WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Dipodomys ordii ABRO00000000.1 (ABRO01) 188 55 0 86 30 12 4 1
Dipodomys ordii ABRO00000000.2 (ABRO02) 267 48 0 153 38 22 4 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Dipodomys ordii V22 ighv ABRO01021712.1 2403 VQCEVQLVESGGGLVQPGGSLRLSCAASGFNFSSNYMSWIRQAPGKRPEWLSYISGDSSDIHYTDSVKGRFTISRDNSKNTLYLQMNRLRVEHTAVYYCDR
Dipodomys ordii V23 ighv ABRO01021713.1 904 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSRYTMHWLRQAPGKRPEWLSYISSGSSNINYADSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAMYYCA
Dipodomys ordii V24 ighv ABRO01021714.1 2593 VQCEVRLVESGGGLVQPGGSLRLSCAGSGFTFSSSYMDWVRQAPGKGLEWVAEIHPNGGSTWYPDSVKGRFTISRDNSKSTLHLQMNSLRVEDTAVYYCA
Dipodomys ordii V25 ighv ABRO01021715.1 82 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMNWIRQAPGKGLEWISYISYNSGTKYYTDSVKGRFTISRDNSKSTLYLQMNNLRVEDTAVYYCAR
Dipodomys ordii V26 ighv ABRO01021716.1 4924 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWLSSISSGSSYIYYADSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAVYYCA
Dipodomys ordii V27 ighv ABRO01021718.1 2975 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVAVIWYDGSQQKYVESVKGRFTISRDNSKNMLYLQMNSLKAEDTATYYCA
Dipodomys ordii V28 ighv ABRO01021720.1 201 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTNGVGVSWIRQPPGKTLEWLANVWWDDDKYYNPALKSRLSISKDSSNSQVFLTLASVDSADTATYYCAR
Dipodomys ordii V29 ighv ABRO01021723.1 3412 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVHQAPGKGLEWLSYFYDSSNTYYADSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYLCA
Dipodomys ordii V30 ighv ABRO01021726.1 1061 VHSQVQLEQPGAEVWRPGDLVRLACKASRYTFTSYYMHWVRQKAGQGLEWIGRIDPRDGETIYAQKIQGKVSLTADTSSSTASMELSRLTAEDSAMYYCM
Dipodomys ordii V31 ighv ABRO01021731.1 1093 VQCEVQLVESEGILVQPGGSLRLSCAASEFTFCTYCMGWSRQAPGKGLEWVARMDPGGGSTRYPDSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYHCA
Dipodomys ordii V32 ighv ABRO01021734.1 622 VHSQVQLEQPGAEVRRPGDSVRLACKASGYTFTSYYMHWVRQKAGQGLEWIGSIDPSDGETKYAQKVQGKVSLTADTSSSTASMELSRLTAEDSAMYYCARQC
Dipodomys ordii V33 ighv ABRO01021753.1 961 VQCEVQLMESGGGLVQPGRSLRLSCAVSGFTFSNYWMSWIRQAPGKGLEWVARINTTGGSTWYPDSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAIYYCPR
Dipodomys ordii V34 ighv ABRO01021754.1 1113 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMSWIRQAPGKRPEWLGEINPGGSGTNYPDSVKGRFTISRDNSKNTLYLQMNSLRVEDTALYYCAR
Dipodomys ordii V35 ighv ABRO01021754.1 6421 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSSYYMHWVRQAPGKGLEWVARIDPYSGSTYYPDSVKGRFTISRDNSKSTLYLQMSSLRTEDTAMYYCAR
Dipodomys ordii V36 ighv ABRO01021755.1 1214 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVLQAPRKGLEWVGYIRKKANGHTTEYAASVKGRFTVSRDDSKSMTYLQMNSLQVEDTAMYYCAR
Dipodomys ordii V37 ighv ABRO01021756.1 2145 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSGYWMTWICQAPGKRPEWLGEINQGGSSTNYPDSVKGRFTISSKNTLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V38 ighv ABRO01021758.1 5387 VQCEVQLVESGGGLVQHGGSLRLSCTASGFDFSDYYMHWIRQAPGKRPQWLSYISGDSSDPEYADSVKDRFTISRDNSKSTFYLQMNSLRVEDSAIYYCT
Dipodomys ordii V39 ighv ABRO01021760.1 437 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSRYDMSWIRQAPGKGLEWLSSIYGSSSTYYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V40 ighv ABRO01021763.1 4651 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTNGVGVSWIRQPPGKTLEWLANVWWDDDKYYNPALKSRLSISKDSSNSQVFLTLASVDSADTATYYCAR
Dipodomys ordii V44 trav ABRO01028705.1 4053 VSGNQVEQSPPALLLQEGENSTLQCNFSNTVTIVQWFQQHPRVGLLSLFYLASGTKHNGRLVATIDTRERRSLLYISSAQNTDSATYFCAVR
Dipodomys ordii V49 igkv ABRO01039125.1 3211 TRCGIQMTQSPSTVFASPRDRVTIKCQACQDISNQFSWYQQKPGKAPKLLIYAANSLQSRIPSGFSGNGRGTEFTLTISSLQPEDVASYFCMHDY
Dipodomys ordii V50 igkv ABRO01039129.1 4733 SSEDVILTQTPLSLPVTMREPVSIFCRSSQSLLYSDGNTYLYWFLQKPGQYPEALIYLVSNQYSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V60 igkv ABRO01048339.1 363 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIGYGLAWYQQQPGKAPKLLIYGADILESGVPSRFSGSQSGTEFTLKISGLEPEDVATYYCQQGYSNP
Dipodomys ordii V61 igkv ABRO01048342.1 473 AKCDIQMTQSPSSLSVSLRDTATITCRASEDIGYALAWYQQQPGKAPKALIYSANSLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQYRSFP
Dipodomys ordii V62 igkv ABRO01048353.1 1256 TRCDIQMTQSPSTLSASPGDRVSITCRASQGISNGLSWYQQKPGGAPKLLIYGANNLQSGIPSRYSGSGSGTEFTLTISSLQPEDIATYYCQQYYNI
Dipodomys ordii V64 igkv ABRO01054739.1 18147 ARCDIQMTQSPPSLSVSPGDRVTITCHASENNYNNLHWYQQKPGEAPKLLISYVSNLQPGVPPRFSSSGYGTEFTLTISSLQPEDVATYYCQQSTSYP
Dipodomys ordii V88 igkv ABRO01111221.1 2560 ARCDIQLTQPPFLSSSQGDRVTITCRASEGISTSLHWYQQRAGKAPKLLISYATTLQSGFPPRFSGSGSGTEFTLAISNLQPEDAATYFCQHSDSLP
Dipodomys ordii V89 igkv ABRO01111222.1 9796 ALSDIQMTQSPSSLSVSLGDTAPITCRASEDIGYALAWHQQQPGKAPKSLIYSADSLESGVPPKFSGSGHGTEFTLTISSLQPEDVATYYCQQAFSIP
Dipodomys ordii V90 igkv ABRO01111224.1 1649 SSGDVVLTQTPRSLPVTLGETASISCRSSQSLLHGDGNTYLYWFLQKPGQPLHRLIYLVSKRGSVVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCFQGTYLP
Dipodomys ordii V91 igkv ABRO01111227.1 4633 TRCEIQMAQSLSSLSLSLGNNANFICRASESNDYSLAWYQEKPGKAPKLLIYAADSWLSGVPSRFSGDGYGTEFTLTISSLQPEDVAPYYCQKITLLL
Dipodomys ordii V94 trav ABRO01116758.1 692 LHGKDEVEQSPESLSLQEGGSGSLNCSYTTSNFGGLLWYRQDAGRGPTFLFILYSDGDAKQTDRLRATLSKKRSVLHITTANPEDSATYLCAVY
Dipodomys ordii V95 trav ABRO01116760.1 1214 VRGIQVEQSPPALLLQEGENATLQCNFSNAVNNVQWFCQYPRGHLINLFYIASGTKHNGRLTATIINRERRTLLYISSAQSTDSATYFCAVR
Dipodomys ordii V97 igkv ABRO01117422.1 3727 SSGDVVMTQTPRSLLVTLGEPASISCRSSQSLLYSNGNTHLSWYMQKPGQSPHQLIYLVSKRDSGVPDRFSGSGSGTDFTLTIIRVEAEDLGVYYCLQR
Dipodomys ordii V98 igkv ABRO01117428.1 4854 TNCDILMTQSPSSLSASVGDRVSITCKASQGISDNLQWYQQKPGKAPTLLIYWANRLVSGVPSRFSGSQSGMEFTLTISSLQPEDFATYYCQQSNSYP
Dipodomys ordii V99 igkv ABRO01117430.1 2592 ARCGIQMTQSPPTLSASVGGTATITCRASGNIYSNLAWYQQKLGKAPKLLIYDSSTLASGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQQYSNSP
Dipodomys ordii V121 trav ABRO01158741.1 7043 IMTDAKTTQPDSMEWTEGEPARLPCNHSTIGGNEYIYWYRQITFQGPEYIIHGLKSNITNRMASLAIPADRKSSTLILPHVNVKDTAVYYCILRD
Dipodomys ordii V125 trbv ABRO01165996.1 1164 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHDTVYWYQQAEDKTLHYLISYYRELEREKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V126 trbv ABRO01165997.1 1464 HTESGVSQSPRHRVTKRGQTVLLRCDPISGHQRLYWYRQTPGQGLEYLTHFQYEVAAEKPEMPVERFSAQRPNGSFSTLKMQPAEQGDSALYLCASCQ
Dipodomys ordii V127 trbv ABRO01165997.1 4966 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHDAVYWYQQAEDKTLQFLVSYFGESELEKGSIPGRFSAQQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V128 trbv ABRO01165999.1 613 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHDAVYWYQQAEDKTLQFLIFYFEESERDKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V129 trbv ABRO01166004.1 423 LTEAGVTQSPRYKVTEKSQAVSLWCDTVSGHNALFWYRQTLGQGQERLLYFQNQAMSEDAQLPKDRFSAQRPEGADSTLKIQPAQLEDSAVYLCASSL
Dipodomys ordii V130 trbv ABRO01166004.1 2953 HTDSGVSQSPRHKVTKRGHTVLLKCNPISGHGCLYWYRQTPGQGLEYLTHFQYEVAAEKPEMPVERFSAQRPNGSVWTLKMQPAEQGDSALYLCASCQ
Dipodomys ordii V131 trbv ABRO01166005.1 881 LTEAGVTQSPRYKVTEKSQAVSLWCDPVSGHNALFWYRQTPEQGPERLLYFQNKAMSEDAQLPKDRFSAQRPEGADSTLKIQPAQLEDSAVYLCASSL
Dipodomys ordii V137 trav ABRO01170827.1 387 VSGKTKVEQSPWIQKVLEGENCTLQCNYTVSPFNNLRWYKQDTEKGPVSLIRMNYTESKKSNGRYTATLHSESKQSYLHITASQLSDTASYICVV
Dipodomys ordii V138 trav ABRO01170829.1 602 TSMAQKVTQAQTSVWVVEKEAVTLDCLYETGESYYSIFWYKQPLAGKLILLVRQNSYDKQNATEDRYFLNFQKSSRYINLTITGTQLEDSAVYFCALIE
Dipodomys ordii V155 igkv ABRO01196177.1 2552 IIMTQTPLSLPVTLGETVSLSCRSSQSLLYSDGDSLLSWFLQRPGQSPQRLIYWATNRGSGVPDRFSGSGSGTDFTLQISRLQGEDIGVYYCMQGYTP
Dipodomys ordii V156 igkv ABRO01196184.1 590 SSGDIVMTQTPLSIAVTLGETVSLSCRSSQSLIDSDGDILLYWYLQKPGQSPKLLIYWASNRASGVPERFSGSGSGTDFTLQISRVEAEDIGVYYCMQDIDTP
Dipodomys ordii V158 igkv ABRO01200611.1 3210 SSGDVVLTQCPSFLPVILGESVSISCRSSQSLLHSNGRTYLDWCLQKPGQSPQVLIYEVSNKYSGIPDRLSGSGAITDFTLKISRVQAEDVGVYYCLQR
Dipodomys ordii V159 igkv ABRO01200612.1 2760 TNCDILMTQSPSSLSASVGDRVSITCKASQGISNVLQWYQQKPGKAPKLLIYWANNLVSGVPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSYP
Dipodomys ordii V164 trav ABRO01203486.1 9561 MSGQHLNQSPQFLSIQEGQDVSMNCSYSNTFNTMLWYKQGPGESLVLLLALYKTGEFIRNGKLTAQFSETRKDSFLTLSASSPGDTGTYLCAG
Dipodomys ordii V175 igkv ABRO01217697.1 5882 ARCDIQMTQSPSSLSASPGDTVTISCKASQGISNCLNWYQQKPGKAPKPLIYYTSRLVSGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQKCDS
Dipodomys ordii V176 igkv ABRO01221504.1 4471 ARCDIQMTQSPSSLSASPGETVTISCKGSQDISNYLAWYQQKPGNAPKLLISYATSLASGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQQHINYP
Dipodomys ordii V177 igkv ABRO01221504.1 8642 ARCDIQMTQSPSSLSASPGDTVTINCRASQGISNYLNWYQQKPEKSPKPLIFYTSNLASGVPSRFSGSGSGTGYSLTISNLQPEDFATYYCQQYDSI
Dipodomys ordii V178 igkv ABRO01221506.1 7668 FRCDIQMTQSPSFLSASPGDRVSITCRASQGISNDLHWYQQKPGNAPKLLIYYVKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQSNSFP
Dipodomys ordii V183 igkv ABRO01239801.1 6713 ARCDIQMSQSPSALSASPGDTITISCKASQGISRVLNWYQQKPGNAPKLLIYYTSNLASGVPSRFSGSGYETDYTLTISSLQPEDFATYYCQQCINYP
