WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mandrillus leucophaeus JYKQ00000000.1 (JYKQ01) 283 63 44 62 45 56 7 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mandrillus leucophaeus V7 trgv JYKQ01003190.1 996 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGIYYCATWD
Mandrillus leucophaeus V8 trgv JYKQ01003191.1 1262 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISSGKYDSYGSTRRRNLRLRLQNLIENDSGVYYCANWD
Mandrillus leucophaeus V9 trgv JYKQ01003191.1 5606 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Mandrillus leucophaeus V10 trgv JYKQ01003194.1 13854 HLEQPQISSTKMLSKTARLECVVSGVTISQTSIYWYRERPGEVIQFLVCILYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Mandrillus leucophaeus V11 trgv JYKQ01003194.1 31034 EQFQLSISTEVKKSIDISCKIRSTNFENDVIHWYWQKPNQALEHLLYIISTKSAVHGSMGKRSNKVEARKNSQTSTSILTIKSVEKQDMAIYYCAGWD
Mandrillus leucophaeus V12 trgv JYKQ01003195.1 7351 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Mandrillus leucophaeus V13 trgv JYKQ01003195.1 9357 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Mandrillus leucophaeus V16 ighv JYKQ01005758.1 2902 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVHQTPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITSLQMNNLKTEDTAVYYCAR
Mandrillus leucophaeus V17 ighv JYKQ01005763.1 2162 VQCEVQLVESGGGLVQPGASLRLCCAASGFTFSSTRMNWIRQSPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Mandrillus leucophaeus V18 ighv JYKQ01005763.1 9397 VCAEVQLVQSGEVKRPGESLRISCKTSGYSFTSSWISWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGHVTISADKSISTVHLQWSSLKASDTATYYCAK
Mandrillus leucophaeus V19 ighv JYKQ01005769.1 5098 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRIRNKANGYTTEYAASVKGRFTISRDDSKNTLYLQMSSMKTEDTAVYHCAR
Mandrillus leucophaeus V20 ighv JYKQ01005770.1 7259 VQCEVQLVESGGGLVQPGRSLRLSCATSGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNMLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V21 ighv JYKQ01005771.1 9001 VQCEVQLVEYGGGLVQRGGSLRLSCGFTFSVHFMSWVHQAPAKGLEWVGFMRNKANGGTTEYATSVKGRSTISRADSKSMASLQMSSLNTEDTAVYYCAR
Mandrillus leucophaeus V22 ighv JYKQ01005772.1 6870 VQGEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Mandrillus leucophaeus V23 ighv JYKQ01005772.1 16445 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVARIKSKADGETANYAASVKGRFTISRDDSKNTLYLQMNSLKTEETAVYYCTT
Mandrillus leucophaeus V24 ighv JYKQ01005772.1 36474 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWISAINSAGSSIYYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Mandrillus leucophaeus V25 ighv JYKQ01005773.1 3693 VQCEVQLVESGGGSIQPGASLRLCCAAPGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCVR
Mandrillus leucophaeus V26 ighv JYKQ01005773.1 11325 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSNWISWVRQMPGKGLEWMGMIDPSDSDTRYSPSFQGQVTISADKSISTTYLQWSSLKASDSATYYCAK
Mandrillus leucophaeus V27 ighv JYKQ01005774.1 1634 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSNWISWVRQMPGKGLEWMGMIDPSDSDTRYSPSFQGQVTISADKSISTTYLQWSSLKASDSATYYCAK
Mandrillus leucophaeus V28 ighv JYKQ01005774.1 20411 VQGGVQLVESEGNFVQPGGSLRLSCAVSGFTFSSYDLDWIRHAPGKGLEWVSGISIAGSTYYANSVKGRFAISIDNAKNTLYLQMNSLIAEDTAIYYCVSE
Mandrillus leucophaeus V29 ighv JYKQ01005774.1 31524 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Mandrillus leucophaeus V30 ighv JYKQ01005777.1 21928 VQCEVQLVESRGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Mandrillus leucophaeus V31 ighv JYKQ01005777.1 46861 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWVRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARG
Mandrillus leucophaeus V32 ighv JYKQ01005784.1 1526 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSSYYMYWIRQAPGKGLEWVSAINTGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Mandrillus leucophaeus V33 ighv JYKQ01005787.1 1656 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGPEWVGFIRNKARGGTAEYAASVKGRFTISRDDSKNVTYLQMSSLKTEDTAVYYCTT
Mandrillus leucophaeus V34 ighv JYKQ01005787.1 14729 VLSQVTLKESGPALVKPTQTLTLTCTVSGFSLTTSGVGVSWIRQAPGKALEWLAHIYWTDSKYYSPSLKSRLTISKDTSKNQVVLTITNTDPVDTATYYCARG
Mandrillus leucophaeus V35 ighv JYKQ01005788.1 4953 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGIIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V36 ighv JYKQ01005789.1 14346 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWARQAPGKGLEWVSAINNGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Mandrillus leucophaeus V74 trbv JYKQ01029804.1 8289 HTEPEVTQIPSHQVTQMGQEVILQCVPIPNHLYFYWYRQILGQKVEFLVIFFNNNISEKSEIFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Mandrillus leucophaeus V75 trbv JYKQ01029805.1 2388 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDTMYWYKQDSKKLLNIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHITSLELGDSAVYFCASSQ
Mandrillus leucophaeus V76 trbv JYKQ01029805.1 7013 PIDTGITQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKAKKPPEIMFMYNYETLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Mandrillus leucophaeus V77 trbv JYKQ01029807.1 1957 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNGKISEQSEIFDDRFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Mandrillus leucophaeus V78 trbv JYKQ01029807.1 9553 SLDTAVPQTPKYLVTQTGKEESVKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKQLFINETVSNRFSPDSPDKARLILHIKSLELGDSAVYFCASSQ
Mandrillus leucophaeus V79 trbv JYKQ01029807.1 18090 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDEISDKSEMFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Mandrillus leucophaeus V80 trbv JYKQ01029807.1 28943 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLQALQPEDSALYLCASSQ
Mandrillus leucophaeus V81 trbv JYKQ01029807.1 39839 PVEAGVTQTPRSLIKMRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQREKGKFPSRFSGRQFSNSRSEMNVSTLELEDSALYLCASSL
Mandrillus leucophaeus V82 trbv JYKQ01029809.1 774 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYQQDPGMGLRLIHYSATEDTTDPGEVPDGYSVSRLNKKEFLLKLESAAPSQTSVYFCASSE
Mandrillus leucophaeus V83 trbv JYKQ01029809.1 15373 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKEPILNETVPNRFSPKSPDKAHLNLHIKSVELGDSAVYFCASSQDIALQ
Mandrillus leucophaeus V84 trbv JYKQ01029809.1 18793 PMDTGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKARKPPELMFIYNFKEPAENNSVPSRFVPECPDSSLFYLHLHALQPEDSALYLCASSQ
Mandrillus leucophaeus V85 trbv JYKQ01029809.1 33266 PVNAGVTQTPKFQILKTGQNMTLKCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPDGYNASRLNPQNFLLRLESAAPSQTSMYFCASSE
Mandrillus leucophaeus V86 trbv JYKQ01029809.1 37009 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Mandrillus leucophaeus V87 trbv JYKQ01029811.1 570 HTGAGVSQFPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAVDDSGLRSDRFSATRPEGSVSTLKIRHTEQGDSATYFCASSL
Mandrillus leucophaeus V88 trbv JYKQ01029811.1 5613 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Mandrillus leucophaeus V89 trbv JYKQ01029811.1 8289 SVDSGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLVQYYNGEEREKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Mandrillus leucophaeus V90 trbv JYKQ01029811.1 16286 HRDAEIIQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNEGEVPDGYSVSRSNKEDFPLTVESAASSQTSVYFCASSE
Mandrillus leucophaeus V113 ighv JYKQ01041707.1 10256 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKAEDTAMYYCAR
Mandrillus leucophaeus V114 ighv JYKQ01041713.1 30685 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGYIRSKSNNYATQYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAMYYCTT
Mandrillus leucophaeus V115 ighv JYKQ01041713.1 41672 LVQPGESLRLSCAASGFTFSDYYMDWVCQAQGRGWSGLATQTLFLNKANSYTTEYAASVKGRFTISRDDSENTLYLQTSSMNTEDTAVYYCAR
Mandrillus leucophaeus V116 ighv JYKQ01041713.1 51471 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIASLQMSSLKTEDTAVYYCAR
Mandrillus leucophaeus V117 ighv JYKQ01041713.1 71053 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVSYISSGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAG
Mandrillus leucophaeus V118 ighv JYKQ01041718.1 4154 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITADTSTSTGYMELSSLRSEDTAVYYCTR
Mandrillus leucophaeus V119 ighv JYKQ01041718.1 11511 VQGEVQLVESRGGLAKPGGSLRLSCAASGFTFSGYNMYWVRQASGKGLEWVSGISYTGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V120 ighv JYKQ01041718.1 32029 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFGDYTMHWVRQAPGKGLEWVSYISSASSYIHYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCTR
Mandrillus leucophaeus V121 ighv JYKQ01041720.1 765 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLANIYWDDGKYYSPSLKSRLTISKDTSRKQVVLTMTNMDPVDTATYYCARG
Mandrillus leucophaeus V138 igkv JYKQ01051971.1 981 SSGDALMTQPLLSLPVTPSEPASISCRSSHSLLHSNGYTYLNWDLQKPGQPPWLPIYLISNWDPGVLDRFSGSGSVADFMLKISRVDAEDAGVYYCQQS
Mandrillus leucophaeus V139 igkv JYKQ01051981.1 561 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKASGLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQFSSAL
Mandrillus leucophaeus V140 igkv JYKQ01051984.1 155 TTGEIVMTQSPATWALSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Mandrillus leucophaeus V141 igkv JYKQ01051984.1 27107 ARCDIQMNQSPSSLSASVGDTVTITCRANQGISNNLAWYQQKPGKVPQLLIYYASSLASGIPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQHNSYP
Mandrillus leucophaeus V142 igkv JYKQ01051985.1 4008 TTVEIVMTQSPATLSLSPGERATLSCRASQSVSSYLSWYQQKPGQAPRILIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYFCPQSSNW
Mandrillus leucophaeus V145 igkv JYKQ01052451.1 83744 SGDIILNQTPASLTAPPGETVSFSCQASADVHGEISWIWIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTNYVFSISDLQPGDSGEYYCMHDYGWP
Mandrillus leucophaeus V146 igkv JYKQ01052451.1 138346 TSGDILLTQTPLSLPVTTGEPASISCRSSQSLLHSNENTYLHWYLQKPGQSPQLLIYEVSNRASGVPERLSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Mandrillus leucophaeus V147 igkv JYKQ01052451.1 143242 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALQNP
Mandrillus leucophaeus V150 trav JYKQ01054912.1 2475 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQRDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQLKDSASYFCALR
Mandrillus leucophaeus V151 trav JYKQ01054915.1 5557 MCLILVTTGQNIDQPTEMTAMEGAIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Mandrillus leucophaeus V152 trav JYKQ01054925.1 5043 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Mandrillus leucophaeus V153 trav JYKQ01054929.1 1550 TLSLAKTTQPISMGSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIENEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Mandrillus leucophaeus V154 trav JYKQ01054933.1 11631 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLIYILSNMDLKRDQRVTVLLNKKDKHLSLRIADTQTEDSAIYFCAES
Mandrillus leucophaeus V155 trav JYKQ01054940.1 18105 GINGDSVVQTEGQVLLSEGNSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMKDNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Mandrillus leucophaeus V156 trav JYKQ01054940.1 31346 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPISLTIMTFSENTKSNGRYIATLDADTKQSSLHITAAQLSDSASYICVVS
Mandrillus leucophaeus V157 trav JYKQ01054940.1 35285 VNRLCTLQQSPSFLSIQEGMHAILNCTFQVRTLFNFHWFLQDPGKGFVSLTLIQSSQKEQGDKYFQELLGKEKFYSVWNLPDSHPGGSATYFCALWQCLP
