WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mchenga conophoros ABPJ00000000.1 (ABPJ01) 26 6 0 9 3 5 2 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mchenga conophoros Vs41 trbv ABPJ01028413.1 779 VSVGIEVRQSSSDIVAKASDKVQIFCSHEKTDYRVMLWYQQSPGDTAMKLIGFLNFQAVTLDQDQYKDHFDFTGDLSGDTAKNGSLIVKVTQHEHSAVYYCAARY
Mchenga conophoros Vs40 trbv ABPJ01027062.1 490 VFLGLEVRQSSSDIIANVSSKVQIFCIHDKTDYYVMLWYQCPPGETAMKLIGYLYHKQVTMEDQYKSNFIISGDLTGSTAKNSSLIANAAQQGDSAVYYCAASK
Mchenga conophoros Vs42 igkv ABPJ01034844.1 658 SSAEIVLTQTPKAQSVAPGQTVSVRCKASSSMSSYLHWYLQKPSEAPKLLVYYATTRQSGVSDRFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYNFP
Mchenga conophoros Vs27 ighv ABPJ01001039.1 558 VNSETLTQPASMIVQPGEHLTITCQVSYSLGSYPTAWIRQPAGKALEWIGRAGDGWTTYYKDSLKNKFSISFESSSKTVTLRGTNVQPEDTAVYYCARE
Mchenga conophoros Vs26 igkv ABPJ01082684.1 148 SRGQYTVTQPGAVSSAVGGSVSIKCTTSQNIYSNWLSWYQQKDGGVPKLLIYYISTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Mchenga conophoros Vs24 ighv ABPJ01082457.1 240 VYSIDLIQSDSIVAQPGQSVTITCQVSGYSLTDRNYATGWIRQSEGKTLEWILHRWGNGDMAQNNALKNKLLHHTYSSTSSVTLTGVNLQPEDTAVYYCVRS
Mchenga conophoros Vs21 trbv ABPJ01064911.1 213 LTVVVLQSGDQISDPGRKVLLECKMGPGFSMGSYTMFWYRQNHHRAPIEFLMREYEKPVGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Mchenga conophoros Vs29 trav ABPJ01003027.1 1277 CRAQKDNVLQAKGEETAAAGGTVTLDCQYNTSSSNHYLYWYKQDGNNSPKFILSRFKVGEGENEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Mchenga conophoros Vs28 ighv ABPJ01001352.1 890 NISVGTEGQTLTESESVVQRPGDSHTLTCTYSGFSSDIHAAWIRQAAGKGLEWITYRSSGSDTIAYSQSVRGRFTITRDNSRKQVYLQMSSLTTEDSAVYYCAR
Mchenga conophoros Vs1 trdv ABPJ01000536.1 1220 LTAGDSITPQQPEVTETEGESVKLTCSYETSESDVYLHWYRHHSDLQAPQFILWKGAKDNSGDEYIPDDRYGSETSPTSTNLTIAALTLADTALYYCALE
Mchenga conophoros Vs2 trgv ABPJ01001603.1 1051 EQLIQDDLTLTRRVGQSVSFSCGGINKCDYDFIFWYQKKENETFKVILDIDKTNGDIDKRYGHPQKDDFSAENKQNSCELKIEKVKRDHSATYYCSCDKRA
Mchenga conophoros Vs3 trav ABPJ01003911.1 995 VSCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEIVTPPSSSRLSVGVRKEETKMTLQISSAAVSDSAVYYCALQ
Mchenga conophoros Vs4 igkv ABPJ01004566.1 1349 SSAEIVLTQTPEAQSVVPGQTVSIRCKASSSMSNYLHWYLQKPSEAPKLLVYYATTRQSGVSDRFSGSGSGSDFTLTISGVQAEDAGVYYCGQSGYSRP
Mchenga conophoros Vs5 trav ABPJ01004744.1 853 LSIKALVQQSASETIQPGGSVTLNCTVHTGTCDGERSIYWFRKTEESQQTGLIYTHGGGNDQCERKTKTQTNTCVYTLPMNGLNLSHAGTYYCAVASC
Mchenga conophoros Vs6 igkv ABPJ01005172.1 1808 SRGQITVTQPGAVSSAVGGTVSIKCTTSQRVDSGNRLAWYQQKDGGVPKLLIYSASRRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Mchenga conophoros Vs7 igkv ABPJ01005247.1 1239 CSGQVTVTQPPVVTSTPGSTVTLTCRTSQDVYRDFEDDDYVFWYQQKSGQTPKLLIRYAKKLQSGTPTRFSGSGSSSDFSMTISGVQTEDAAVYYCQS
Mchenga conophoros Vs13 ighv ABPJ01011964.1 429 VDGQTLRESEPVIKRPGESHRLTCTASGFTFSSYRMVWVRQAPGKGLEWIAYISTSSSPIYYSQSVQGRFIISRDDSSSKLFLQMNSLKTEDTAVYYCARC
Mchenga conophoros Vs10 igkv ABPJ01007203.1 783 SRGQITVTQPGAVSSAVGATVSIKCRTSQDVYVSGSSHLLSWYQQKDGGVPKLLIKYASSRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Mchenga conophoros Vs37 igkv ABPJ01014534.1 1403 RETGLKNPALVHQSPSETIQPGGSVTLNCTVHTGTCDEEHSVYWFKETEASRPGLIYTYGGKNDYCRTKTNPQADACVYNLPMKDLNMSHAGTYYCAVDSC
Mchenga conophoros Vs30 ighv ABPJ01003822.1 459 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQKSGESLEWMGEGYTDSSSNKYVSSLRGRIEITKDNSNSMVHLRLSNLKPEDSAVYYCAK
Mchenga conophoros Vs31 trbv ABPJ01006614.1 2005 RTYGSYINQASMLWKNQGEDATLNCSHVMTIEFYQMYWYRQLPGEPMKQMVYTIPNAEPDFEPDFRDEKFSVTKPDARSGTLTVKNLVPGDQGLYFCAVS
Mchenga conophoros Vs32 trgv ABPJ01009534.1 667 LVTMAAQLIQNDLTSTKKAGEAASLKCTGFDQCDNNYMYWYMKKDRGSFTVIVRFDRIEKKTSKFTHHLKESFSAMSDKDDIVLLINKCSVEHSATYYCV
Mchenga conophoros Vs33 trbv ABPJ01010513.1 1208 GSSLSDQVHQSPANIYTKGEEAKIYCWHSNPSYETILWYKQSEKKLQLLGYTYYDNSYPEPGVNITMDGDARQHKNCTLTIKYLKLSSSAVYFCAAR
Mchenga conophoros Vs38 igkv ABPJ01026099.1 819 CSGQVTVTQPPVVTSAPGNTVTLTCRTSQDVYRDFEDDDYVFWYQQKSGQTPKLLIKWAKTLESGTPTRFSGSGSSSYFSMTISGVQTEDAAVYYCQS
Mchenga conophoros Vs35 ighv ABPJ01011365.1 1285 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISDSSTYIYYSPSVQGRFTISRDNSRKQVYLQMNSLTTEDSARYYCARD
Mchenga conophoros Vs34 igkv ABPJ01011102.1 814 SSAEIVLTQTPKAQSVVPGQTVSVRCKSSTSIGDDIDWYLQKSGKAPKLLIADTTERQSGVPDRFRATAVPTDFTLTISGVQAEDAGVYYCGQSGYSRP