Dipodomys ordii V184 igkv ABRO01240577.1 1199 ACGDIVLTQSPSSLAVSAGERVTINCESSQSLLSGSYNSLAWYQQKWGEAPKLLIYGASTRASGIPDRFIGSGSRTDFTLIITGIWAEDVADYYCQQDYSYP
Dipodomys ordii V185 igkv ABRO01240579.1 6633 ACGDIVLTQSPSSLAVSAGDRVTINCESSQSLLSGGNNYLAWYQQKWGEAPKMLVYLAHTWASGVPDRFIGSGSGTDFTLTISNIEEEDTADYYCQQDYSYP
Dipodomys ordii V187 trav ABRO01244172.1 4408 LSQGEKVEQSSSVLSVQEGDTCVINCTYTDSTFSYFPWYKQEPGQGPQLIIDIRSNRDRNENGKLLVLLKKNDKHLSLLIKDIQPGDSAVYYCAAS
Dipodomys ordii V188 trav ABRO01244174.1 1634 RTCGDSVTQKESHVTVSEGASMTIDCTYSATGYPSLFWYVQYPGEGPQLLFRVSKANDKGSYNGFEAMYNRENTSFHLKKAAVLESDSALYYCALN
Dipodomys ordii V189 trav ABRO01244174.1 4951 VSGKTKVEQSPWIQKVLEGENCTLQCNYTVSPFNNLRWYKQDTEKGPVSLIRMNYTESKKSNGRYTATLHSESKQSYLHITASQLSDTASYICVV
Dipodomys ordii V197 igkv ABRO01258592.1 1110 ARCDIQMTQSPSTLSASVGGTATITCRASGNIYSNLAWYQQKLGKAPKLLIYASSALASGVPSRFSGSGYGTEFTLTISSLQPEDVATYYCQHFYGVP
Dipodomys ordii V199 igkv ABRO01261482.1 4629 ARCDIQLTQPPSLSSSQGDRVTITCRASQGISKSLPWYQQIAGKAPKLLISYATPLQSGFPPRFSGSGSGTEFTLAISNLQPEDAATYFCQQRDSLP
Dipodomys ordii V201 trav ABRO01262159.1 7018 LHGKDEVEQSPESLSLQEGGSGSLNCSYTTSNFRGLLWYRQDAERGLTFLFSLYSAGDAKQKDRLGATLSKKGSFLHITSANLEDSATYLCAVY
Dipodomys ordii V205 ighv ABRO01265707.1 3674 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGNYWMSWIRQAPGKRPEWLGEINQGGSSTYYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V206 ighv ABRO01265707.1 7076 VQCEVRLVESGGGLVQPGRSLRLSCAASGFDFSSYGMNWVRQAPGKGLEWVAVIWYDGSQQKYMESVKGRFTISRDNSKNMLYLQMNSLKAEDTATYYCA
Dipodomys ordii V207 ighv ABRO01265710.1 3401 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVAVIWYDGSQQKYVESVKGRFTISRDNSKNMLYLQMNSLKAEDTATYYCA
Dipodomys ordii V211 trav ABRO01269750.1 2383 RTCGISVTQKESRISVLEGASMTIDCTYTATGYTYLFWYVQYPGDGLQLLLKAITANEKGSYKGFEARYDRENTSFHLKKAAVLESDSAVYYCAVS
Dipodomys ordii V217 igkv ABRO01283455.1 186 ARCDIQMTQSPSFLSASPGDRVSMSCRASQDISNYLNWYQQTPGKAPKLLIYAAEYLSSGIPSRFSGSRSGKEFTLTISSLQPEDAGIYYCQHYYGTF
Dipodomys ordii V220 igkv ABRO01288718.1 248 SSGDVVMTQTPRSLPVTLGEPASISCRSSQSLLYSNGNTYLNWFMQKPGQSPHRLIYLVSKRDSGVSDRFSGSGSSTDFTLTISRVEAEDVGVYYCMQA
Dipodomys ordii V224 ighv ABRO01295101.1 1674 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYYMDWVHQAPGKGLEWVAKIYKDGGSTWYPDSVKCRFTISRDNSKNTVYLQMNSLRVEDTAVYYCTR
Dipodomys ordii V232 igkv ABRO01315332.1 753 SAGVAMLTQTPLSLPVTLGDQASISCRSSESLLYSNGKTYLYWFVQKPGQSPQRLIYWVSNRETGVPDRFSGSGSVTDFTLTISRVESEDIGVYYCFQD
Dipodomys ordii V235 igkv ABRO01317430.1 4501 YNGDVVMTQTPRSLPVTLGEPASISCRSSQSLLYSDGNTYLYWFLQKPGQSPHRLIYLVSKQDSGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQA
Dipodomys ordii V241 igkv ABRO01325887.1 735 SSGDVVMMQTPLTLSINPEEPASISCKSSESLLHSDGNTYLYWYLQKPGQSPQLLIYKGSNRFTGVSDRFSGSGSGTDFTLKISRVKPEDAGVYYCSKYKIP
Dipodomys ordii V242 igkv ABRO01327313.1 2852 ARCDIQMTQSPSSLSASPVTISCRASQDISNYLAWYQQKPGNAPKLLISYATSLASVVPSRFSGSGFRPNYSLTISSFQPENFATYYCQQHMSYP
Dipodomys ordii V243 igkv ABRO01327313.1 7048 ARCDIQMTQSSSSLSASPGDTVTISCRASQSISNYLAWYQQKPGKAPKLLIYYTSSLASGVPSRFSGSGSGTDYSLTISSLQTEDFATYFCQQYASRP
Dipodomys ordii V245 trav ABRO01328249.1 654 GITAQGVAQPEDHISVFEGAHVQVKCNYSYSGSPVLFWYIQHPGQGLQLLLKHISGGSAKGFTATLNKSEKSFHLQKARTQEDDSAMYYCALS
Dipodomys ordii V246 trav ABRO01328250.1 705 VNSQQEEKTQTLSIQQGENATVNCSYKSDIITLQWYRQDSGRGPTMLILIRSNERERSSGRLRITLDTSARSSSLSILTSQTADTAAYFCATD
Dipodomys ordii V247 igkv ABRO01329684.1 2829 SNGDVVMTQTPLSLLVTLGEPASISCRSSQSLLYSDGNTYFYWFLQKPGQSLHRLIYLVSKRGSGVPDRFSSSGSGSDFTLTISRVEAEDVGVYYCFQG
Dipodomys ordii V251 ighv ABRO01332694.1 1132 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSSYWMSWVRQAPGKGLEWISSIYDNSNIYYADSMKGRFTTSRDNSKSTLYLQMNSLRVEDTAMYYCT
Dipodomys ordii V255 ighv ABRO01336936.1 1390 VQWEVQLVESGGGLVQPGGSLRLSCAASFSNYWMSWVPQVPGKGLYWISSIYGSSNIYYADSVKGCFTTSRQNSTNILYQQMNSLRVEDTAIYYCA
Dipodomys ordii V257 trav ABRO01345529.1 2444 RSSGDSVTQTEDLVTLTEGAPLILNCTYQSTYSIAFIFWYIQYLNKAPQLLLKSSTQSPRSENRGFQATLVKSDNSFHLQKSSLQLSDSALYFCALG
Dipodomys ordii V261 trav ABRO01357582.1 563 LRGLQVEQSPSVQRLQDGASSTLRCNFSTTVYNVQWFRQNPGGGLLSLFFMTPGTKQKGRLQSTLDSKERYSSLHISASQLEDSGTYLCAAEAQCSQ
Dipodomys ordii V262 trav ABRO01361261.1 6562 VSGIAEVIQSPPSLVIHEGDNTTFNCSYEVKNFQNLQWYKQEEKAPSFLLKLISSGIDKKQGRLSGTLNKKELLSTLHITAAHIGDSATYLCAVE
Dipodomys ordii V264 igkv ABRO01362636.1 1638 FRCDIQMTQSPSFLSASPGDRVSLTCRASQGISYYLNWYQQKPGNAPKVLIYNAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHNSLP
Dipodomys ordii V265 igkv ABRO01362694.1 1423 APCDIQMTQSPSSLSVSLGDTATITCRASEDIGYALAWHQQQPGKAPKSLIYSADSLESGVPPRFSGSGHGTEFTLTISSLQPEDVATYYCQQAFSTP
Dipodomys ordii V268 trav ABRO01368456.1 999 KSSGDSVTQTEGSVTFTEGATLILNCTYQSTYSNVFIFWYVQYLNKAPQLLLKSSTQSLRSENRGFQATLVKSDNSFHLQKSSLQLSDSALYFCALG
Dipodomys ordii V269 igkv ABRO01369161.1 3699 SSADIMMTQTPPSLIVAPEEPASISCKSSESLLHSDGNTYLHWYLQKPRQSPQLLIYKVSNRFTGVPDRFSGSGSVTDFPLTISRVKPEDAGVYYCQQETKLP
Dipodomys ordii V271 trav ABRO01370656.1 3987 VSSQQKEVEQHPESCSVPEGATASLNCTYRDSGSQNFRWYRQYSGKGPELLVSAYSNGDRDEGRFTVHLNRASLYLSLHIRSSQLSDSATYFCAVS
Dipodomys ordii V272 igkv ABRO01374964.1 614 AKCDIQMTQTPSSLSASPGDTVTINCRSSQGINKYLVWFQQKPGKAPKRLIYKASNLGSGVPSRFSGSGSGTDYSLTISRLQAEDFATYYCMQYDEFP
Dipodomys ordii V273 igkv ABRO01376829.1 486 ARCGIQMTQSPSTLSASVGGTATITCRASGNIYGNLAWYQQKLGKAPKLLIYSSSNLVSGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQHYYGY
Dipodomys ordii V274 ighv ABRO01378149.1 2636 VQCEVELVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVCQAPGKGLEWISYISFSGTKYYADSMKGRFTTSRDNIKNTLYLQMNSLRVEDTATYYCA
Dipodomys ordii V277 trav ABRO01385982.1 2222 LSQGEKVEQSPSVLNMQEGDTSVINCTYTDSASVYFPWYKQEPGQGPQLIIDIRSNRDRIENGKLLVLLKKNDKHLSLHIKDTQPGDSAVYYCAAS
Dipodomys ordii V278 ighv ABRO01389178.1 4664 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTVSGYYMSWVRQAPGKGLEWISSIYGSSSTYYADSVKGRFTISTDNSKSTIYLQMNSLRVEDTAIYYCAR
Dipodomys ordii V279 trav ABRO01389409.1 351 VSQGEKLEQGPSILSMQEGDSCVINCTYSDSASDYFVWYKQEPGQGLQLIINIRSNRDKIENEKFLVFLKKKDKHFSLHIKDAQPGDSAVYFCAAR
Dipodomys ordii V282 ighv ABRO01394565.1 1724 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSISGYYMNWVRQAPGKGLEWVSLIRLKANSYTTEYATSVKGRFTISRDDGKSMLYLQMNSLRAEDTATYYCT
Dipodomys ordii V285 igkv ABRO01400712.1 1031 SCGDIVMTQTPPLLSINPEEPASISCKSSESPLYSDGNTYLNWYLQKPGQSPQPLIYTVSNRFTGVPDRISGSGSGMDFTLTISRVKPEDEGVYYCQQSSKY
Dipodomys ordii V291 igkv ABRO01415526.1 1410 FICDIQMTQSPSFLSASPGDRVSITCHASQGISNDLQWYQQKPGNAPKLLIYNANSLFFGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQVINIL
Dipodomys ordii V294 igkv ABRO01421767.1 1469 FKCDIQMTQSPSFLSASPGDRVSITCRASQGINYYLHWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQSSSYP
Dipodomys ordii V295 igkv ABRO01422077.1 1460 SCGDIVMTQTPPSLSINPEEPASISCKSSESLLHSNGNTYLYWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLTISRVKPEDAGVYYCLQSI
Dipodomys ordii V297 ighv ABRO01425993.1 1681 VQCEVQLVESGGGLVQHGGSLRLSCTASGFDFSDYYMHWIRQAPGKRPQWLSYISGDSSDPEYADSVKDRFTISRDNRKSTFYLQMNSLRVEDSAIYYCT
Dipodomys ordii V302 trav ABRO01427705.1 1154 VNSQQKEVEQHPESLSVPEGATASLNCTYKNSGFQYFVWYRQYSGKGPELLMSTSSNGDKHKGRFTAHLNRASLYLSLQIRDSQLSDSATYLCAVS
Dipodomys ordii V304 ighv ABRO01430178.1 1727 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSSYWMSWVRQAPGKGLEWISSIYDNSNIYYADSMKGRFTTSRDNSKSTLYLQMNSLRVEDTAMYYCT
Dipodomys ordii V306 trav ABRO01433801.1 516 VNSQQGEEKTHTLSIQPGENATMNCSYKSSITVLQWYRQDSGRGPTMLILIMSNEREKISGRLRLTVHTSARSSSLSILTSQPEDTAVYFCATD
Dipodomys ordii V309 ighv ABRO01444072.1 691 AAGGVWRRLGAAWGVPETLCTASGFTFSDYYMSWIRQSPGKGLEWVGFIRNKANGHTTEYAASVKGRFTISRDDSKSMTFLQMNSLKVEDTAVYYCTR
Dipodomys ordii V310 igkv ABRO01446184.1 1087 AKCDIQMTQSPSSLSVSLGDTATITCRGSENIRYALAWYQQQPGKAPKLLIYRADILESGVPSRFSGSKSGTEFTLTISGLEPEDVATYYCQQGYSNP
Dipodomys ordii V312 ighv ABRO01449608.1 733 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTNGVGVSWIRQPPGKTLEWLANVWWDDDKYYNPALKSRLSISKDSSNSQVFLTLASVDSADTATYYCAR
Dipodomys ordii V316 igkv ABRO01454265.1 639 AKCDIQMTQTPSSLSASPGDTVTINCRASQGINKYLAWFQQKPGKAPKQLIYRASNLESGVPSRFSGSGSGTDYSFTISSLQAEDFATYYCMQYDELP
Dipodomys ordii V317 ighv ABRO01457997.1 1706 AQCEVLLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWIRQSPGKGLEWVGFIRNKANGHTTEYAASVKGRFTISRDDSKSMTFVQMNSLKVEDTAVYYCTR
Dipodomys ordii V318 ighv ABRO01459379.1 1250 VQCEVRLVESGGGLVQPGGSLRLSCVASGFTFSRYGMNWVRQAPAKRLEWVSSIYGDNSYIKYADSVKGLFTISTDNSKNTLYLQMNSLRVEDTATYYCAR
Dipodomys ordii V319 ighv ABRO01461745.1 2120 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYGLNWVRQAPGKGLEWLSYIYGSSSTYYADSVKGRFTTSRDNSKSTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V321 ighv ABRO01473849.1 1194 VQCEVQLVESGGGLVQPGGSLRLSCMASGFTFSRYGMNWVRQAPAKRLEWVSSIYGDNSYIKYADSVKGRFTISIDNSKSTLYLQMNSLRVEDTAIYYCAR
Dipodomys ordii V325 ighv ABRO01494111.1 1077 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTVSGYYMSWVRQAPGKGLEWISSIYGSSSTYYADSVKGRFTISTDNSKNILYLQMNSLRVEDTAVYYCA
