEHVAEGRAISLVCNYEGSIYNIQWYRQQQRSRPEFLLYITEGGTVNPTASGFSAHIDKIGKSVALQISSAAVTDSAVYYCALR
Tetraodon nigroviridis Vs113 trdv CAAE01008071.1 8729 MTSAQNIYPVADMKNGISSKEGDTVSLTCNYKTSATYIRLYWYKQQSEHLAPQFILWKGARGSSSEYIPDQRYKCQTGQEESKLNITEVTLADTAVYYCAL
Tetraodon nigroviridis Vs114 trav CAAE01008071.1 7453 CRTQGDNVLQPKAEEMAAEDQTVTLDCQYTSTSTNVYIFWYKQDGTSGPKFILSCFSFGGGKTENEFMERFSSTLNSTTKSAPLKIQKLQLSDSAVYYCALR
Tetraodon nigroviridis Vs115 trav CAAE01008071.1 6640 FVSSYNIKAQSSEEHVAEGRAISLVCNYEGSITNIQWYRQQQRSRPEFLLYITEGGTVNPTASGFSAHIDKIGKSVALQISSAAVTDSAVYYCALR
Tetraodon nigroviridis Vs116 trav CAAE01008071.1 5961 CRGEDKVIQPSGDAVAAEGDTVTLDCTFQSSTNSPYIFWYKQDGTSRPKFILSCSSFGGGKTENEFKERFSSTLNSTTKSAPLKIQKLQLSDSAVYYCALK
Tetraodon nigroviridis Vs118 igkv CAAE01009027.1 41019 CSGELTVTQPAVITSAPGSSVSLTCQTNTAVCRRCWNGQSWSRDCMFWYQQKPGQPPKLLVRNVRINHSGTPARFSGSGSRTSFTLTISGVQAEDAAVYYCLG
Tetraodon nigroviridis Vs119 igkv CAAE01009027.1 33999 ITFTPGSSVSLTCQTNPAVNSGCYNGQSYTDCMSWYQQKPGQPPKLLVRHIINHSGTPARFSGSGSSTSFTLTISGVQTEDAAVYYCLGALSDGTL
Tetraodon nigroviridis Vs17 ighv CAAE01009197.1 23062 GVDAQTLTQSGPVVKSPGESHTLTCTASGLDFSGYSMDWFKQAPGKGLESISGITSFGSTSYSESVKGRFTISRDDNRAQLNLQMSSLKTEDSAVYYCARW
Tetraodon nigroviridis Vs143 trav CAAE01010177.1 17892 QTATIEVSPSIKWKNNLFLVKPGHNLTLECLYTNKGTTKMSWYKETLEETPSPIFYNDFQDNPRFKLHTDNKGANLTIMALELSDSATYYCTEQEFH
Tetraodon nigroviridis Vs128 trbv CAAE01009234.1 38384 VCLCVDVRQSVSDLLTKPGDNVQIFCSHDKTDYRVMLWYQRSPGDTAMKLIGYLNYQDVTMEEQYKRNFNMTGDLRVDNAKNGSLMIQITGRDEDAVYYCAASK