Mandrillus leucophaeus V158 trav JYKQ01054940.1 46971 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSAYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVY
Mandrillus leucophaeus V159 trav JYKQ01054940.1 52432 GTRAQSVTQLDSQVSVSEGAPVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLRKASAHVSDAAEYFCAVS
Mandrillus leucophaeus V160 trav JYKQ01054942.1 16189 VNGENVEQHPSILSVQEGDSSVIKCTYSDSASNYFPWYKQELGKEPQFIIDIRSNAHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Mandrillus leucophaeus V161 trav JYKQ01054942.1 38706 VWSQQKVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQPSDSATYLCAV
Mandrillus leucophaeus V162 trav JYKQ01054942.1 45192 GTKAQSVTQLDSQVSVSEGVPVLLRCNYSSSFPPTLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Mandrillus leucophaeus V163 trav JYKQ01054942.1 50754 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKHSVHWSDAAEYFCAAG
Mandrillus leucophaeus V164 trav JYKQ01054942.1 64628 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIIDIRSNMAKRQGQRLTVFLNKTMKHLSLQIAATEPGDSAVYFCAEN
Mandrillus leucophaeus V165 trav JYKQ01054942.1 70520 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSAMYFCAMR
Mandrillus leucophaeus V166 trav JYKQ01054942.1 88858 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKATKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Mandrillus leucophaeus V167 trav JYKQ01054942.1 113523 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPNDSATYFCAMS
Mandrillus leucophaeus V168 trav JYKQ01054944.1 3304 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Mandrillus leucophaeus V169 trav JYKQ01054948.1 817 GTRAQSVTQPEKILSVFKGAPVELKCYYSYSGSPDLLWYVQYPKQRLQLLLRHIPRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Mandrillus leucophaeus V170 trav JYKQ01054953.1 3498 VNSQQGEEDPQTLSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLILIRSNEREKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Mandrillus leucophaeus V171 trav JYKQ01054957.1 3988 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Mandrillus leucophaeus V172 trav JYKQ01054957.1 7208 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYYSKFQKSTSSFNLTITASQVVDSAVYFCALNE
Mandrillus leucophaeus V173 trav JYKQ01054957.1 42946 LSGEDQVTQSPEALSLQEGDSSSLNCSYTVSGLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Mandrillus leucophaeus V174 trav JYKQ01054958.1 3113 VSSKQEVKQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGHSTLYITASQPSDSATYLCAV
Mandrillus leucophaeus V175 trav JYKQ01054966.1 1128 VRGIQVEQSPPDLILQEGANSTLRCNYSATVSSLQWFHQNPWGQLINLFYITSGTKQNGRLSATTVTKERYSLLHISSSQTTDSGIYFCAVEPQCSP
Mandrillus leucophaeus V191 iglv JYKQ01062966.1 12024 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSYVYWYQQRPGSAPTTVIYSDDQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSS
Mandrillus leucophaeus V196 ighv JYKQ01067073.1 703 VRCEVQRVESGGGLVQPGGSLRLSCAASGFTISSSWMNWDFQAPGKGLECVSHIISGGSTDYPDSFKGRFTISRDNTKNTLYVQKNSLRAEDMAVYYCAR
Mandrillus leucophaeus V197 ighv JYKQ01067101.1 5044 TQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYGINWVRQAPGQGLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELNSLRSDDTAVYYCAR
Mandrillus leucophaeus V198 ighv JYKQ01067101.1 30148 VLSQVQLQESGPGVVKPSETLSLTCAVSGASISSGYYYWSWIRQPPGKGLEWIGGIYSNSGSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V225 igkv JYKQ01079834.1 1748 TTGEIVLTQSPATLALSPGEGATLSCRASQSVSRYSSWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQSNNW
Mandrillus leucophaeus V236 ighv JYKQ01086555.1 11853 VQCEVQLVESGGGVVQPGGSLRLLCAASGFTFDDYAMHWVRQAPGKGLEWVSAISWDGDSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V298 iglv JYKQ01114545.1 3564 VDSETVVTQEPSLSVSSGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYRTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMGSGI
Mandrillus leucophaeus V320 trbv JYKQ01131089.1 3077 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNEDVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Mandrillus leucophaeus V321 trbv JYKQ01131090.1 8546 HRDAEITQSPRYKVTETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIYYSAGASIIDKGEVPDGYVVSRSKTEDFPLTLESATRSQTSVYFCASSE
Mandrillus leucophaeus V322 trbv JYKQ01131090.1 17697 LTEAGVVQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGLELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Mandrillus leucophaeus V323 trbv JYKQ01131090.1 36299 PVNAGVTQTPKFQILKTGQSMTLQCAQDMNHDCMYWYRQDPGMGLRLIHYSVGEGSTDKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Mandrillus leucophaeus V324 trbv JYKQ01131090.1 40490 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQAPGQGPAFLTYFQNDAQRDKSGLPNDRFSAEMPEGSVSTLKIQRTEQGDSAVYLCASSL
Mandrillus leucophaeus V325 trbv JYKQ01131090.1 48410 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGQGLQFILWYDEEEQRDRGTFPHRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Mandrillus leucophaeus V326 trbv JYKQ01131090.1 60132 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVALYWYRRTLGQGPEFLTYFQNDAQPDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDAAVYLCASSL
Mandrillus leucophaeus V327 trbv JYKQ01131091.1 1115 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSL
Mandrillus leucophaeus V328 trbv JYKQ01131092.1 11 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSLAQPGR
Mandrillus leucophaeus V329 trbv JYKQ01131092.1 3326 LVNAGVTQTQKFQVLKTGQSMTVQCAQDMNHDCMYWYRQDPGMGLRLIHYSDAAGTTDKREVPSGYNVSRLNIEDFPLRLESAAPSQTSVYICASSY