Dipodomys ordii V326 igkv ABRO01494563.1 773 FSGDAILTQTPLSVPVTMREPVSIFCRSSQSLLYSDGNTYLYWFLQKPGQSPQALIYLVSNQYSGVPDRFSGSGSRKDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V327 ighv ABRO01497268.1 876 VQCEVRLVESGGGLVQPGGSLRPSCAASGFTFSDYYMHWVRQAPGKGLEWLSYFYDSSNTYYADSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYLCA
Dipodomys ordii V328 ighv ABRO01498473.1 665 VQCEVQLVESGGGLVQPGRSLRLSCAASGFDFSRNYMSWIRQAPGKRPEWLSYISGSSSDIHYTDSVKGRFTISRDNSKNTLYLQMNSLRVEDTALYYCAR
Dipodomys ordii V332 trav ABRO01520091.1 1148 VSSQQKEVEQHPESLSVPEGATASLNCTYKNSAYQYFRWYRQYSGKGPELLASTYSNGDKDEGRFTVHLNKASLYLSLQIRNAQLSDPATYLCAMS
Dipodomys ordii V339 igkv ABRO01004681.1 1296 AKCDIQMTQSPSSLSVSLRDTATITCRASKGIGYYLAWYQQQPGKAPKLLIYGTNGLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQYSNFP
Dipodomys ordii V340 igkv ABRO01004682.1 1823 AKCDIQMTQSPSSLSVSLRDTATITCRASKGIGYYLAWYQQQPGKAPKLLIYGTNGLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQYSNFP
Dipodomys ordii V341 igkv ABRO01004796.1 3147 TRCDIQVTQSPSTLSASPGDRVTIKCQASQGVSNELSWYQQKPGKAPKLLIYAANSLQSGIPSRFSGSGRGTEFTLTISSLQPEDVASYFCMHDYNLL
Dipodomys ordii V363 igkv ABRO01040920.1 1334 ARCEIQMAQSLSSLSLSLGDNATFTCRASENIDYSLAWYQQKPGKAPKLLIYAADTLLSGVPSWFSGDGYGTEFTLTISNLQPEDVASYYCQKVTLLL
Dipodomys ordii V366 igkv ABRO01049643.1 328 FRCDIQMTQSPSFLSASPGDRVSLTCRASQGISYYLNWYQQKPGNAPKLLIYHAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSSP
Dipodomys ordii V367 igkv ABRO01049644.1 8534 VRCDIQMTQSPPFMSVSPGDTVTISCRASQGISNLNWFQQKPGKTPKLLIYYTSRLASGVPSRLSGSGSGTDYSLTISSLQPEDFATYYCQKYASR
Dipodomys ordii V368 igkv ABRO01049649.1 1851 FRCDIQMTQSPSFLSASPGDRVSINCHASQAISNDVQWYQQKPGNAPKLLIYNVNSLFFGIPSRFSGSQSGTEFTLTISSLQHEDFATYYCQQESSYP
Dipodomys ordii V369 igkv ABRO01049653.1 1591 ATCDIQMTQSPSILSASPGDRVSITCQASQGISNVLNWYQQKPENAPNLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSFP
Dipodomys ordii V370 igkv ABRO01049658.1 1358 ARCDIQMNQSPSSLSASPGDTVTISCKSSQGISNYLNWYQQKPGKAPKPLIYYTSRLASGVPSRFSGSRSGTDYSLTISSLQPEDFATYYCQKCDSM
Dipodomys ordii V382 trdv ABRO01070713.1 5995 KGMLCNQVTQSSLDQTVISDSKITLFCTYNATDADLALYWYRKRADQSFQFILYRVNSLSHYADFTEGRFSVRRSQTHKTFHLVISQVRTEDSATYYCVFG
Dipodomys ordii V391 igkv ABRO01081167.1 5894 TRCDIQMTQSPSTLSASPGDTVTIKCQASQYISNELNWYQKKPGKAPKLLIYGANRLQFGIPSRFSGSGLGTEFTLTISSLQPEDIATYYCQQHYDN
Dipodomys ordii V392 igkv ABRO01081168.1 2099 SSGDIVMTQTPLSLPVTLGETVSLSCRSSQSLIDSDGDSLLYWYLQKPGQSPKLLIYWASKRPSGVPERFSGSGSGTDFTLQISRVEAEDIGVYYCMQGIDTP
Dipodomys ordii V422 igkv ABRO01132571.1 8935 AKCDVQLTQLPSMSASLGERVSISCRASQDTSNDLHWYQQKPGNAPKLLIYFATGLQSGFLSRFSGSQSGTEFTLTINSLQPEDVATYYCEQSNSYP
Dipodomys ordii V431 igkv ABRO01147583.1 500 SNGDVVMTQTPVSLPVTMGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQSPRFLIYQVSNRVSGVPDRFTGSGSGRDFTLRISRVETEDVGVYYCFQA
Dipodomys ordii V433 igkv ABRO01155360.1 3307 LKIGNAITQSPASLSVHPGERVTITCQTNPKENIKFSWYKQPPGRIPKPLVYDTSTRVPGVPERFSGSRSGTAFTLSISNVETNDTGSYFCLEWPG
Dipodomys ordii V445 igkv ABRO01170632.1 11911 ARCDIQMTQTPSSLSASPGDTVTINCRASQNINKYLAWFQQKHGKPPKRLIYGTSNLDSAFPSRFSGSGSGTDYSLTISSLQPEDGATYFCTQGYSYP
Dipodomys ordii V446 igkv ABRO01170632.1 3459 AKCDIQMTQTPSSLSASPGDTVTINCRASQGISSWLAWFQQKPGKAPKRLIYKASNLGSGVPSRFSGSGSGTDYSLTISSLQAEDFATYYCMQYDKFP
Dipodomys ordii V447 igkv ABRO01170969.1 3654 ARGDIQMTQSPSSLSAFQGDTVTISCRTSQSISNYLNWYQQKPQKSPKPLIYNSSRMAIGISSTGFMTDYSLTISSLQPEDFATYYCQQYASR
Dipodomys ordii V448 igkv ABRO01170973.1 3398 FRCDVQMTQSPSFLSASPGDRVSITCLASQGINYYLNWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSLP
Dipodomys ordii V449 igkv ABRO01170975.1 1873 FRCDIQMTQSPSFLSASPGDRVSITCRASQGISNYLHWYQQKPGNAPKLLISFAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQDYSFP
Dipodomys ordii V463 igkv ABRO01195310.1 4112 FRCDVQMTQSPSFLSASPGDRVSITCRASQGINYYLNWYQQKPGNATKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSLP
Dipodomys ordii V468 igkv ABRO01199887.1 3506 FRCDIQMTQSPSFLSASPGDRVSTTCHASQHISSDLHWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLISSSLQPEDFATYYCQQSNSLP
Dipodomys ordii V469 igkv ABRO01199892.1 5355 FRCDIQMTQSPSFLSASPEDRVSITCRASQGISNDLNWYQQKPGNAPKLLIYYANSLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHYSFP
Dipodomys ordii V480 igkv ABRO01210909.1 2119 TRCDIQMTQSPSTLSASPGDRVTITCRASQGINYALHWYQQKPGGAPKLLIYGADNLQSGIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQYYNN
Dipodomys ordii V484 igkv ABRO01215545.1 872 ASCDIQMTQSQSSLSASLGDSVSITCRASQGISSWLAWYQQKPGKAPKLLIYGASNLATGVPSRFSGSGSGTEFTLTISSLQQDDIAIYYCQQYSSLP
Dipodomys ordii V485 igkv ABRO01215548.1 7341 ARCAIQTDPQSPPSLSASPGDRVSLTCRSSQNIYNRLSWYQQKPGESPKILIYGTNNLESGIPSRFSGSGSGTDYSLTINSLQPEDVATYYCQHSYGY
Dipodomys ordii V487 igkv ABRO01223504.1 3708 SSADIVMTQTPHSLMVAPEEPVSVSCKSSESLLHTYGNTYLHWYLQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLTISRVKPEDAGVYYCQQETKRP
Dipodomys ordii V488 igkv ABRO01223509.1 877 SSADIMMTQTPPSLIVAPEEPASISCKSSESLLHSDGNTYLHWYLQKPGQSPQLLIYRVSNRFTGVPDRCSGSGSGTDFTLTISKVKPEDAGVYYCQQ
Dipodomys ordii V489 trav ABRO01224805.1 1958 GSNGESVTQTQGQVALLEGASLTVNCSYETKGYPTLFWYVQYPGEGLQLLIKVAKANEMGGHKGFEAMSDEENTSFHLKKATVLVSDSAVYYCALR
Dipodomys ordii V500 trav ABRO01246320.1 5485 RSNGDSVTQTQGQVALLEGASLTVNCSYETKQYPTLFWYVQYPGEGLQLLIKVAKANEMGSHKGFEAMYDKESTSFHLKKATVLVSDSAVYYCALR
Dipodomys ordii V506 igkv ABRO01251778.1 4446 SSGDVVMTQTPSSLPVTLGQLASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQPLIYLVSKRASGVPDRFSGSGSGTDFTLTISRVEAEDAGVYYCLQS
Dipodomys ordii V511 ighv ABRO01261394.1 9182 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSNYMNWVRQAPGKGLEWVAQIHPNGGSTWYPDSVKGRFTISRDNSKNTLHLQMNSLRVEDTAVYYCA
Dipodomys ordii V512 ighv ABRO01261394.1 5728 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVAQIHPNGGSTWYPDSVKGRFTISRDNGKSTLYLQMNSLRVEDTAVYYCT
Dipodomys ordii V513 ighv ABRO01261394.1 1959 VQCEVRLVESGRGLVQPGGSLRLSCAASGFTFSDYYMDWIRQAPGKGLEWVARIDPGGGSTRYADSVKGRFTLCRDNSQSTLYLQMSSLRTEDTALYHCA
Dipodomys ordii V514 ighv ABRO01261395.1 815 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFRSYYMNWLCQAPGKRPEWLSYINSDSSYIKYAECVKGRFTTSRDNSKNTLYLQINSLRVEDTAIYYCAT
Dipodomys ordii V519 trgv ABRO01269086.1 1044 TSGDLVPHITKKAGATAFLECQMKVARAKEKAYIHWYQQKPGQPLRRILCISSNDNVIYEEGISEERYEAKRWLSDLSSSLRIHHLTEEDTGMYFCACWD
Dipodomys ordii V520 trgv ABRO01269088.1 10377 GLGHLEQPEIIVSRATDGSAQVPCKASFSSFRSVAIHWYRQKPGQSLEYLLYVIYTSSQRSLDGKNKKFEASKNFSTSTATLTINFLKTEDEATYYCSHG
Dipodomys ordii V521 trgv ABRO01269088.1 5752 GLGYLEQPEISVSRATDGSAQVPCKASISSFRSVAIHWYRQKPGQSLEHLLYVIYTSTQQSLDGKDRKFEASKNFSTSTTTLTINFLKREDEATYYCSYG
Dipodomys ordii V522 trgv ABRO01269088.1 886 GLGYLEQPEISVSRATDGSAQVPCKASFSTFRSAFIHWYRQKPGQSLEYLMYVIYTSSQQSLDGKDRKFEASKNFSTSTATLTINFLKTEDEATYYCSHG
Dipodomys ordii V524 igkv ABRO01270528.1 880 ARCDIQMTQTPSSLSASPGDRVTINCRASQGINKYLAWFQQKPGKAPKQLIYYTSSLISGVPSRFSGSGSGTDYSLTISSLQTEDVATYYCLQYDKI
Dipodomys ordii V525 igkv ABRO01270532.1 394 ARCDIQMTQTPSSLSATPGDTVSINCRASQDISNWLSWYQQKPGKAPKLLIYKASNLESGVPSRFSGRGSGTDYSLTISNLQTEDFAMYYCVQGNSY
Dipodomys ordii V526 igkv ABRO01272589.1 3243 SSGDAILTQTPLSLPVTLGEPVSISCRSSQSLLYSDGNTYLYWFLQKSGQSPQALIYLVSNQYSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V527 trav ABRO01273426.1 3046 MSAQQLEQRPRFLSIQEGEECNVYCNSSSIFSSFQWYRQELQGHPVLLVTLVKGGEVQTQKKLTVKFDEARKGSSLNISPTQPEDKGYFCARAQCSG
Dipodomys ordii V535 igkv ABRO01287430.1 2168 SSGDVVLTQTPLSLSVMLGEPASISCKSSQNLLYSNGNTYLKWFLQKPGQSPKLLIYEVSNRFPGVPDRFSGSGSGTDFTLKISRMDIEDIGVYYCFQH
Dipodomys ordii V543 trav ABRO01301343.1 12517 VKAQMKVEQSPQNLILEEGRNFSLTCKYSTSTSNGVQWFRQNPGGRFVLLFYIVSGAKHNGRLESTVNTKEQQSQLYIKDLQPGDSASYFCAVE
Dipodomys ordii V558 trbv ABRO01324155.1 1080 SLDTAVSQDPKYLVTQVGNKKSLNCKQNLGHNAMYWYKQDSKQLLKLMFIYYNKELNLNETVPGRFSPEAPDKAHLNLHVKFPELEDSAMYLCASSQ
Dipodomys ordii V559 igkv ABRO01327504.1 1417 ARCDIQMTQSPSSLSASPGDTVTISCKACQGISNYLNWYQQKPGKAPKPLIYYTSRLASGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQKCDS
Dipodomys ordii V566 ighv ABRO01336824.1 591 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTIGLGVSWIRQPRGKTLEWLANVWWNDNKYYNPALKSRLSISKDSSNSQVFLTLASVDSADTATYYCAR
Dipodomys ordii V567 ighv ABRO01336826.1 4159 VQCEVQLVESGGGLVQPGGSLRLYCAASGFEFSNYWMSWIRHAPGKRPEWLGEINPGGSGTNYPESVKGRFTISRDNSKSILYLQMNSLRVEDTAIYYCT
Dipodomys ordii V572 trbv ABRO01346141.1 5533 SLNAGVVQTPRYEVTEKGKNVALKCEPMAGHTALSWYRQTVARGLEALISFQNQALVDDAGMPKDRFSADMPTASRSNLKIQPTQPGDSAKYFCASSR
Dipodomys ordii V578 trav ABRO01349434.1 3726 GSHGDSVTQTQGHVTLSEGASLTVNCSYEATYYPTLFWYIQYPGEGPQILFKVSKANDKGNHKGFEAIYDRESTSFHLKKAAVLESDSALYYCALN
Dipodomys ordii V579 trav ABRO01349434.1 1323 HATAQSVTQPDVHITVSEGNSLELRCNYSYGASVFLFWYVQYPSQGLQLLLKYSSGDPLVQGLKGFEAEFKRSDSSFHLRKHSVHVSDSAAYFCALS
Dipodomys ordii V580 ighv ABRO01351584.1 1482 VQCEVELVESRGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWLSYFYDSSNTYYADSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYHCA
Dipodomys ordii V582 igkv ABRO01355101.1 5169 AKCDIQMTQSPSSLSVSLGDTATITCKASEDIGYILAWYQQQPGKAPKLLIYGADILESGVPSRFSGSGSQSGTEFTLTISGLEPEDVATYYCQQYNNFP
Dipodomys ordii V588 igkv ABRO01377286.1 677 VCGDIIMTQSSRSLAVSIGERAIMNCKSSQNVNNHIVWYQKKAGQTPQQLIYGASIWPSGIPERFIGSGSGADYTLTISNMQADDVADYYCQQYYNYP
Dipodomys ordii V591 ighv ABRO01384128.1 3474 AAGGVWGRLGAAWGVLRLSCTASGFTFSEYYLDWICQSPGKGPEWLSYISGSSNDIKYADSVKGRFTISRDNSKKPLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V594 ighv ABRO01398009.1 1816 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSSYYMSWIRQAPGKGLEWVAQINPNSGSTWYADSVNGRFTISSDNSKSTLYLQMSSLRTEDTALYYCAR
Dipodomys ordii V599 igkv ABRO01400267.1 2999 SSGDVVMTQSPLTLSIKPEEPASISCKSSESLLHNDGNTYLNWYLQKPGQSPQLLIYTVSNQVTGVSDRFSGSGSGTDFTLKISKVKPEDAGVYYCGQ
Dipodomys ordii V603 ighv ABRO01404475.1 2460 VQCEVRLVESGGGLVQPGGSLRLSCAVSRFTFSGYWMNWLRQAPGKGLEWISSIDGSSSTYYPDSVKGRFTISKDNSKSTLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V604 ighv ABRO01407413.1 946 VQCEVQLMESGGGLVQPGRSLRLSCAVSGFTFSNYWMSWIRQAPGKGLEWVARINTTGGSTWYPDSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAIYYCPR
Dipodomys ordii V605 ighv ABRO01407823.1 1323 VHSQVQLEQPGAEVRRPGDSAKLACRASGYTFTSYYMHWVRQKAGQGLEWIGRIDPEDGETKYAQKFQGKVSLTADTSSSTASLELSRLTAEDSAMYYCARQC
Dipodomys ordii V612 igkv ABRO01422374.1 1167 SCGDIVMTQTPLSLSINPEEPVSISCKSSESLLYSDGNTYLHWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLTISKVKPEDAGVYYCGQDTKRP
Dipodomys ordii V613 igkv ABRO01425201.1 1810 SSGDVVMTQTPLTLSINPEEPASISCKSSESLLHSNGITYLYWYLQKPGQSPQLLIYRGSNRFTGVSDRFSGSGSGTDFTLKISKVKPEDAGVYYCQQSIKLP
Dipodomys ordii V615 ighv ABRO01427552.1 2804 AQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSNSWMSWICQAPGKELDWVEEINTDGGSTWYADSVKGQFTLSRDNSQSTLYLQMSSLRTADTTLYYCA
Dipodomys ordii V620 igkv ABRO01438281.1 1605 SNGDIVMTQTPLSLAVTLGETVSLSCRSSQSLIYSDGDSLLYWFLQKPGQSAQQLIYWATNRESGVPDRFSGSGSGTDFTLQISNVEAEDNGIYYCLQSRSTP
Dipodomys ordii V624 trbv ABRO01447947.1 743 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHNTVYWYQQAEDQRFQFLISYYRESEREKGSIPGHFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V625 ighv ABRO01448082.1 2907 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTVSGYYMSWVRQAPGKGLEWISSIYGSSSTYYADSVKGRFTTSRDNSKNTVYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V628 ighv ABRO01458603.1 717 TYSQVHLVQSGPELKKPGEAVKVSCKASGYTFTSYGINWVRQEPRGGLQWMGWINTYTGNPTYAEGFKGGFVFSLETSVSTAHLKISSLKAEDTAVYYCA
Dipodomys ordii V630 trbv ABRO01464823.1 2037 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHYTVYWYQQAEDKTLQYLISYYRESEREKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V632 trbv ABRO01474483.1 446 PMETQVTQIPRHLISGTGKKLTVTCSQNMNHDSMYWYRQDPGLGLKLIYYSINTDSINKGDIPDGYKVSRKEKKHFPLILESTSINQTSMYFCASS
Dipodomys ordii V633 ighv ABRO01477628.1 425 VQCEVQLVESGGGLVQPGGSLRLSCAVSGFTFSGYWMNWLRQAPGKGLEWISSIDGSSSTYYPDSVKGRFTISKDNSKNTLYLQMNSLRVEDTAIYYCAT
Dipodomys ordii V635 igkv ABRO01494201.1 1808 VRCAIQMTQSPSTLSSSVGVTATITCRASGNIYSNLAWYQQKLGKAPKLLIYGSSTLASGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQHYYGVP
Dipodomys ordii V140 trbv ABRO02037802.1 79457 SLDTAVSQDPKYLVTQVGNKKSLNCKQNLGHNAMYWYKQDSKQLLKLMFIYYNKELNLNETVPSRFSPEAPDKAHLNLHVKFPELEDSAMYLCASSQ
Dipodomys ordii V141 trbv ABRO02037805.1 3832 LTGAGITQTPRSRITHTGKKLVLDCSQDMNHFSMFWYRQDAGQGLRLIYYSTGVGSIAKGDITEGYDVARPQQESFRLTLASASPSQTSLYFCSSS
Dipodomys ordii V142 trbv ABRO02037805.1 10149 HTESGVSQSPRHRVTKRGQTVLLRCDPISGHQRLYWYRQTPGQGLEYLTHFQYEVAAEKPEMPVERFSAQRPNGSFSTLKMQPAEQGDSALYLCASCQ
Dipodomys ordii V143 trbv ABRO02037805.1 13651 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHDAVYWYQQAEDKTLQFLVSYFGESELEKGSIPGRFSAQQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V144 trbv ABRO02037806.1 3510 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHYTVYWYQQAEDKTLQYLISYYRESEREKGSIPGRFSARQFSDYHSELNMSALELRDSSLYLCASS
Dipodomys ordii V145 trbv ABRO02037810.1 24 LTEAGVTQSPRYKVTEKSQAVSLWCDPVSGHNALFWYRQTPGQGPERLLYFQNKAMSEDAQLPKDRFSAQRPEGADSTLKIQPAQLEDSAVYLCASSL
Dipodomys ordii V146 trbv ABRO02037814.1 3509 LTEAGVTQSPRYKVTEKSQAVSLWCDPVPGHNALFWYRQSPGQGPERLLYFQNKAMSEDAQLPKDRFSAQRPEGADSTLKIQPAQLEDSAVYLCASSL
Dipodomys ordii V148 trbv ABRO02037815.1 5242 LTEAGVTQSPRYKVTEKSQAVSLWCDPVSGHNVLFWYRQIPGQGPERLLHFQNKAMSEDTQLPKDRFSAQRPEGADSTLKIQPAQLEDSAVYLCASSL
Dipodomys ordii V149 trbv ABRO02037816.1 5682 RADAGVTQTPMHEVTEKGQSVMLMCKPISGHTRTFWYRQTMTQGLELLVYFNNKDAIDHTGMPSERFSAEMPNASLSTLKIQPTEPKDSAVYLCASSP
Dipodomys ordii V150 trbv ABRO02037816.1 9666 SLNAGVVQTPRYEVTEKGKNVALKCEPMAGHTALSWYRQTVARGLEALISFQNQALVDDAGMPKDRFSADMPTASRSNLKIQPTQPGDSAKYFCASSR
Dipodomys ordii V152 trbv ABRO02037816.1 17416 TVECGIVQTPRFLLRKEEQSATLKCEQNLDHDSMYWYRQDPGHGLRLIYYSQVVKAIQKGDLAEGYSVSREKKPLFPLTVTLAQKNQTALYFCASSR
Dipodomys ordii V153 trbv ABRO02037816.1 20699 STGAEVIQRPRHLIRGKEQKAKLKCVPIKGHDYVYWYRQKPNEELKFLGYLYKEDIMEKTEVLGERFSPQCPQNKPCTVEIQSAEPADSALYFCASS
Dipodomys ordii V154 trbv ABRO02037816.1 28145 SLGAKVTQTPRHLVKEKGQRAKMDCNPIQGHAYVHWYQQNKKREVKLLVYFQNSQLLKETDIAKGRVSATCPSESPCSLEIPSCDLGDTALYLCASSQ
Dipodomys ordii V155 trbv ABRO02037817.1 6579 PMETQVTQIPRHLISGTGKKLTVTCSQNMNHDSMYWYRQDPGLGLKLIYYSINTDSINKGDIPDGYKVSRKEKKHFPLILESTSINQTSMYFCASS
Dipodomys ordii V196 trdv ABRO02048232.1 86654 KGMLCNQVTQSSLDQTVISDSKITLFCTYNATDADLALYWYRKRADQSFQFILYRVNSLSHYADFTEGRFSVRRSQTHKTFHLVISQVRTEDSATYYCVFG
Dipodomys ordii V202 igkv ABRO02049970.1 18358 AKCDVQLTQLPSMSASLGERVSISCRASQDTSNDLHWYQQKPGNAPKLLIYFATGLQSGFLSRFSGSQSGTEFTLTINSLQPEDVATYYCEQSNSYP
Dipodomys ordii V258 igkv ABRO02068741.1 6855 TSGSTLMTQSPALVSVSPGDSISVTCRASETVSDYVTWYQQKPGEAPKILIYDADNQYPGVSDRFIGIQSGTDFIFKIDRVNVSDIATYYCQQS
Dipodomys ordii V259 igkv ABRO02068746.1 7340 ARCDIQMTQSPSLSASLGDRVTITCRASQGISNYLHWYQQKPGKALQFLIYRATTLQPGVPSRFSGSGSGTEFTLTISSLQPEDVATYYCQQGYRDP
Dipodomys ordii V260 igkv ABRO02068749.1 2762 SSGDIIMTQTPLSLPVTLGEMVSLSCRSSQSLIDSDGDSLLSWYLQKPGQSPKLLIYLASRRPSGVPDRFSGSGSGTDFTLQISRVEAEDIGVYYCMQDIDTP
Dipodomys ordii V261 igkv ABRO02068752.1 4281 SNGDIVMTQTPLSLPVTLGETVSLSCRSSQSLIYGDGASLLSWYFQKPGQSPQRLIYWAINQGSGVPDRFSGSGSGTDFTLQIRNVEAEDSGVYYCMQSRYNP
Dipodomys ordii V267 igkv ABRO02071309.1 4727 SSADIMMTQTPPSLIVAPEEPASISCKSSESLLHSDGNTYLHWYLQKPRQSPQLLIYKVSNRFTGVPDRFSGSGSVTDFPLTISRVKPEDAGVYYCQQETKLP
Dipodomys ordii V268 igkv ABRO02071311.1 19976 SSADIMMTQTPLSMSIKPEEPASISCKSSESLLHSNGNTYLNWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGTGSGTDFTLKISRVKPEDAGVYYCGQGTKLP
Dipodomys ordii V269 igkv ABRO02071312.1 4109 SSGDVVMMQTPLTLSINPEEPASISCKSSESLLHSDGNTYLYWYLQKPGQSPQLLIYKGSNRFTGVSDRFSGSGSGTDFTLKISRVKPEDAGVYYCRQGIKYP
Dipodomys ordii V270 igkv ABRO02071314.1 2998 SSGDVVMTQTPLTLSINPEEPASISCKSSESLLHSNGITYLYWYLQKPGQSPQLLIYRGSNRFTGVSDRFSGSGSGTDFTLKISKVKPEDAGVYYCQQSIKLP
Dipodomys ordii V271 igkv ABRO02071314.1 11455 SCGDIVMTQTPLSLSINPEEPVSISCKSSESLLYSDGNTYLHWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLTISKVKPEDAGVYYCGQDTKRP
Dipodomys ordii V272 igkv ABRO02071314.1 35854 SSGDVVMTQSPLTLSIKPEEPASISCKSSESLLHNDGNTYLNWYLQKPGQSPQLLIYTVSNQVTGVSDRFSGSGSGTDFTLKISKVKPEDAGVYYCGQ
Dipodomys ordii V273 igkv ABRO02071314.1 46759 SCGDIVMTQTPPSLSINPEEPASISCKSSESLLHSNGNTYLYWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLTISRVKPEDAGVYYCLQSI
Dipodomys ordii V274 igkv ABRO02071317.1 4244 STGDIMMTQTPLSLMVAPKEPASISCRSSESLLDSDGNTYLYWFLQKPGQSPQYLIYKVSNRASGVPDRFSGSGSVRDFTLTISRVKPEDTGVYYCMQGTKFC
Dipodomys ordii V275 trav ABRO02071685.1 4479 VSGKTKVEQSPWIQKVLEGENCTLQCNYTVSPFNNLRWYKQDTEKGPVSLIRMNYTESKKSNGRYTATLHSESKQSYLHITASQLSDTASYICVV
Dipodomys ordii V276 trav ABRO02071685.1 26975 TSMAQKVTQAQTSVWVVEKEAVTLDCLYETGESYYSIFWYKQPLAGKLILLVRQNSYDKQNATEDHYFLNFQKSSRYINLTITGTQLEDSAVYFCALIE
Dipodomys ordii V277 trav ABRO02071685.1 48680 VSSQQKEVEQHPESCSVPEGATASLNCTYRDSGSQNFRWYRQYSGKGPELLVSAYSNGDRDEGRFTVHLNRASLYLSLHIRSSQLSDSATYFCAVS
Dipodomys ordii V278 trav ABRO02071685.1 65613 GSNGESVTQTQGQVALLEGASLTVNCSYETKGYPTLFWYVQYPGEGLQLLIKVAKANEMGGHKGFEAMSDEENTSFHLKKATVLVSDSAVYYCALR
Dipodomys ordii V279 trav ABRO02071685.1 95150 VSQGEKLEQGPSILSMQEGDSCVINCTYSDSASDYFLWYKQEPGQGLQLIINILSNRDKIENEKFLVVLKKKDKHFSLHIKDAQPGDSAVYFCAAR
Dipodomys ordii V280 trav ABRO02071686.1 2403 RTCGISVTQKESRISVLEGASMTIDCTYTATGYTYLFWYVQYPGDGLQLLLKAITANEKGSYKGFEARYDRENTSFHLKKAAVLESDSAVYYCAVS
Dipodomys ordii V281 trav ABRO02071686.1 17756 VNSQQGEEKTHTLSIQPGENATMNCSYKSSITVLQWYRQDSGRGPTMLILIRSNEREKISGRLRITLDTSARSSSLSILTSQPEDTAVYFCATD
Dipodomys ordii V282 trav ABRO02071687.1 2095 LHGKDEVEQSPESLSLQEGGSGSLNCSYTTSNFRGLLWYRQDAERGLTFLFSLYSAGDAKQKDRLGATLSKKGSFLHITSANLEDSATYLCAVY
Dipodomys ordii V283 trav ABRO02071687.1 19623 RTHGNSVTQTQGQVMVLEGASLRINCTYTTTEYPSLFWYVQYPGEGPQLLLKAMTANDKGSHKGFTASYDREATSFHLEKTAVLESDMAVYYCALS
Dipodomys ordii V284 trav ABRO02071688.1 1613 VSCQQKEVEQHPESLSVPEGATASLNCTYRDSASRYFWWYRQYSGKGPELLVYTYSNGDKREGRFTAHLNRGSLYLSLHIRDSQSSDSATYICAVS
Dipodomys ordii V285 trav ABRO02071689.1 611 VSCQQKEVEQHPESLSVPEGATASLNCTYRDSASQYFWWYRQYSGKGPELLVYTYSNGDKQEGRFTAHLNRGSLYLSLHIRDFQSSDSATYICAVS
Dipodomys ordii V286 trav ABRO02071695.1 3391 VRGNQVEQSPPALLLQEGENSTLQCNFSNTVTIVQWFQQHPRGGLISLFYLASGTKHNGRLVATIDTRERRSLLYISSAQNTDSATYFCAVR
Dipodomys ordii V290 igkv ABRO02072938.1 2963 SNGDVVMTQTPLSLLVTLGEPASISCRSSQSLLYSDGNTYFYWFLQKPGQSLHRLIYLVSKRGSGVPDRFSSSGSGSDFTLTISRVEAEDVGVYYCFQG
Dipodomys ordii V291 igkv ABRO02072948.1 8535 SSGDAILTQTPLSLPVTLGEPVSISCRSSQSLLYSDGNTYLYWFLQKSGQSPQALIYLVSNQYSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V292 igkv ABRO02072957.1 3751 AKCDIQMTQSPSSLSVSLRDTATITCRASEDIGYALAWYQQQPGKAPKALIYSANSLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQYRSFP
Dipodomys ordii V293 igkv ABRO02072958.1 26199 TRCDIQMIQSPSTLSASSGDRVSITCRASQGISNGLSWYQQKPGGAPKLLIYGANNLQSGIPSRFSGSGSGTEFTLTISSLQPEDIATYYCQQYYNI
Dipodomys ordii V294 igkv ABRO02072959.1 3115 ATCDIQMTQSPSFLSASPGDRVSITCRASQGINYYLHWYQQKPGNAPKLLIYNANSLASGIPSRFSGSQSGTEFTITISSLQPEDFATYYCLQGCSFP
Dipodomys ordii V295 igkv ABRO02072962.1 2931 SSGDVVMTQTPRSLPVTLGEPVSISCRSSQSLLHSNGNTYLNWFMQKPGQSPHRLIYLVSKRDSGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCFQG
Dipodomys ordii V296 igkv ABRO02072963.1 3354 TNCDILMTQSPSSLSASVGDRVSITCKASQGISDNLQWYQQKPGKAPTLLIYWANRLVSGVPSRFSGSQSGMEFTLTISSLQPEDFATYYCQQSNSYP
Dipodomys ordii V297 igkv ABRO02072971.1 3522 SAGVAMLTQTPLSLPVTLGDQASISCRSSESLLYSNGKTYLYWFVQKPGQSPQRLIYWVSNRETGVPDRFSGSGSVTDFTLTISRVESEDIGVYYCFQD
Dipodomys ordii V298 igkv ABRO02072971.1 29637 ARCAIQMTQSPPSLSASPGDRVSLTCRSSQNIYNRLSWYQQKPGESPKILIYGTNNLESGIPSRFSGSGSGTDYSLTINSLQPEDVATYYCQHSYGY
Dipodomys ordii V299 igkv ABRO02072974.1 4706 ASCDIQMTQSQSSLSASLGDSVSITCRASQGISSWLAWYQQKPGKAPKLLIYGASNLATGVPSRFSGSGSGTEFTLTISSLQQDDIAIYYCQQYSSLP
Dipodomys ordii V300 igkv ABRO02072974.1 24666 FRCDIQMTQSPSFLSASPEDRVSITCRASQGISNDLNWYQQKPGNAPKLLIYYANSLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHYSFP
Dipodomys ordii V301 igkv ABRO02072976.1 11275 FRCDIQMTQSPSFLSASPGDRVSTTCHASQHISSDLHWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLISSSLQPEDFATYYCQQSNSLP
Dipodomys ordii V302 igkv ABRO02072976.1 41016 FKCDIQMTQSPSFLSASPGDRVSITCRASQGINYYLHWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQSSSYP
Dipodomys ordii V303 igkv ABRO02072976.1 61206 ARCDIQMSQSPSALSASPGDTITISCKASQGISRVLNWYQQKPGNAPKLLIYYTSNLASGVPSRFSGSGYETDYTLTISSLQPEDFATYYCQQCINYP
Dipodomys ordii V304 igkv ABRO02072976.1 75822 ATCDIQMTQSPSFLSASPGDRVSITCRASQGISDNLHWYQQKPENAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGRSY
Dipodomys ordii V305 igkv ABRO02072977.1 21949 ATCDIQMTQSPSILSASPGDRVSITCQASQGISNVLNWYQQKPENAPNLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSFP
Dipodomys ordii V306 igkv ABRO02072977.1 37535 ARCDIQMTQSPSSLSASPGETVTISCKGSQDISNYLAWYQQKPGNAPKLLISYATSLASGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQQHINYP
Dipodomys ordii V307 igkv ABRO02072977.1 41706 ARCDIQMTQSPSSLSASPGDTVTINCRASQGISNYLNWYQQKPEKSPKPLIFYTSNLASGVPSRFSGSGSGTGYSLTISNLQPEDFATYYCQQYDSI
Dipodomys ordii V308 igkv ABRO02072977.1 55166 FRCDIQMTQSPSFLSASPGDRVSITCRASQGISNDLHWYQQKPGNAPKLLIYYVKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQSNSFP
Dipodomys ordii V309 igkv ABRO02072978.1 20359 ARCDIQMTQSPSSLSASPGDTVTISCKASQGISNCLNWYQQKPGKAPKPLIYYTSRLVSGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQKCDS
Dipodomys ordii V310 igkv ABRO02072978.1 40658 FRCDIQMTQSPSFLSASPGDRVSITCRASQRINYYLHWYQQKPGNAPKLLIYNANSLFSGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQDYSFP
Dipodomys ordii V311 igkv ABRO02072981.1 5762 FRCDVQMTQSPSFLSASPGDRVSITCRASQGINYYLNWYQQKPGNATKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSLP
Dipodomys ordii V312 igkv ABRO02072982.1 35980 FRCDIKMTQSPSFLSASPGDRVSITCHASQGISNDLHWYQQKPRNAPKLLINFAKNLVFGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQDNSLP
Dipodomys ordii V313 igkv ABRO02072983.1 6099 FICDIQMTQSPSFLSASPGDRVSITCHASQGISNDLQWYQQKSGNAPKLLIYNANSLFFGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQVNSYP
Dipodomys ordii V314 igkv ABRO02072983.1 29771 ARCDIQMNQSPSSLSASPGDTVTISCKSSQGISNYLNWYQQKPGKAPKPLIYYTSRLASGVPSRFSGSRSGTDYSLTISSLQPEDFATYYCQKCDSM
Dipodomys ordii V315 igkv ABRO02072983.1 45790 ATCDIQMTQSPSFLSASPGDRVSITCRASQGINYYLNWYQQKPGNAPKLLIYHANNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSLP
Dipodomys ordii V316 igkv ABRO02072984.1 22695 FRCDIQMTQSPSFLSASPGDRVSINCHASQAISNDVQWYQQKPGNAPKLLIYNVNSLFFGIPSRFSGSQSGTEFTLTISSLQHEDFATYYCQQESSYP
Dipodomys ordii V317 igkv ABRO02072985.1 5854 VRCDIQMTQSPPFMSVSPGDTVTISCRASQGISNLNWFQQKPGKTPKLLIYYTSRLASGVPSRLSGSGSGTDYSLTISSLQTEDFATYYCQKYASR
Dipodomys ordii V318 igkv ABRO02072986.1 6679 FRCDIQMTQSPSFLSASPGDRVSLTCRASQGISYYLNWYQQKPGNAPKLLIYHAKNLASGIPSRFSGSQTGTEFTLTISSLQPEDFATYYCQQHNSYP
Dipodomys ordii V319 igkv ABRO02072987.1 15232 ARCDIQMTQSPSSLSASPGDTVTISCKACQGISNYLNWYQQKPGKAPKPLIYYTSRLASGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQKCDS
Dipodomys ordii V320 igkv ABRO02072991.1 11938 FKCDIQMTQSPSFLSASPGDRVSITCRASQGINQYLNWYQQKPGNAPKLLIYNAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHNSFP
Dipodomys ordii V321 igkv ABRO02072992.1 1973 ARCDIQMTQSPSSLSASPVTISCRASQDISNYLAWYQQKPGNAPKLLISYATSLASVVPSRFSGSGFRPNYSLTISSFQPENFATYYCQQHMSYP
Dipodomys ordii V322 igkv ABRO02072992.1 6178 ARCDIQMTQSSSSLSASPGDTVTISCRASQSISNYLAWYQQKPGKAPKLLIYYTSSLASGVPSRFSGSGSGTDYSLTISSLQTEDFATYFCQQYASRP
Dipodomys ordii V323 igkv ABRO02072993.1 4413 FRCDIQMTQSPSFLSASPGDRVSITCRASQGISNYLHWYQQKPGNAPKLLISFAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQDYSFP
Dipodomys ordii V324 igkv ABRO02072993.1 18588 FRCDVQMTQSPSFLSASPGDRVSITCLASQGINYYLNWYQQKPGNAPKLLIYYAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSLP
Dipodomys ordii V327 igkv ABRO02073429.1 16550 AKSDIQMTQSPSSLSVSLGDTATITCRASEDIGYYLAWYQQQPGKAPKLLIYGADSLESGVPSRFSGSKSGTEFTLRISGLEPEDVASYYCQQTYSYP
Dipodomys ordii V328 igkv ABRO02073430.1 6051 ARCDIQLTQPQSLPSSLGNGVTITCRASQDISESLHWYQQRAGKAPKLLIRYATTLQSGFPLRFSGSGSGTGFTLAISSLQPEDVATYFCQQSYNNP
Dipodomys ordii V329 igkv ABRO02073438.1 126 SSGDIILTQTPLSLAVTLGEMVSLSCRSSQSLIYSNGNSILYWFLQKPGQSPQRLIYLATNRGSGVPDRFSGSGSDTDFTLQISRVEAEDIGVYYCMQGIDTP
Dipodomys ordii V330 igkv ABRO02073462.1 2915 TRCDIQMTQSPSTLSASPGDRVTITCRASQGISNWLNWYQQKPGGAPKLLIYGAKYLQSGIPSRFSGSGSGTEFTLTISSLQPEDIATYYCQQYYSN
Dipodomys ordii V331 igkv ABRO02073475.1 5305 ARCDILMTQSPSYLSASVGDRVSITCRASQGISGYLQWYQQRPRKAPKLLIYWANSLQTGVPSRFSGSRSGEEYTLTISSLQPEDFATYYCQQGSRYP
Dipodomys ordii V332 igkv ABRO02073475.1 8719 ARCEIHMAQSLSSLSLSLGDNATFTCRASENIDYSLAWYQQKPGKAPKQLIYAADTLLSGVPPRFSGDGYGTEFTLTISSLQPEDVSTYYCQQGYIAP
Dipodomys ordii V333 igkv ABRO02073545.1 3749 SSGDVVLTQTPLSLSDMLGEPASISCKSSQNLLYSNGNTYLKWFLQKPGQSPQLLIYEVSNRFPGVPDRFSGSGSGTDFTLKISRMDIEDIGVYYCFQH
Dipodomys ordii V334 igkv ABRO02073586.1 2205 TRCDIQMTQSPSTLSASPGDTVTIKCQASQYISNELSWYQQKPGKAPKLLIYGANRLQFGIPSRFSGSGLGTKFTLSISSLQPEDIATYYCQQDYDN
Dipodomys ordii V336 igkv ABRO02073893.1 5830 ARCDIQMTQSTSTLSASPGDRVSITCQASQSISNWVNWYQQKPGGTPKLLIYSAKYLESGIPSRFSGSGLGTEFTLTISSLQPEDIATYYCQQFFDY
Dipodomys ordii V337 igkv ABRO02073893.1 65769 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIGYVLAWYQQQPGKAPKPLIFDADSMASGVPSRFSGSGSQSGTEFTLTISGLEPEDVATYYCQQYTNFP
Dipodomys ordii V338 igkv ABRO02073893.1 78685 ARCDTQLTQPLSLSSSQGDRVTITCRTSQDIGTNLHWYQQRAGKAPKLLIRYSTILQSGFPPRFSGSGSGTEFTLTISSLQPEDATTYFCQQSYYYP
Dipodomys ordii V339 igkv ABRO02073893.1 102313 TRCDIQMTQSPPTLSASPGDRVTITCRASQGINYALNWYQQKPGGAPKLLIYGADNLQSGIPSRFSGSGSGTEYTLTISSLQREDIATYYCQQYYDSP
Dipodomys ordii V340 igkv ABRO02074058.1 2131 SSGDAILTQTPLSLPVTLGEPVSISCRSSQSLLYSDGNTYLYWFLQKPGQSPQALIYLVSNQYSGVPDSFSGSGSGTDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V341 igkv ABRO02074060.1 8966 AKCDIQMTQSPSSLSVSLGDTATITCRANEDIGYYLAWYQQQPGKAPKPLIYLADILESGVPSRFSGSQSGTEFTLRISGLEPEDVATYYCQQYNGFP
Dipodomys ordii V342 igkv ABRO02074062.1 14084 TRCDIQMTQSPSTLSASPGDRVSITCRASQGISNWLSWYQQKPGGAPKLLIYGANNLQSGIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQHYI
Dipodomys ordii V343 igkv ABRO02074063.1 7394 ARCDIQLTQPPSLSSPLGDRVTITCRASQDISNNLHWYQQRVGKAPKLLINYATTLQSGFPPRFSGSGSGAEFTLAISSLQPEDAATYFCQQRYSLP
Dipodomys ordii V344 igkv ABRO02074063.1 27467 TRCDIQMTQSPSTLSASPGDRVTITCRASKGINSWLNWYQQKPGGAPKLLIYGGKYLQSGIPSRFSGSGSGTEYTLTISSLQAEDIATYYCQQSYNN
Dipodomys ordii V345 igkv ABRO02074065.1 5106 SSGDVVMTQSPRSLPVTLGEPASISCRSSQSLLYSDGKTYLYWFLQKPGQSPHRLIYLVSKRDSGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCFQH
Dipodomys ordii V346 igkv ABRO02074065.1 21119 ARGDILMTQSPSYLSTSVGDRISITCRASQGISGYLQWYQQKPRKAPKLLIYWANSLQTGVPSRFSGSRSGEEYTLTISSLQPEDFATYYCQQSSSYP
Dipodomys ordii V347 igkv ABRO02074068.1 1841 SSGDVVMTQTPSSLPVTLGESASISCKSSHNLRYEDGHIYLDWFLQKPGQIPQLLIYKASNRASGVPVRFSGSGSGTDFILKISRVEAEDIGVYYCLQR
Dipodomys ordii V348 igkv ABRO02074070.1 9964 ARCDIQMTQSPSTLTASVGGTATITCRASGNIYGNLAWYQQKLGKAHKLLIYSSSNLVSGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQHYYGY
Dipodomys ordii V349 igkv ABRO02074092.1 2477 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIGYYLAWYQQQPGKTPKPLIYLADSLESGVPSRFSGSQSGTEFTLRISGLEPEDVATYYCQQGSSFP
Dipodomys ordii V350 igkv ABRO02074100.1 6878 TRCDIQMTQSPSTLSASPGDRVSITCRASQGISNALSWYQQKPGGAPKLLIYDAKYLQSDIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQYYDY
Dipodomys ordii V351 igkv ABRO02074101.1 2830 SSGDIILTQTPLSLAVTLGETVSLSCRSSQSLIYSDGDSLLYWFLQKPGQSPQQLIYWATNRESGVPDRFSGSGSGTDFTLQISRVEAEDIGVYYCMQGIDTP
Dipodomys ordii V352 igkv ABRO02074226.1 30667 GCAEIVVTQSPRSLAVSAGEKVTINCKSSQSLLLYSNNYLAWYQQKPGKAPKLLMYGASTRASGVPDRFIGSGSGTDFTLTISSIEAEDMADYHCQQSHSFP
Dipodomys ordii V353 igkv ABRO02074227.1 8318 ACSEIVVTQSPRSLSVSAGERVTINCKSSQNLLSGGNNYLAWYQQKPGKAPKLLIYWASTRASGVPDRFIGSGSGTDFTLTISSIEAEDMADYFCLQHYNLP
Dipodomys ordii V354 igkv ABRO02074229.1 2779 ARCDIQMTQSPSFLSASPGDRVSMSCRASQDISNYLNWYQQTPGKAPKLLIYAAEYLSSGIPSRFSGSRSGKEFTLTISSLQPEDAGIYYCQHYYGTF
Dipodomys ordii V355 igkv ABRO02074552.1 15156 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIGYGLAWYQQQPGKAPKLLIYGADILESGVPSRFSGSQSGTEFTLKISGLEPEDVATYYCQQGYSNP
Dipodomys ordii V356 igkv ABRO02074558.1 3727 TRCDIQMTQSPSTWSASPGDRVSFTCQASQDIYNGLSWYQQKPGGAPKLLIHSAEYLQSGIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQNYDY
Dipodomys ordii V357 igkv ABRO02074569.1 2811 SSGDVVMTQTPRSLPVTLGEPASISCRSSQSLQHSNGNTYLSWYLQKPGQSPHLLIYLVSKRESGVPDRFSGSGSGTDFTLTISRVEAEDLGVYYCMQA
Dipodomys ordii V358 igkv ABRO02074569.1 13284 SSGDVVMTQTPVSLLVTLGEPASISCRSSQSLLHSDRNTYLYWFLQKPGQSTHCLIYWVSKQDSGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQA
Dipodomys ordii V359 igkv ABRO02074569.1 18454 ARRDIQMTQSPPSLSVSPGDRVTITCHASENNYNNLHWYQQKPGEAPKLLISYVSNLQPGVPPRFSSSGYGTEFTLTISSLQPEDVATYYCQQSTSCP
Dipodomys ordii V360 igkv ABRO02074570.1 24882 SSGDVVMTQTPSSLPVTLGQLASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQPLIYLVSKRASGVPDRFSGSGSGTDFTLTISRVEAEDAGVYYCLQS
Dipodomys ordii V361 igkv ABRO02074570.1 57210 SSGDVVLTQCPSFLPVILGESVSISCRSSQSLLHSNGRTYLDWCLQKPGQSPQVLIYEVSNKYSGVPDRLSGSGAITDFTLKISRVQAEDVGVYYCLQR
Dipodomys ordii V362 igkv ABRO02074570.1 65806 TNCDILMTQSPSSLSASVGDRVSITCKASQGISNVLQWYQQKPGKAPKLLIYWANNLVSGVPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSYP
Dipodomys ordii V363 igkv ABRO02074571.1 6036 ARCAIQMTQSPSTLSASVGGTATITCRASGNIYSNLAWYQQKLGKAPKLLIYGSSTLASGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQHYYGVP
Dipodomys ordii V367 ighv ABRO02076347.1 3546 VQCEVQLMESGRGLVQPGRSLRLSCAVSGFTFSNYWMSWIRQAPGKGLEWVARINTTGGSTWYPDSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAIYYCPR
Dipodomys ordii V368 ighv ABRO02076347.1 7287 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSRYDMSWIRQAPGKGLEWLSSIYGSSSTYYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V369 ighv ABRO02076348.1 3480 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVHQAPGKMPEWLSYISGSSSDIKYADSVKGRFTTSRDNSKNTLYLQMNSLRVEDMAVYYCA
Dipodomys ordii V370 ighv ABRO02076348.1 4575 VHSQVQLEQPGAEVRTPGDSARLACRASGYTFTSYYMHWVRQKAGQGLEWIGRIDPRDGETKYTQKVQGKVSLTADTSSSTASMELSRLTVEDSAVYYCA
Dipodomys ordii V371 ighv ABRO02076354.1 2087 VQCEVQLVESGGGLVQPGGSLRLSCAVSGFTFSGYWMNWLRQAPGKGLEWISSIDGSSSTYYPDSVKGRFTISKDNSKSTLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V372 ighv ABRO02076355.1 298 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSSYYMSWIRQAPGKGLEWVAQINPNSGSTWYADSVNGRFTISSDNSKSTLYLQMSSLRTEDTALYYCAR
Dipodomys ordii V373 ighv ABRO02076358.1 11762 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSRYTMHWLRQAPGKRPEWLSYISSGSSNINYADSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAMYYCA
Dipodomys ordii V374 igkv ABRO02076520.1 3450 SSGDAILTQTPLSLPVTLGEPVSITCRSSQSLLYSDGNTYLYWFLQKPGQSPQALIYLVSNQYSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQH
Dipodomys ordii V375 igkv ABRO02076523.1 22265 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIAYDLAWYQQQPGKAPKLLIYGADILESGVPSRFSGSQSGTEFTFTISGLEPEDVATYYCQQSYSYP
Dipodomys ordii V376 igkv ABRO02076525.1 1209 ARCDIQLTQPPSLSSPLGDSVTITCRASQGISNYLHWYQQRAGKAPKLLISYATTLQSGFPSRFSGSGSGTEFTLAISSLQPEDAATYFCQQSNSYP
Dipodomys ordii V377 igkv ABRO02076532.1 6295 TSCDILMTQSPSSLSASVGDRVSITCKASQGISDVLQWYQQKPGKAPKLLIYWANNLVSGVPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSYP
Dipodomys ordii V380 ighv ABRO02078066.1 3387 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVGYIRKKANGHTTEYAASVKGRFTVSRDDSKSMTYLQMNSLQVEDTAMYYCAR
Dipodomys ordii V381 ighv ABRO02078504.1 2053 VQCEVQLVESGGDLVQPGGSLRLSCAASGFDFSSYGMNWVRQAPGKGLEWLSYIYGSSSTYYADSVKGRFTTSRDNSKSTLYLQMNSLRVEDTAIYYCA
Dipodomys ordii V382 igkv ABRO02078769.1 5267 SSGDVVLTQTPLSLSVMLGEPASISCKSSQNLLYSNGNTYLKWFLQKPGQSPKLLIYEVSNRFPGVPDRFSGSGSGTDFTLKISRMDIEDIGVYYCFQH
Dipodomys ordii V385 igkv ABRO02079308.1 4422 TRCDIQMTQSPSTLSASPGDRVTITCRASQNIYYGLHWYQQKPGGAPKLLIYNANNLQSGIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQYLEY
Dipodomys ordii V390 igkv ABRO02088684.1 2264 SSGDVVMTQTPRSLLVTLGEPASISCRSSQSLLYSNGNTHLSWYMQKPGQSPHQLIYLVSKRDSGVPDRFSGSGSGTDFTLTIIRVEAEDLGVYYCLQR
Dipodomys ordii V552 trbv ABRO02037827.1 23320 TQAQTIQQWPAARVQTVGSSLTLECKVTGTSNPNLYWYRQATGGALQQLFYSISADQVDAAASHGLTASRSKDGQFFLSSEKLLLSDSGFYLCAWS
Dipodomys ordii V585 trdv ABRO02048241.1 8149 TSITQTVTQSQPEMSVQETETATLNCTYNTKESNYFLYWYKQLPSGQMVFVILQEAYKKENSVENRFSVNFQKEARFFSLTISALQLEDAAKYFCVLKEQ
Dipodomys ordii V586 trav ABRO02048242.1 8921 VSGIAEVIQSPPSLVIHEGDNTTFNCSYEVKNFQNLQWYKQEEKAPSFLLKLISSGIDKKQGRLSGTLNKKELLSTLHITAAHIGDSATYLCAVE
Dipodomys ordii V587 trav ABRO02048243.1 8546 MSGQHLNQSPQFLSIQEGQDVSMNCSYSNTFNTMLWYKQGPGESLVLLLALYKTGEFIRNGKLTAQFSETRKDSFLTLSASSPGDTGTYLCAG
Dipodomys ordii V588 trav ABRO02048247.1 4434 IMTDAKTTQPDSMEWTEGEPARLPCNHSTIGGNEYIYWYRQITFQGPEYIIHGLKSNITNRMASLAIPADRKSSTLILPHVNVKDTAVYYCILRD
Dipodomys ordii V589 trav ABRO02048248.1 11377 MSAQQLEQRPRFLSIQEGEECNVYCNSSSIFSSFQWYRQELQGHPVLLVTLVKGGEVQTQKKLTVKFDEARKGSSLNISPTQPEDKGYFCARAQCSG
Dipodomys ordii V590 trav ABRO02048248.1 2387 VKAQMKVEQSPQNLILEEGRNFSLTCKYSTSTSNGVQWFRQNPGGRFVLLFYIVSGAKHNGRLESTVNTKEQQSQLYIKDLQPGDSASYFCAVE
Dipodomys ordii V591 trav ABRO02048249.1 11711 GSGAQSVTQLDSHVTVSERAPLELRCNYSYGGTPYLFWYVQYPNQGLQFLLKYEPGKTVVKGIKGFEAEFKKSETSFHLKKASIQWSDTAEYFCALR
Dipodomys ordii V592 trav ABRO02048251.1 23673 VRGIQVEQSPPALLLQEGENATLQCNFSNAVNNVQWFCQYPRGHLINLFYIASGTKHNGRLTATIINRERRTLLYISSAQSTDSATYFCAVR
Dipodomys ordii V593 trav ABRO02048252.1 2480 LHGKDEVEQSPESLSLQEGGSGSLNCSYTTSNFGGLLWYRQDAGRGPTFLFILYSDGDAKQTDRLRATLSKKRSVLHITTANPEDSATYLCAVY
Dipodomys ordii V594 trav ABRO02048253.1 28578 VSSQQKEVEQHPESLSVPEGATASLNCTYKNSAYQYFRWYRQYSWKGPELLASTYSNGDKDEGRFTVHLNKASLYLSLQIRNAQLSDPATYLCAMS
Dipodomys ordii V595 trav ABRO02048253.1 19966 GITAQGVAQPEDHISVFEGAHVQVKCNYSYSGSPVLFWYIQHPGQGLQLLLKHISGGSAKGFTATLNKSEKSFHLQKARTQEDDSAMYYCALS
Dipodomys ordii V596 trav ABRO02048253.1 16083 VNSQQEEKTQTLSIQQGENATVNCSYKSDIITLQWYRQDSGRGPTMLILIRSNERERSSGRLRITLDTSARSSSLSILTSQTADTAAYFCATD
Dipodomys ordii V597 trav ABRO02048254.1 49075 LSQGEKVEQSPSVLSVQEGDSCVINCTYTDSASVYFPWYKQEPGQGPQLIIDIRSNRDRNENGKLLVILKKNDKHFSLHIKDTQPGDSAIYYCAASTHCSP
Dipodomys ordii V598 trav ABRO02048254.1 41454 LRGLQVEQSPSVQRLQDGASSTLRCNFSTTVYNVQWFRQNPGGGLLSLFFMTPGTKQKGRLQSTLDSKERYSSLHISASQLEDSGTYLCAAEAQCSQ
Dipodomys ordii V599 trav ABRO02048254.1 30999 LSQGEKVEQSSSVLSVQEGDTCVINCTYTDSTFSYFPWYKQEPGQGPQLIIDIRSNRDRNENGKLLVLLKKNDKHLSLLIKDIQPGDSAVYYCAAS
Dipodomys ordii V600 trav ABRO02048254.1 19500 RTCGDSVTQKESHVTVSEGASMTIDCTYSATGYPSLFWYVQYPGEGPQLLFRVSKANDKGSYNGFEAMYNRENTSFHLKKAAVLESDSALYYCALN
Dipodomys ordii V601 trav ABRO02048254.1 3198 VSQGEKLEQGPSILSMQEGDSCVINCTYSDSASDYFVWYKQEPGQGLQLIINIRSNRDKIENEKFLVFLKKKDKHFSLHIKDAQPGDSAVYFCAAR
Dipodomys ordii V602 trav ABRO02048256.1 3463 LSQGEKVEQSPSVLNMQEGDTSVINCTYTDSASVYFPWYKQEPGQGPQLIIDIRSNRDRIENGKLLVLLKKNDKHLSLHIKDTQPGDSAVYYCAAS
Dipodomys ordii V603 trav ABRO02048260.1 5908 HATAQSVTQPDVHITVSEGNSLELRCNYSYGASVFLFWYVQYPSQGLQLLLKYSSGDPLVQGLKGFEAEFKRSDSSFHLRKHSVHVSDSAAYFCALS
Dipodomys ordii V604 trav ABRO02048260.1 2353 LRGLQVEQSPSVQRLQNRASSTLRCNFSTTVYNVQWFRQNPGGGLLSLFFMTPGTKQKGRLQSTLDSKERYSSLHISASQLEDSGTYLCAAEAQCSQ
Dipodomys ordii V605 trav ABRO02048262.1 18024 RSSGDSVTQTEGLVTLTEGAPLILNCTYQSTYSIAFIFWYIQYLNKAPQLLLKSSTQSPRSENRGFQATLVKSDNSFHLQKSSLQLSDSALYFCALG
Dipodomys ordii V606 trav ABRO02048262.1 691 GSHGDSVTQTQGHVTLSEGASLTVNCSYEATYYPTLFWYIQYPGEGPQILFKVSKANDKGNHKGFEAIYDRESTSFHLKKAAVLESDSALYYCALN
Dipodomys ordii V607 trav ABRO02048263.1 17966 VNSQQKEVEQHPESLSVPEGATASLNCTYKNSGSQYFVWYRQYSGKGPELLMSTSSNGDKHKGRFTAHLNRASLCLSLQIRDSQLSDSATYLCAVS
Dipodomys ordii V608 trav ABRO02048263.1 7220 KSSGDSVTQTEGSVTFTEGATLILNCTYQSTYSNVFIFWYVQYLNKAPQLLLKSSTQSLRSENRGFQATLVKSDNSFHLQKSSLQLSDSALYFCALG
Dipodomys ordii V609 trav ABRO02048263.1 2030 VSSQQKEVEQHSESLSVPEGATASLNCTYKNSGSQNFVWYRQYSGKGPELLISTSSNGHKLEGRFTAHLNRASLYFSLHIRGSQLSDSATYFCAVS
Dipodomys ordii V610 trav ABRO02048268.1 1185 LRGLQVEQSPSVQRLQDGASLTLRCNFSTTVYNVQWFRQNPGGGLLSLFFMTPGTKQKGRLQSTLDSKERYSSLHISACQLEDSGTYLCAAEAQCSQ
Dipodomys ordii V611 trav ABRO02048270.1 2246 RSNGDSVTQTQGKVALLEGASLTVNCSYETKQYPTLFWYVQYLGEGLQLLIKVAKANEMGSHKGFEAMYDKESTSFHLKKATVLVSDSAVYYCALR
Dipodomys ordii V657 trgv ABRO02065402.1 9544 TSGDLVPHITKKAGATAFLECQMKVARAKEKAYIHWYQQKPGQPLRRILCISSNDNVIYEEGISEERYEAKRWLSDLSSSLRIHHLTEEDTGMYFCACWD
Dipodomys ordii V658 trgv ABRO02065403.1 579 GLGYLEQPEISVSRATDGSAQVPCKASISSFRSVAIHWYRQKPGQSLEHLLYVIYTSTQQSLDGKDRKFEASKNFSTSTTTLTINFLKREDEATYYCSYG
Dipodomys ordii V659 trgv ABRO02065404.1 578 GLGHLEQPEIIVSRATDGSAQVPCKASFSSFRSVAIHWYRQKPGQSLEYLLYVIYTSSQRSLDGKNKKFEASKNFSTSTATLTINFLKTEDEATYYCSHG
Dipodomys ordii V660 trgv ABRO02065408.1 6131 SQMSSTWAGRMRSVTKTLKSSVAISCDIYLDTAYVHWYQAVEGKAPRHLLFYNFGSTTVMVDSELSPGKYHAYEGAERNCNLVIRNLDRSDAGMYYCAAWT
Dipodomys ordii V678 igkv ABRO02071313.1 1063 VCGDIIMTQSSRSLAVSIGERAIMNCKSSQNVNNHIVWYQKKAGQTPQQLIYGASIWPSGIPERFIGSGSGADYTLTISNMQADDVADYYCQQYYNYP
Dipodomys ordii V679 igkv ABRO02071314.1 68255 ARGDIVVTQSPNSLTVSAGETVTINCKASQSLLWTNDNNNYLSWYQQKWGEAPKMLMYLAHTRASGVPDRFIGSGSRTDFTLTISSVQVEDVADYYCQQSYSRP
Dipodomys ordii V680 igkv ABRO02071314.1 17349 TGAEIVVTQSPRSLAVSAGEKVTINCKSSQSLLLFGNNCLAWYQQKPGKAPKLLMYGASTRASGVPDRFIGSGSGTDFTLTISRIEAVDMADYYCGQYYNLP
Dipodomys ordii V681 igkv ABRO02071315.1 15696 ACGDIVLTQSPSSLAVSAGERVTINCESSQSLLSGSYNSLAWYQQKWGEAPKLLIYGASTRASGIPDRFIGSGSRTDFTLIITGIWAEDVADYYCQQDYSYP
Dipodomys ordii V682 igkv ABRO02071315.1 1395 ACGDIVLTQSPSSLAVSAGDRVTINCESSQSLLSGGNNYLAWYQQKWGEAPKMLVYLAHTWASGVPDRFIGSGSGTDFTLTISNIEEEDTADYYCQQDYSYP
Dipodomys ordii V688 igkv ABRO02073532.1 21008 AKCDIQMTQSPSSLSVSLGDTATITCRASEGIWYALAWYQQQPGKAPKLLIYGANSLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQTYSYP
Dipodomys ordii V689 igkv ABRO02073553.1 16841 ARCGIQMTQSPSTLSASVGGTATITCRASGNIYGNLAWYQQKLGKSPKLLIYGSSTLASGVPSRFSGSGYGTEFTLTISSLQPEDVATYYCQQYNNFL
Dipodomys ordii V690 igkv ABRO02073555.1 17509 TRCEIQMAQSLSSLSLSLGNNANFTCRASESNDYSLAWYQEKPGKAPKLLIYAADTWLSGVPSRFSGDGYGTEFTLTISSLQPEDVATYYCQKVTLLL
Dipodomys ordii V691 igkv ABRO02073555.1 2666 TSCDILVTQSPSSLSASVGDRVSITCKASQGISNDLQWYQQKPGKAPKLLIYWENILEPDVPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNIYP
Dipodomys ordii V692 igkv ABRO02073559.1 11411 SNGDVVLTQTPRSLPVTLGEAASISCRSSQSLLHGDGNTYLYWFLQKPGQSLHRLIYLVSKRGSGVPDRFSGSGSGTDFTLTISRVEAEDIGVYYCFQGTYLP
Dipodomys ordii V693 igkv ABRO02073561.1 863 ALCDIQMTQSPSSLSVSLGDTATITCRASEDIGYFLAWHQQQPGKAPKSLIYSADSLESGVPPRFSGSGHGTEFTLTISSLQPEDVATYYCQQAFSTP
Dipodomys ordii V694 igkv ABRO02073576.1 8786 TRCDIQMTQSPSTLSASPGDTVTIKCQASQGISNELSWYQQKPGKAPKLLIYGANRLQFGIPSRFSGSGLGTEFTLTISSLQPEDVASYFCMQDYND
Dipodomys ordii V695 igkv ABRO02073577.1 13699 SSGNVVMTQTPLSFPVTLGELTSISCRSSQNFLYSNGNTYLKWFLQKRGVSPQLLISEVSNRESGISERLSGSGSGTDSTLKISSVETEDAGVYYCCQA
Dipodomys ordii V696 igkv ABRO02073896.1 22181 SSGDVVMTQTPSSLPVTLGQLASISCRSSQSLLYSDGNTYLDWYLQKPGQSPQPLIYLVSKRASGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCFQA
Dipodomys ordii V697 igkv ABRO02073901.1 9885 SNGDIVMTQTPLSLAVTLGETVSLSCRSSQSLIYSDGDSLLYWFLQKPGQSPQRLIYWATNRGSGVPDRFSGSGSGTDFTLQISRVEAEDIGVYYCMQSIANP
Dipodomys ordii V698 igkv ABRO02073905.1 43673 AKCDIQMTQSPSSLSVSLGDTATITCKASEDIGYILAWYQQHPGKAPKLLIYGADILESGVPSRFSGSGSQSGTEFTLTISGLEPEDVATYYCQQYNNFP
Dipodomys ordii V699 igkv ABRO02073905.1 29895 TSCDILVTQSPSSLSASVGDRVPITCKASQGISDDLQWYQQKPGKTPKLLIYWANNLVSGVPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQGNSYP
Dipodomys ordii V700 igkv ABRO02073905.1 18533 ARCGIQMTQSPSTLSASVGGTATITCRASGNIYGSLAWYEQKLGKAPKLLIYASSNLVFGVPSRFSGSGYGTEFTLTISSLQPEDVATYYCQNYYGYS
Dipodomys ordii V701 igkv ABRO02073906.1 11728 AKCDIQMTQSPSSLSVSLGDTATITCRASEDIGYGLAWYQQQPGKAPKLLIYVADSLESGVPSRFSGSQSGLEFTLTISDLEAEDTASYYCQQGSSIP
Dipodomys ordii V702 igkv ABRO02073911.1 1747 TRCDIQMTQSPSTLSASPGDTVTIKCQASQYISNELNWYQKKPGKAPKLLIYGANRLQFGIPSRFSGSGLGTEFTLTISSLQPEDIATYYCQQHYDN
Dipodomys ordii V703 igkv ABRO02073912.1 879 SSGDIVMTQTPLSLPVTLGETVSLSCRSSQSLIDSDGDILLYWYLQKPGQSPKLLIYWASKRPSGVPERFSGSGSGTDFTLQISRVEAEDIGVYYCMQGIDTP
Dipodomys ordii V704 igkv ABRO02073916.1 1666 IIMTQTPLSLPVTLGEMVSLSCRSSQSLLYSDGDSLLSWFLQKPGQSPQRLIYWATNRGSGVPDRFSGSGSGTDFTLQISRLQGEDIGVYYCMQGYTP
Dipodomys ordii V705 igkv ABRO02073920.1 804 ARCDIQMTQSPSTLSASVGGTATITCRASGNIYRNLAWYQQKLGKAPKLLIYASSALASGVPSRFSGSGYGTEFTLTISSLQPEDVATYYCQHGYGDP
Dipodomys ordii V706 igkv ABRO02074226.1 26166 SSADIVMTQTPHSLMVAPEEPVSVSCKSSESLLHTYGNTYLHWYLQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLTISRVKPEDAGVYYCQQETKRP
Dipodomys ordii V707 igkv ABRO02074226.1 3748 SCGDIVMTQTPLSLSIKPEEPASISCKSSESLLHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLKISKVKPEDAGVYYCGHNKNDP
Dipodomys ordii V708 igkv ABRO02074227.1 34683 SCGDIVMTQTPPLLSINPEEPASISCKSSESPLYSDGNTYLNWYLQKPGQSPQPLIYTVSNRFTGVPDRISGSGSGMDFTLTISRVKPEDEGVYYCQQSSKY
Dipodomys ordii V709 igkv ABRO02074227.1 28444 SSADIMMTQTPLSMSIKPEEPASISCKSSESLLHSNGNTYLNWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGTGSGTDFTLTISRVKPEDAGVYYCQQETKLP
Dipodomys ordii V710 igkv ABRO02074227.1 4224 SSADIMMTQTPPSLIVAPEEPASISCKSSESLLHSDGNTYLHWYLQKPGQSPQLLIYRVSNRFTGVPDRCSGSGSGTDFTLTISKVKPEDAGVYYCQQ
Dipodomys ordii V711 igkv ABRO02074230.1 9761 ARCDIQMTQTPSSLSASPGDTVTINCRASQNINKYLAWFQQKHGKPPKRLIYGTSNLDSAFPSRFSGSGSGTDYSLTISSLQPEDGATYFCTQGYSYP
Dipodomys ordii V712 igkv ABRO02074230.1 1910 AKCDIQMTQTPSSLSASPGDTVTINCRASQGINKYLAWFQQKPGKAPKQLIYRASNLESGVPSRFSGSGSGTDYSFTISSLQAEDFATYYCMQYDELP
Dipodomys ordii V713 igkv ABRO02074233.1 14803 AKCDIQMTQTPSSLSASPGDTVTINCRASQGISSWLAWFQQKPGKAPKRLIYKASNLGSGVPSRFSGSGSGTDYSLTISSLQAEDFATYYCMQYDKFP
Dipodomys ordii V714 igkv ABRO02074234.1 1975 AKCDIQMTQTPSSLSASPGDTVTINCRASQGISSWLAWFQQKPGKAPKRLIYKASNLGSGVPSRFSGSGSGTDYSLTISSLQAEDFATYYCMQYDKFP
Dipodomys ordii V715 igkv ABRO02074238.1 43259 TRCDIQMTQTPSSLSATPGDTVTINCRASQDISSWLSWYQQKPGKAPKPLIYKTSNLESGVPSRFSGSGSGTDYSLTISSLQPEDVATYYCQHGYGYP
Dipodomys ordii V716 igkv ABRO02074238.1 23558 ARCDIQMTQTPPSLSASPGDTVTINCRASQGINKYLAWFQQKPGKPPKRLIYYTYNLDSAFPSRFSGSGSGTDYSLTISSLQPEDGATYYCLQYHNYP
Dipodomys ordii V717 igkv ABRO02074238.1 15033 AKCDIQMTQTPSSLSASPGDTVTINCRSSQGINKYLVWFQQKPGKAPKRLIYKASNLGSGVPSRFSGSGSGTDYSLTISRLQAEDFATYYCMQYDEFP
Dipodomys ordii V718 igkv ABRO02074239.1 14512 TRCDIQMTQTPSSLSTSPGDTVTINCRASQGINSWLAWYQQKPGKAPKLLIYKASNLESGVPSRFSGSGSGTDYSLTISSLQPEDFATYFCMQHNSYP
Dipodomys ordii V719 igkv ABRO02074240.1 4528 ARCDIQMTQTPSSLSASPGDRVTINCRASQGINKYLAWFQQKPGKAPKQLIYYTSSLISGVPSRFSGSGSGTDYSLTISSLQTEDVATYYCLQYDKI
Dipodomys ordii V720 igkv ABRO02074242.1 5215 ARCDIQMTQTPSSLSATPGDTVSIKCRASQDISNWLSWYQQKPGKAPKPLIYKASNLESGVPSRFSGSGSGTDYSLTISNLQTEDFAMYYCQQFKSY
Dipodomys ordii V721 igkv ABRO02074244.1 39660 ARCDIQMTQTPSSLSASPGDRVTINCRASQGINKYLAWYQQKPGKAPKQLIYYTSSLISGVPSRFSGSGSGTDYSLTISSLQTEDVATYYCLQYDKI
Dipodomys ordii V722 igkv ABRO02074244.1 30839 ARCDIQMTQTPSSLSASLGDTVTINCRASQGISSWLAWYQQKPGKAPKLLIYEASNLESGVPSRFSGSESGTDYSLTISSLQPEDAASYFCQQYDELP
Dipodomys ordii V723 igkv ABRO02074244.1 7559 ARCDIQMTQTPSSLSASPGDRVTINCRASQGISSWLAWYQQKPGKAPKLLIYKASNLESGVPSRFSGSGSGTQFTLTISSLQPEDFATYYCQQYDSYP
Dipodomys ordii V724 igkv ABRO02074247.1 608 ARCDIQMTQTPSSLSATLGDTVSINCRASQDISNWLSWYQQKPGKAPKLLIYKASNLESGVPSRFSGRGSGTDYSLTISNLQTEDFAMYYCVQGNSY
Dipodomys ordii V725 igkv ABRO02074257.1 304 LKIGNAITQSPASLSVHPGERVTITCQTNPKENIKFSWYKQPPGRIPKPLVYDTSTRVPGVPERFSGSRSGTAFTLSISNVETNDTGSYFCLEWPG
Dipodomys ordii V726 igkv ABRO02074266.1 81578 ATCDIQMTQSPSFLSASPGDRVSFTCRASQDISNGLNWYHQKPQNAPKLLIYYANSLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQDSSYP
Dipodomys ordii V727 igkv ABRO02074266.1 62807 ARCDIQMSLSPSSLSASLVETITISCRASQGISKFLAWYQQKLGNAPKLLISYATSLASGIPSRFSGSGSGTGYSLTISSLQPEDFATYYCQQHINYP
Dipodomys ordii V728 igkv ABRO02074266.1 58615 ARCDIRMTQSPSSLSASPGDTVTISCKASQGISNYLNWYQQKPGKAPKPLIYNTSRLASGVPSRFSSSGSGTDYSLTISNLQPEDFATYYCQKYDSK
Dipodomys ordii V729 igkv ABRO02074266.1 47629 FRCDIQMTQSPSFLSASPGDRVSITCRASQGISYYLHWYQQKPEKAPKLLIYNAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQSNSFP
Dipodomys ordii V730 igkv ABRO02074266.1 23198 FRCDIHMTQSPSFLSASAGDRVSITCRASQGIIYHLNWYQQKPGNAPKLLISNAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHNSYP
Dipodomys ordii V731 igkv ABRO02074269.1 5931 FKCDIQMTQSPSFLSASPGDRVSITCRASQGINQYLNWYQQKPGNAPKLLIYNAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCLQHNSFP
Dipodomys ordii V732 igkv ABRO02074270.1 5554 ARCDIQMNQSPSSLSASPGDTVTISCKASHGISNYLNWYQQKPGKAPKPLIYYTSRLASGVPSRFSGSGSGTDYSLTISSLQPEDFATYYCQKYDSIP
Dipodomys ordii V733 igkv ABRO02074272.1 8675 FRCDIQMTQSPSFLSASPGDRVSLTCRASQGISYYLNWYQQKPGNAPKLLIYHAKNLASGIPSRFSGSQSGTEFTLTISSLQPEDFATYYCQQHNSSP
Dipodomys ordii V734 igkv ABRO02074955.1 8456 ARCEIQTAQSLSSLSLSLGDTATFTCRASERIGYSLAWYQQKPGKAPKLLIYAADTLLSGVPSRFSGDGYGTEFTLTISSLQPEYVATYYCQQGYIVP
Dipodomys ordii V735 igkv ABRO02074957.1 25707 TRCDIQMTQSPSTLPASPGDRVSITCRASQNINYGLNWYQQKPGGAPKLLIYRANNLQSGIPSRFSGSGSGTEFTLTISSLQPEDIATYYCQQYYDY
Dipodomys ordii V736 igkv ABRO02074958.1 1509 ARCDIQLTQPPSLSSSQGDRVTITCRASQGISKSLPWYQQIAGKAPKLLISYATPLQSGFPPRFSGSGSGTEFTLAISNLQPEDAATYFCQQRDSLP
Dipodomys ordii V737 igkv ABRO02074994.1 25926 YNGDVVMTQTPRSLPVTLGEPASISCRSSQSLLYSDGNTYLYWFLQKPGQSPHRLIYLVSKQDSGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQA
Dipodomys ordii V738 igkv ABRO02074995.1 11463 TRCDIQMIQSPSTLSASSGDRVSITCRASQGISNGLSWYQQKPGGAPKLLIYGANNLQSGIPSRFSGSGSGTEFTLTISSLQPEDIATYYCQQYYNI
Dipodomys ordii V739 igkv ABRO02074995.1 4454 LRCDIQMTQSPSFLSASPGDRVSITCRASQGINYYLHWYQQKPGNAPKLLIYNANSLASGIPSRFSGSQSGTEFTITISSLQPDDFATYYCLQGSSFP
Dipodomys ordii V740 ighv ABRO02075045.1 557 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSSYWMSWVRQAPGKGLEWISSIYDNSNIYYADSMKGRFTTSRDNSKSTLYLQMNSLRVEDTAMYYCT
Dipodomys ordii V741 ighv ABRO02075051.1 5397 AQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSNSWMSWICQAPGKELDWVEEINTDGGSTWYADSVKGQFTLSRDNSQSTLYLQMSSLRTADTTLYYCA
Dipodomys ordii V742 ighv ABRO02075051.1 2799 VQCEVQLVESGGDLVQPGGSLRLSCAASGLDFSDYYMHWIRQAPGKRPEWLSYISGDSSDTEYADSVKDHFTISRDNSKSTLYLQMNSLRVEDSAIYYCT
Dipodomys ordii V743 ighv ABRO02075055.1 354 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSHGMNWVRQAPGKGLEWLLYIYGSSSTYYTDSVKGRFTTSRDNSKNTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V744 ighv ABRO02075065.1 14022 VHSQIQLEQPGAEVRRPGDSVRLACRASGYTFTSYYMHWVRQKTGEGLEWIGRIDPRDGETKYTQKFQGKVSLTADTSSSTASLELSRVTAEDSAMYYCA
Dipodomys ordii V745 ighv ABRO02075065.1 3753 VQCEVQLVESGGGLVQPGGSLRLSCAVSGFTFSGYWMNWLRQAPGKGLEWISSIDGSSSTYYPDSVKGRFTISKDNSKNTLYLQMNSLRVEDTAIYYCAT
Dipodomys ordii V746 ighv ABRO02075065.1 553 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYYMDWVHQAPGKGLEWVAKIYKDGGSTWYPDSVKCRFTISRDNSKNTVYLQMNSLRVEDTAVYYCTR
Dipodomys ordii V747 ighv ABRO02075079.1 8490 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWIRQAPGKGLEWLSYISSSSSSIKYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V748 ighv ABRO02075137.1 975 TYSQVHLVQSGPELKKPGEAVKVSCKASGYTFTSYGINWVRQEPRGGLQWMGWINTYTGNPTYAEGFKGGFVFSLETSVSTAHLKISSLKAEDTAVYYCA
Dipodomys ordii V749 ighv ABRO02075138.1 6160 VQCEVQLVESGGGLVQPGGSLRLSCAASGFDFSGYWMTWICQAPGKRLEWLGEINQGGSSTNYPDSVKGRFTISSKNTLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V750 ighv ABRO02075138.1 2183 VHSQVQLEQPGAEVRRPGDSAKLACRASGYTFTSYYMHWVRQKAGQGLEWIGRIDPEDGETKYAQKFQDKVSLTADTSSSTASLELSRLTAEDSAMYYCA
Dipodomys ordii V751 ighv ABRO02075147.1 1369 GGAAGGVWGWLGAAWGSLRLSCAASFSNYWMSWVPQVPGKGLYWISSIYGSSNIYYADSVKGCFTTSRQNSTNILYQQMNSLRVEDTAIYYCA
Dipodomys ordii V752 ighv ABRO02075149.1 2580 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTNGVGVSWIRQPPGKTLEWLANVWWDDDKYYNPALKSRLSISKDSSNSQVFLTLASVDSADTATYYCAR
Dipodomys ordii V753 ighv ABRO02075150.1 2622 VQCEVRLVESGGGLVQHGGSLRLSCTASGFDFSDYYMHWIRQAPGKRPQWLSYISGDSSDPEYADSVKDRFTISRDNSKSTFYLQMNSLRVEDSAIYYCT
Dipodomys ordii V754 ighv ABRO02075156.1 1806 VQCEVQLVESGGGLVQPGGSLRLTCAASGFTFSNYYMHWVRQAPGKGLEWVARIDPGGGSTRYPESVKGRFTISRDNSKSTLYLQMSSLRTEDMALYYCAR
Dipodomys ordii V755 ighv ABRO02075161.1 15130 VQCEVRLVESGGGLVQPGRSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVAVIWYDGSQQKYMESVKGRFTISRDNSKNMLYLQMNSLKAEDTATYYCA
Dipodomys ordii V756 ighv ABRO02075167.1 413 TYSQVQLVQSGPELKKPGEAVKVSCKASGYTFTSYSINWVRQEPRGGLQWMGWINTNTGNPTYAEGFKGRFVFSLETSVSTAHLQISSLKAEDTAVYYCA
Dipodomys ordii V757 ighv ABRO02075168.1 4699 VQCEVQLVESGGGLVQPGGSLRLSCAASGFNFSSNYMSWIRQAPGKRPEWLSYISGDSSDIKYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAVYYCA
Dipodomys ordii V758 ighv ABRO02075168.1 1177 AAGGVWGRLGAAWGVLRLSCTASGFTFSEYYLDWICQSPGKGPEWLSYISGSSNDIKYADSVKGRFTISRDNSKKPLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V761 ighv ABRO02076255.1 1304 VQCEVQLVESGGDLVQPGGSLRLSCAASGFDFSNYWMSWIRQAPGKRPEWLSYISSSSSSINYADSVKGRFTISRDNSKSTLYLQMNSLRVEDTAIYYCTR
Dipodomys ordii V762 ighv ABRO02076258.1 338 VRSRIKLEQPGAEVRTPGDSAKLACQASGYTFTSYYMHWMRQKAGQGLEWIGRIDPEDGETKYAQKFQGKVSLTADTSSSTASLELSRWTVEDSAMYYCA
Dipodomys ordii V763 ighv ABRO02076261.1 2727 VQCEVRLVESGGGLVQPGGSLRLSCVASRFDFSSYDMNWLRQAPGNRPEWISYIYDSSSINYADSMKGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCAR
Dipodomys ordii V764 ighv ABRO02076263.1 1758 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTTGVAVSWIRQPPGKTLEWLANVWWDDGKSYNPALKSRLSISKDSSNSQVFLTLDSVDSADTATYYCAR
Dipodomys ordii V765 ighv ABRO02076267.1 60917 VQCEVELVESRGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWLSYFYDSSNTYYADSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYLCA
Dipodomys ordii V766 ighv ABRO02076267.1 36092 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWLSYISGDSSYIKYADSVKGRFTTSRDNSKSTVYLQMNSLRVEDMAIYYCAR
Dipodomys ordii V767 ighv ABRO02076267.1 30711 VQCEVQLVESEGILVQPGGSLRLSCAASEFTFCTYCMGWSRQAPGKGLEWVARMDPGGGSTRYPDSVKGRFTLSRDNSQSTLYLQMSSLRTEDTALYHCA
Dipodomys ordii V768 ighv ABRO02076267.1 15438 VQCEEQLMESGGGLVQPGGSLRLSCGASGFDFSDYYMHWIRQAPGKRPQWFLNISDDSSDTEYADSVKDRFTISRDNSKNTLYLQMNSLRVEDSAIYYCT
Dipodomys ordii V769 ighv ABRO02076267.1 9162 ALSQIALKESGPGLLPPSQTLSLTCSISGFSLSTTGVAVSWIRQPPGKTLEWLANVWWDDGKSYNPALKSRLSISKDSSNSQVFLTLDSVDSADTATYYCAR
Dipodomys ordii V770 ighv ABRO02076274.1 10117 VQTEDHIVQWGEGVLMSLQTLSLTCATYTFSISEYSVSWVRLRPDKSLEWIGVIWAKGSINYSPSLHSRAVISRDTGRNQVYLQLSSLTAEDSGMYYCAQ
Dipodomys ordii V771 ighv ABRO02076274.1 5634 VQCEVQLVESGGGLVQPGGSLRLSCEASGFTFSDYWMYWVRQAPGKGLEWVSLIRLKANSYTTEYATSVKGRFTISRDDGKSMLYLQMNSLRAEDTATYYCT
Dipodomys ordii V773 ighv ABRO02076664.1 5892 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVGFIRNKANGHTTEYAASVKGRFTISRDDSKSMTYLQMNSLKVEDTAVYYCTR
Dipodomys ordii V774 ighv ABRO02076664.1 526 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMNWIRQAPGKGLEWISYISYNSGTKYYTDSVKGRFTISRDNSKSTLYLQMNNLRVEDTAVYYCAR
Dipodomys ordii V775 ighv ABRO02076666.1 2217 AAGGVWRRLGAAWGVPETLCTASGFTFSDYYMSWIRQSPGKGLEWVGFIRNKANGHTTEYAASVKGRFTISRDDSKSMTFLQMNSLKVEDTAVYYCTR
Dipodomys ordii V776 ighv ABRO02076667.1 9024 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTVSGYYMSWVRQAPGKGLEWISSIYGSSSTYYADSVKGRFTISTDNSKNILYLQMNSLRVEDTAVYYCA
Dipodomys ordii V777 ighv ABRO02076839.1 7790 VQCEVRLVESGRGLVQPGGSLRLSCAASGFTFSDYYMDWIRQAPGKGLEWVARIDPGGGSTRYADSVKGRFTLCRDNSQSTLYLQMSSLRTEDTALYHCA
Dipodomys ordii V778 ighv ABRO02076841.1 1364 VQCEVQLVESGGGLVQPGGSLRLSCAASGFGFSSYYMNWLCQAPGKRPEWLSYINSDSSYIKYAECVKGRFTTSRDNSKNTLYLQMNSLRVEDTAIYYCAT
Dipodomys ordii V779 ighv ABRO02076847.1 528 VQCEVWLVESGGGLVQPGGSLRLSCAASGFDFSDYWMSWIRQAPGKRPEWLSYISGDSNSIYYADSVKGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCAT
Dipodomys ordii V781 igkv ABRO02077445.1 2563 AKCDIQMTQSPSSLSVSLRDTATITCRASKGIGYYLAWYQQQPGKAPKLLIYGTNGLESGVPSRFSGSKSGTEFTLRISGLEPEDVATYYCQQYSNFP
Dipodomys ordii V782 ighv ABRO02077548.1 7475 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVAVIWYDGSQQKYVESVKGRFTISRDNSKNMLYLQMNSLKAEDTATYYCA
Dipodomys ordii V783 ighv ABRO02077559.1 2653 VQCEVQLVNSGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKRPEWFSYISGDSSDTEYADSVKDRFTISRDNSKSTLYLQMNSLRVEDSAIYYCT
Dipodomys ordii V784 trbv ABRO02077971.1 2356 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHNTVYWYQQAEDQRFQFLISYYRESEREKGSIPGHFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V785 trbv ABRO02077972.1 3889 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHDTVYWYQQAEDQRFQFLISYYRESKREKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V786 trbv ABRO02077974.1 1812 VVHAGVLQSPRHLIKAKGGKATLQCSPDSGHYTVYWYQQAEDKTLQFLISYFEESERHKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASSLHSP
Dipodomys ordii V787 trbv ABRO02077975.1 2758 HTDSGVSQSPRHKVTKRGHTVLLKCNPISGHGCLYWYRQTPGQGLEYLTHFQYEVAAEKPEMPVERFSAQRPNGSVWTLKMQPAEQGDSALYLCASCQ
Dipodomys ordii V788 trbv ABRO02077981.1 1967 VVHAGVLQSPRHLIKAKGGKAILQCSPDSGHNTVYWYQQAEDKSLQLLISYYRESEREKGSIPERFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V789 trbv ABRO02077982.1 446 VVHAGVLQSPRHLIKAKGGKAILQCSPDSGHDTVYWYQQAEDKSLHFLISYYRELEREKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V790 igkv ABRO02078019.1 3662 VVMTQTPRSLHVTLGESASISCRSSQSLLHSNGKTYLHWYLQKPGQSPHQLIYLISKLASGVPDRFSGSGSGTYFTLTISSMEAEDVGVYYCLQG
Dipodomys ordii V791 igkv ABRO02078022.1 1096 TRCDIQMTQSPSTLSASPGDRVTITCQASQGISNVLNWYQQKPGGAPKLLIYGAKYLQSGIPSRFSGSGSGTEYTLTISSLQPEDIATYYCQQYYI
Dipodomys ordii V792 igkv ABRO02078329.1 1636 ARCDVLMTQSPSYMSASVGDRVSITCRASQGIGTNLHWYQQKPRKAPKLLIYWANSLQTGVPSRFSGSISGEEYTLTISSLQPEDFATYYCQQGSRYP
Dipodomys ordii V794 trbv ABRO02081652.1 1528 VVHAGVLQTPRHLIKAKGGKATLQCSPDSGHDTVYWYQQAEDKSLQLLVSYFGESELEKGSIPGRFSARQFSDYHSELNMSALELRDSALYLCASS
Dipodomys ordii V801 igkv ABRO02093169.1 3626 SSGDVVMTQTPRSLLVTLGEPASISCRSSQSLLYSNGNTHLSWYMQKPGQSPHQLIYLVSKRDSGVPDRFSGSGSGTDFTLTIIRVEAEDLGVYYCLQR