Mandrillus leucophaeus V330 trbv JYKQ01131093.1 13831 SVDAGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYKRALGQGPQFIFQYYEKEERERGNFPGRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Mandrillus leucophaeus V331 trbv JYKQ01131093.1 22879 LFSAGPGNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMSWYRQDPGVGLRLIHYSVGAGVTDKGEVSNGYNVSRLNTEDFPLSLESAASSQTSVYFCASSY
Mandrillus leucophaeus V332 trbv JYKQ01131094.1 5378 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPELLTYFQNDAQLDKSGLPSDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Mandrillus leucophaeus V333 trbv JYKQ01131094.1 13820 PVDTGVTQSPTHLIKTRGQQVILRCSPISGHSSVYWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Mandrillus leucophaeus V334 trbv JYKQ01131094.1 21289 PGNADVTQTPKFQVLKTGQSLTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVFRLNTEDFPLRLESAALSQTSVYFCASS
Mandrillus leucophaeus V335 trbv JYKQ01131095.1 9159 PVDTGVTQSPTHLIKMRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Mandrillus leucophaeus V336 trbv JYKQ01131096.1 2551 PVNAGVTQTPKFQVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESAAPSQTSVYFCASSY
Mandrillus leucophaeus V337 trbv JYKQ01131098.1 4347 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAGLYWYQQALGQGPEFLTYFNYQAQPDKSGLPNDRFSAERHEGSVSTLTIQRTEQQDSAVYLCASSL
Mandrillus leucophaeus V338 trbv JYKQ01131101.1 107 PVDAGVAQSPTHLIKTRGQQVTLRCSPISGHNTVYWYQQALGQGPQLIFQYYRGEDRGRGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Mandrillus leucophaeus V339 trbv JYKQ01131101.1 9055 HTDARVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDSAVYLCASSL
Mandrillus leucophaeus V340 trbv JYKQ01131101.1 15541 SVAAGVTQAPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASSL
Mandrillus leucophaeus V341 trbv JYKQ01131101.1 23982 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGRGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Mandrillus leucophaeus V342 trbv JYKQ01131101.1 35040 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNSGQGPELLVRYENEEAVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Mandrillus leucophaeus V343 trbv JYKQ01131102.1 2950 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHTYLFWYRQTMMQGLEFLIYFNNKDPTDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Mandrillus leucophaeus V344 trbv JYKQ01131102.1 18188 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLVYLRNKASLDDSGMPKDRFSAEMPNASLATLKIQPSEPRDSAVYLCASGL
Mandrillus leucophaeus V345 trbv JYKQ01131102.1 25141 HTEAGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVMGKEIKFLISFMRVSTQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Mandrillus leucophaeus V346 trbv JYKQ01131102.1 30164 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Mandrillus leucophaeus V347 trbv JYKQ01131102.1 35123 SPGEEVTQTPKHLVKGEGQKAKLYCDPIKGHSYVFWYQQVLRKEFKFLISFQNKNVFDETGMPKERFSAKCHANSPCSLEIQATKLKDSAVYFCASSQ
Mandrillus leucophaeus V348 trbv JYKQ01131103.1 16378 LSNAGITQNPRHLVRRRGQEARLRCSPTKEHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEQFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Mandrillus leucophaeus V349 trbv JYKQ01131104.1 2285 TVDGGITQSPKYVFRKEGQNVTLSCEQNLNHNAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKQSFPLTVTSAQRNPTAFYLCASSI
Mandrillus leucophaeus V350 trbv JYKQ01131104.1 10187 GSGLAAVISQYPNRFICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNGDSDVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Mandrillus leucophaeus V351 trbv JYKQ01131104.1 20315 STDTKVTQRPRLLVKANGQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDAALYYCASSK
Mandrillus leucophaeus V352 trbv JYKQ01131105.1 772 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQDEQVLQETELHKKRFSSQCRKNLPCSLEIPSSEPGDTALYLCASSQ
Mandrillus leucophaeus V353 trbv JYKQ01131107.1 8153 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISDGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Mandrillus leucophaeus V354 trbv JYKQ01131107.1 16642 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDYSSKSTVSRLRIEHFPLTLESTSPSHTSQYLCASSE
Mandrillus leucophaeus V355 trbv JYKQ01131110.1 21385 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSSNVELVDKGDIPEGYNVSRKEKTTFPLILESPSPSQTSLYFCASSY
Mandrillus leucophaeus V356 trbv JYKQ01131110.1 26753 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSTSTNQTSMYLCASSL
Mandrillus leucophaeus V357 trbv JYKQ01131111.1 5909 SVFSAVISQKPSRDVCQRGTSVTFQCQVDSQVTMMFWYRQRPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Mandrillus leucophaeus V367 trav JYKQ01135379.1 428 SGRADWLKPQETEVSGTEGKTVNLLCNCGTSSGSYFDLYWFQQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Mandrillus leucophaeus V368 trav JYKQ01135385.1 1629 SGMAQTVTQSQPEVSVREAETVTLSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Mandrillus leucophaeus V369 trav JYKQ01135388.1 4502 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYRS
Mandrillus leucophaeus V370 trav JYKQ01135389.1 2806 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Mandrillus leucophaeus V371 trav JYKQ01135389.1 19855 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINTQERHSSLHIAASQPRDSAIYICAV
Mandrillus leucophaeus V372 trdv JYKQ01135390.1 36952 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Mandrillus leucophaeus V373 trdv JYKQ01135394.1 6965 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Mandrillus leucophaeus V457 igkv JYKQ01187326.1 1361 TTGETVVTQSPATLSVSPGERATISCRTSQSVGSRLAWYQQKPGQAPRLLIYGASNRATGIPDRFSGSGSGTDFTLTISSLKPEDAAVYYCQQDNDWK
Mandrillus leucophaeus V458 igkv JYKQ01187337.1 7814 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSNLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQGNSI
Mandrillus leucophaeus V577 ighv JYKQ01245859.1 893 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWIGWINPYNGNTKYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Mandrillus leucophaeus V578 ighv JYKQ01245874.1 7329 VRCEVQLVESGGGVVQPEGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNGDSTYYADSVKGRFTISRDNAKNSLFLQMNRLRAEDTAVYYCAKD
Mandrillus leucophaeus V579 ighv JYKQ01245874.1 37998 VQCEEQLVESGGGLVQPGASLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTVSRDNAKNSLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V580 ighv JYKQ01245876.1 15393 VLSQLQLQESGPGVVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGSIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V581 ighv JYKQ01245876.1 36257 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSRINSDGSSTNYADSVKGRFTISRENAKNSLYLQMNSLRAEDTAVYYCTT
Mandrillus leucophaeus V582 ighv JYKQ01245880.1 7640 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMHWARQAPGKGLEWVSRISSGSGSSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V583 ighv JYKQ01245881.1 6179 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGFIKNKADGGTADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Mandrillus leucophaeus V584 ighv JYKQ01245882.1 18029 AHAQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTNTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCAR
Mandrillus leucophaeus V585 ighv JYKQ01245882.1 35103 AHSEVQLVQSGAEVKKPGATVKISCKASGYTFTDYYLHWVRQAPGKGLEWMGRVDPEDGEADYAQKFQDRLTMTADTSTDTAYMELSSLRSEDTAVYYCTR
Mandrillus leucophaeus V586 ighv JYKQ01245886.1 244 FQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Mandrillus leucophaeus V587 ighv JYKQ01245888.1 1667 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYVSWVRQAPGKGLEWVGFMRNKANGGRTEYAASVKGTFTISRDDSKSIASLQMSSLKTEDTAVYYCAR
Mandrillus leucophaeus V588 ighv JYKQ01245888.1 18545 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISDSYYWSWIRQAPGKGLEWIGGIYGSGSSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V589 ighv JYKQ01245889.1 13018 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSGISNTGGSIYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Mandrillus leucophaeus V590 ighv JYKQ01245890.1 4930 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYAMHWVRQAPGKGLEWVSVISTSGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Mandrillus leucophaeus V591 ighv JYKQ01245900.1 4136 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTTGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Mandrillus leucophaeus V592 ighv JYKQ01245904.1 631 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSAISWDGDSTGYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V605 trav JYKQ01004174.1 7717 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Mandrillus leucophaeus V607 igkv JYKQ01005004.1 12759 SDTTGETVMTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLVYYASSRATGIPDRFSGSGSGTDFTLTISSLDPEDVGVYYCQKYNDWP
Mandrillus leucophaeus V608 igkv JYKQ01005007.1 10065 TTGEIVMTQSPATLSLSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYNNWN
Mandrillus leucophaeus V609 igkv JYKQ01005012.1 4669 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTVFTLTISSLQSEDFATYYCLQYNS
Mandrillus leucophaeus V610 igkv JYKQ01005013.1 8969 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSAP
Mandrillus leucophaeus V611 igkv JYKQ01005014.1 4670 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Mandrillus leucophaeus V612 igkv JYKQ01005017.1 9078 TTGEIVLTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYHDWS
Mandrillus leucophaeus V613 igkv JYKQ01005017.1 8859 RFSGSGSRTEFTLTISSLEPEDVGVYHCQQYHDWSPTVIPPETKTSTRPSVFTDYTSCFLYRQLVRWPLSFSISALFGYFGVHVLKSKMNYICP
Mandrillus leucophaeus V614 igkv JYKQ01005018.1 22300 TTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSLAWYQQKPGQVPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNWP
Mandrillus leucophaeus V615 igkv JYKQ01005018.1 9702 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSNP
Mandrillus leucophaeus V616 igkv JYKQ01005019.1 589 TTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSLAWYQQKPGQVPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNWP
Mandrillus leucophaeus V617 igkv JYKQ01005022.1 4924 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Mandrillus leucophaeus V618 igkv JYKQ01005026.1 1166 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Mandrillus leucophaeus V619 igkv JYKQ01005027.1 13167 VRGDIQMTQSPASLSASVGDRVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSTP
Mandrillus leucophaeus V620 igkv JYKQ01005032.1 50900 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Mandrillus leucophaeus V621 igkv JYKQ01005033.1 19733 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSRSF
Mandrillus leucophaeus V622 igkv JYKQ01005040.1 18706 TRCAIQMTQSPSSLSASVGDRVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGADFTLTISSLQPEDVATYYCQKCDSAP
Mandrillus leucophaeus V623 igkv JYKQ01005045.1 10566 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIHGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQHRALP
Mandrillus leucophaeus V624 igkv JYKQ01005048.1 1761 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSNGNTYLSWLQQKPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQV
Mandrillus leucophaeus V641 ighv JYKQ01015003.1 410 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGSYGWNWIRQPPGKGLEWIGRIYGSSGNTYYNPSLKSRVTISRDTSKNQFSLKLSSVAAADTAVYYCAR
Mandrillus leucophaeus V642 ighv JYKQ01015024.1 727 AHSQEQLVQSGAEVKKPGASVKVSCKASGYIFTGYIISWLRQAPGQGFEWMGGIHPGYGSTSYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAMYYCAA
Mandrillus leucophaeus V643 ighv JYKQ01015026.1 375 AHSEMQLVQSEAEVKKPGASVKVSCKASGYTFTYRYLHWVRQTPGQGLEWMGWITPYNGNTNYAQKFQGRVTITRDRSMSTAYMELSSLRSEDTAVYYCAR
Mandrillus leucophaeus V669 trav JYKQ01026643.1 6407 VSGQQLNQSPHSLSVQEREDVPMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSDGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Mandrillus leucophaeus V670 trav JYKQ01026643.1 1646 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVANFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLYSILNITATQTRDSAVYLCAVE
Mandrillus leucophaeus V671 trav JYKQ01026644.1 1806 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Mandrillus leucophaeus V672 trav JYKQ01026645.1 1117 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Mandrillus leucophaeus V673 trav JYKQ01026646.1 1999 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Mandrillus leucophaeus V674 trav JYKQ01026651.1 12232 VSTQQLEQSPRFRSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQRRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Mandrillus leucophaeus V675 trav JYKQ01026655.1 1489 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYVYWYRQIHSQEPQYVIHGLKNNETNVMASLIITEDRKSSTLILPHATLRDTAVYYCIVRG
Mandrillus leucophaeus V676 trav JYKQ01026661.1 307 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRVSVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Mandrillus leucophaeus V677 trdv JYKQ01026663.1 1303 SSVAQKVTQTQSSVSMPVEKAVTLNCQYETSRWSYYLFWYKQPPSKEMIFLIRQGSSEPNAKSGRYSVNFQKAASSIALTISALQLEDSATYFCALWE
Mandrillus leucophaeus V678 trdv JYKQ01026665.1 747 SSVAQKVTQAQSSVSMPVGKAVTLNCQYETSWWSYDLFWYKQPPSKEMIFLIRQGYSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALRE
Mandrillus leucophaeus V679 trav JYKQ01026679.1 1789 VRGIQVEQSPPDLILQEGANSTLRCNYSATANNLQWFHQNPWGQLINLFYILSGTKQNGRLSATTVTKERYSLLHISSSQTTDSGIYFCAVESQCSP
Mandrillus leucophaeus V709 ighv JYKQ01042840.1 16288 VLSQLQLQESGPGLVRPSETLSLICTVSGGSISDSYYWNWIRQPPGKGLEWIGNIYGGGGSTNYNPSLKSRVTISKDASKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V710 ighv JYKQ01042857.1 966 AQSQVQLVQSGAEVKKPGASVKLSCKASGFTFGSYAISWVRQAPGQGLEWMGEIIPAFGIADYAQKFQGRVTITADTSTNTAYMELSSLRSEDTAVYYCAR
Mandrillus leucophaeus V711 ighv JYKQ01042859.1 2130 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGMGVSWIRQPSGKALEWLALIYWNDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Mandrillus leucophaeus V712 ighv JYKQ01042861.1 3053 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIASLQMNSLRAEDTAVYYCTR
Mandrillus leucophaeus V717 igkv JYKQ01044654.1 12859 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNSSSP
Mandrillus leucophaeus V718 igkv JYKQ01044659.1 1698 TTGETVLTQSPATLYLSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLLICGASSRAAGIPARFSGSGSGTDFTLTISSLEPEDFAVYFCLQRETG
Mandrillus leucophaeus V719 igkv JYKQ01044662.1 5646 AKCDIQMTQSPPSLSASVGDRVTITCRASQGISNWLAWYQQKPGEAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Mandrillus leucophaeus V728 igkv JYKQ01052437.1 561 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSNGNTYLNWFQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGIYYCMQSIHLP
Mandrillus leucophaeus V729 igkv JYKQ01052439.1 2516 SSGDVVMTQSPLSLSVTIGQPASISCRSSQSLVHSDGKTYLNWLQQKPGQPPRRLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVETEDVGVYYCVQG
Mandrillus leucophaeus V730 igkv JYKQ01052440.1 95724 ARCDIQLTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Mandrillus leucophaeus V731 igkv JYKQ01052440.1 80366 SSGDIVMTQTPFSLPVTPGEPASISCRSSQSLLHSDGRTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Mandrillus leucophaeus V732 igkv JYKQ01052440.1 75373 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLFYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Mandrillus leucophaeus V733 igkv JYKQ01052440.1 56568 SSGDIVMTQTPLSLPVTAGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPWLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Mandrillus leucophaeus V734 igkv JYKQ01052440.1 35147 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQKHDNSP
Mandrillus leucophaeus V735 igkv JYKQ01052440.1 25719 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQNTKAP
Mandrillus leucophaeus V736 igkv JYKQ01052440.1 5117 ARCDIQMTQSPSSLSASIGDRVTITCRASQNIYSNLAWYQQKPGKAPKPLIYYASSVETGVPSRFSGSGSGTDYTLTISSLQPEDVATYYCQQYDNSP
Mandrillus leucophaeus V737 igkv JYKQ01052441.1 5505 ARCDILMTQSPASLSASVGDRVTITCRASQGISNYLAWYQQKPGETPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Mandrillus leucophaeus V738 igkv JYKQ01052442.1 1370 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIQEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Mandrillus leucophaeus V739 igkv JYKQ01052443.1 31771 ARCDIQMTQSPSSLSASVGDRVTITCQASQSLSNYLNWYQQKPGKIPKLLIYGASSLQSGIPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGYSNP
Mandrillus leucophaeus V740 igkv JYKQ01052443.1 15816 TSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSDGYTYLDWYVQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Mandrillus leucophaeus V741 igkv JYKQ01052444.1 51028 YSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Mandrillus leucophaeus V742 igkv JYKQ01052444.1 34454 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINKELAWYQQKPGKAPMLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYTTP
Mandrillus leucophaeus V743 igkv JYKQ01052444.1 26308 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLHSDGYTYLHWYLQKPGQSPRLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVETEDVGVYYCMQTLQTP
Mandrillus leucophaeus V744 igkv JYKQ01052444.1 16381 ARCDIQMTQSPSSLSASVGDRVTITCRASQGIGNYLAWYQQKPGETPKLLIYAASSLQSGIPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGYSNP
Mandrillus leucophaeus V746 igkv JYKQ01052444.1 1370 TNGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGKTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEVEDVGVYYCEQG
Mandrillus leucophaeus V747 igkv JYKQ01052450.1 18711 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYTTP
Mandrillus leucophaeus V748 igkv JYKQ01052451.1 33638 SRGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Mandrillus leucophaeus V752 ighv JYKQ01056010.1 3193 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Mandrillus leucophaeus V753 ighv JYKQ01056018.1 406 VLSQVKLQQWGEGLVKPSETLSLTCAIYGGSISGYYYWSWIRQPPGKGLEWIGNIYGGGGSTNYNPSLKNRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Mandrillus leucophaeus V772 ighv JYKQ01062878.1 4154 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYISSDSSYIYYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCAR
Mandrillus leucophaeus V773 ighv JYKQ01062881.1 3587 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMQWVRQAPGQGLEWMRWINPYNGNTKYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAT
Mandrillus leucophaeus V774 ighv JYKQ01062881.1 684 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHCMSWVRQAPGKGLEWVGFIRNKAKGGTAEYAASVKGRFTISRDDSKSIAILQMNSLKTEDTAMYYCTR
Mandrillus leucophaeus V775 trav JYKQ01062939.1 1542 TIIDAKTTQPTSMDCAEGRAANLPCNHSAISANEYIHWYRQIHSQGPQYVIHGLKDNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCILRV
Mandrillus leucophaeus V783 trav JYKQ01066659.1 2652 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQNLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Mandrillus leucophaeus V784 trav JYKQ01066660.1 779 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Mandrillus leucophaeus V785 trav JYKQ01066663.1 1268 VNGQQIMQIPQYQHVQEGEDFTTHCNFSTTLSNIQWYKQRPGGHPVFLITLVKSREVKKQKRLTFKSGEAKKNSSLHITATQTTDVGTYFCA
Mandrillus leucophaeus V786 trdv JYKQ01066669.1 4569 SSVAQKVTQAQSSVSMPVGKAVTLNCQYETSWWSYDLFWYKQPPSKEMIFLIRQGYSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALRE
Mandrillus leucophaeus V803 igkv JYKQ01075085.1 2260 ARCDIQMSQSPPSLSASVGDRVTITCQACQGISNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQRNSYP
Mandrillus leucophaeus V810 igkv JYKQ01076935.1 30804 ARCDIQMTQSPSSLSASVGDTVTITCQASQGISDYLAWYQQKPGKAPKLLIYAASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYDSDP
Mandrillus leucophaeus V811 igkv JYKQ01076937.1 32209 ARCDIQMSQSPSSLSASVGDRVTITCRASQGISNALAWFQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGYSTP
Mandrillus leucophaeus V812 igkv JYKQ01076937.1 20612 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYATSLESGVPSRFSGSGSGTEFILTISSLQPEDFATYYCQQHNSYP
Mandrillus leucophaeus V813 igkv JYKQ01076937.1 1180 TTGEIVMTQSPATLSLSLGETATISCRTSQSVGRKLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Mandrillus leucophaeus V827 iglv JYKQ01080923.1 59813 PVVQAGLTQPPSVSKGLKQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Mandrillus leucophaeus V828 iglv JYKQ01080923.1 49412 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYEDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSADGS
Mandrillus leucophaeus V829 iglv JYKQ01080923.1 12795 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQQGKAPRYLMWLKSDGSHSKADGIPDRFSGSSSGADRYLTISNLQSEDEADYYCHTWNTG
Mandrillus leucophaeus V830 igkv JYKQ01081225.1 9157 ARCDIQMTQSPSSLSASVGDKVTITCQASQSISSWLTWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQFSSAP
Mandrillus leucophaeus V863 iglv JYKQ01098165.1 2571 SRAQSVLTQPPSVSGALGQRVTISCSGSGSNIGSNDVYWYQQFPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAISGLQPGDEADYYCAAWNDSLSG
Mandrillus leucophaeus V864 iglv JYKQ01098166.1 440 SLSQPMLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLKYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Mandrillus leucophaeus V920 iglv JYKQ01126536.1 147059 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPRYIMKVNSDGTHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Mandrillus leucophaeus V921 iglv JYKQ01126539.1 1623 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPRYIMKVNSDGTHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Mandrillus leucophaeus V922 iglv JYKQ01126545.1 69914 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Mandrillus leucophaeus V923 iglv JYKQ01126545.1 46202 PAASYELTQPPSVSVSPGQTARITCSGDALPEKYAYWYQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSADSSGN
Mandrillus leucophaeus V924 iglv JYKQ01126545.1 38715 SVASYELTQPLSVSVALGQMARITCGGNNIGRKYVYWYQQKPDQAPVLVIYEDSKRPSGIPERFSGSNSGNMATLTIDGAQARDEADYYCQVWDS
Mandrillus leucophaeus V925 iglv JYKQ01126545.1 35366 SWAQAALTQPHSVSGSPGQSVTISCTGTSSDIGGYDRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Mandrillus leucophaeus V926 iglv JYKQ01126545.1 11982 QSALIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYQQQPGTTTKLMMYNVNTRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Mandrillus leucophaeus V927 iglv JYKQ01126546.1 112009 SVASYELTQPPSVSVSPGQTAKITCSGDVLAKYYAHWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCYSGDDNN
Mandrillus leucophaeus V928 iglv JYKQ01126546.1 102484 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYSYVSWYQQHPGKAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Mandrillus leucophaeus V929 iglv JYKQ01126546.1 90032 SAASYDLTQPPSVSVSPGQTARITCGGDNIESEAVHWYQQKPPQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQMWDSSSKH
Mandrillus leucophaeus V930 iglv JYKQ01126546.1 82928 SVVSSELTQESALSVALGQTVRITCQGDSLSSYYASWYQQKPGQVPVLVIYGNTNRPSGIPGRFSGSWSGNTASLTITGAQVEDEADYYCGSWDNSGNH
Mandrillus leucophaeus V931 iglv JYKQ01126546.1 66571 SAASYDVTQPRSVSVSPGQTARITCGGDNIGSKYVQWYQQKPAQAPVLVIYDNSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Mandrillus leucophaeus V932 iglv JYKQ01126546.1 61779 SVVSSELTQEPALSVALGHTVSMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGNH
Mandrillus leucophaeus V933 iglv JYKQ01126546.1 55239 SWAQAALTQPPSVSGSPGQSVTISCTGTSNDVGGYNYVSWYQQHPGKALKLMIYEVSKRPTGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYSGS
Mandrillus leucophaeus V934 iglv JYKQ01126546.1 37412 SAASYDVTQPRSVSVSPGQTARITCGGDSIGSKVVNWYQQKPAQAPVLVIYADSVRPSGIPERFSGSNSGNTATLTISGIEAGDEADYYCQVWDSSSDH
Mandrillus leucophaeus V935 iglv JYKQ01126546.1 10595 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSS
Mandrillus leucophaeus V936 iglv JYKQ01126546.1 2763 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYARWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Mandrillus leucophaeus V938 iglv JYKQ01126579.1 32502 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIHWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Mandrillus leucophaeus V939 iglv JYKQ01126579.1 27957 SWAQSVLTQPRSASEAARKSVTISCSGSSSNIGSNYVSWYQQLPETAPKLLIYYDDLRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Mandrillus leucophaeus V940 iglv JYKQ01126580.1 8938 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVYWYQQVPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCQSYDSSLS
Mandrillus leucophaeus V941 iglv JYKQ01126580.1 3130 SWAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYNVYWYQLLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLQSEDEADYYCQSYDSSLS
Mandrillus leucophaeus V942 iglv JYKQ01126581.1 18897 SLSQPVLTQPASLSASPGASARLTCTLSSGINVGSYSIYWYQQKPGSPPRYLLYYYSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Mandrillus leucophaeus V943 iglv JYKQ01126581.1 8303 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRGYVSWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGNSASLTITGLQTGDEADYYCGAWDSSLSA
Mandrillus leucophaeus V944 iglv JYKQ01126581.1 4125 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYGNNKRPSGVSDRFSGSQSGTSASLAITGLQSEDEADYYCEAWDNSLS
Mandrillus leucophaeus V945 iglv JYKQ01126582.1 494 SNSQAVVTQEPSLTMSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLHGGKAALILSGAQPEDEAEYYCW
Mandrillus leucophaeus V946 iglv JYKQ01126583.1 371 SNSQAVVTQEPSMTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPAWFSGSLLGGKVALILSGAQPEDEAEYYCW
Mandrillus leucophaeus V947 iglv JYKQ01126585.1 9652 SLSQPVLTQPASLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Mandrillus leucophaeus V948 iglv JYKQ01126585.1 4810 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGSNYVSWYQQLSGKAPKLLIYKNNQRPSGVPDRFSGSKSGNSASLAISGLQSEDEADYYCAAWDDSLSG
Mandrillus leucophaeus V949 iglv JYKQ01126586.1 14307 SLSQPMLTQPASLSASPGASASLTCTFSGGINVAGYYIHWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Mandrillus leucophaeus V950 iglv JYKQ01126586.1 9443 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLTITGLRSEDEAHYYCEAWDNSLS
Mandrillus leucophaeus V951 iglv JYKQ01126586.1 371 SNSQAVVTQEPSMTVFPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPRTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Mandrillus leucophaeus V952 iglv JYKQ01126588.1 747 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSSNYPSWYQQKPGQAPRALIYNTNSKYSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSSA
Mandrillus leucophaeus V953 iglv JYKQ01126589.1 42711 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYYVQWYQQLPGTAPKLLIYENNKRPSGVTDRFSGSKSGTSASLTITGLQSEDEADYYCQSYDSSLS
Mandrillus leucophaeus V954 iglv JYKQ01126589.1 27702 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYAVDWHQQKPGKGPRFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGV
Mandrillus leucophaeus V955 iglv JYKQ01126589.1 12112 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPRRYLLNYYSDSDKHQGSGVPSRFSGSKDASANAGILLISGLQPEDEADYYCMI
Mandrillus leucophaeus V956 iglv JYKQ01126589.1 7308 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGSNYVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCAAWDNSLSG
Mandrillus leucophaeus V957 iglv JYKQ01126592.1 4315 SDSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLVGGKAALTLSGAQSEDEAEYYCL
Mandrillus leucophaeus V970 trbv JYKQ01131116.1 29491 VRSQTIHQWPATLVQPVGSRLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGVGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Mandrillus leucophaeus V981 trdv JYKQ01135395.1 28492 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVIYGDESRSHGAYFAQGRFSVKHLLTQRAFHLVISPVRTEDSATYYCAM
Mandrillus leucophaeus V1074 igkv JYKQ01187337.1 15494 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDVNWYQLEPGEAPKLIIKDATTLVSGIPPRFSGSGYGVDFTLTINNVESEDAAYYFCLQHDNFP
Mandrillus leucophaeus V1075 igkv JYKQ01187338.1 2384 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSVSSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQHSSGY
Mandrillus leucophaeus V1076 igkv JYKQ01187339.1 7035 SSGDIVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDRFTVSGSDTDFILQISRVKAEDVGVYYCVQCLQL
Mandrillus leucophaeus V1077 igkv JYKQ01187347.1 3496 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLISWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQHYSSP
Mandrillus leucophaeus V1165 ighv JYKQ01237599.1 1063 VQGEVQLVESGGGLSKPGGSLRLSCAASGFTFSDYNMHWVRQASGKGLEWVSGISNDGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAG