WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Bison bison bison JPYT00000000.1 (JPYT01) 234 6 18 8 99 60 9 34
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Bison bison bison V102 trbv JPYT01046320.1 273 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHLSVYWYQQALGQSPEFLVQYYDGEMYQKGNISDRVSGKQFSDAASELSLTPLELTDSAVYLCASSQ
Bison bison bison V104 trbv JPYT01046697.1 1481 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVGNEMVPSRFSPESPDKAHLNLHIDSLEPGDSAMYFCASS
Bison bison bison V105 trbv JPYT01046698.1 224 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHDAMYWYKQSAQKPPELMFIHNYQELAGNESVPSRFWSECPDSSQCRLDLNALKPQDSAVYLCASSR
Bison bison bison V106 trbv JPYT01046702.1 3363 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGPQFLVQYYNQKVSGEAHLLDRFSGKQFSDSRSELNLSSLELTDSAMYLCASSE
Bison bison bison V107 trbv JPYT01046704.1 1015 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPSMERGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCTCGY
Bison bison bison V108 trbv JPYT01046704.1 4764 AVHAGVTQDPRFQVVRTGQNVTLTCTQDLGHNSMYWYRQDLGHGLRLIHYSDGPPTTVKGDVPEGYSVSRPSKKDFPLTLKSANHSQTSVYFCASSY
Bison bison bison V109 trbv JPYT01046706.1 1610 AVHAGVTQDPRCQVVKTGQKVTLKCTQDLGHDRMYWYRQDPERGLRLIHYSAAAPTTEKGDMPEGYSVSRLSTENFALTLESANRSQTSVYFCASSY
Bison bison bison V110 trbv JPYT01046709.1 1080 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHLSVYWYQQALGQSPQFLVQYYDGEMYQKGNISDRVSGKQFSDAASELSLTPLELTDSAVYLCASSQ
Bison bison bison V111 trbv JPYT01046710.1 6711 AVHAGVTQDPRFQVVRTGQKATLTCTQDLGHDCMYWYRQDLGHGLRLIHYSFAAPNTVKGDIPEGYSVSRPSTEDFPLTLESANHSQTSVYFCASSY
Bison bison bison V112 trbv JPYT01046710.1 10762 AVHAGVTQDPRFQVMRTGQNATLRCSQDLGHNYMSWYQDLGHGLRLIHYSDGAHTSEPGDMPDGYSVSRSNKENFAVTLESANRSQTSVYFCASRY
Bison bison bison V113 trbv JPYT01046711.1 1794 LVDSEVTQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGQGPQFLILYYDGKVRTKGNMPDRFSGEQFGDSRSQMNLSSLELTDSAVYLCASRQ
Bison bison bison V114 trbv JPYT01046711.1 4241 AVHAGVSQDPRFQVVKTGQNVTLRCTQHLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASST
Bison bison bison V115 trbv JPYT01046711.1 7150 HTGAGAVSQSPRHRVAGRGQTVNLRCDPISGHVSLYWYRQTLGQGPEFLTYFQDEQQLDRSGMPKNRFYAERPEKTYSYLKIQPAEPGDSAVYLCASSP
Bison bison bison V116 trbv JPYT01046713.1 711 LVDSEVTQTPKYLIKSRKQQATLRCSPNSGHSSVNWYQQALGQGPQFLVQYYRGQVSRGENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Bison bison bison V117 trbv JPYT01046717.1 378 PLEAEVTQTPRHLIKTTGQTATLRCSPISGHSSVSWYQQAQSQGPQFIFEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDLTDSALYLCASSL
Bison bison bison V118 trbv JPYT01046718.1 468 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGPEYLTNFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bison bison bison V119 trbv JPYT01046719.1 3529 LVDSGVTQTPKYLIKSRKQQATLRCSPVSGHLSVYWYQQALGQGPQFLVQYYNQKVRGEAHLLDRFSGKQFSDSRSELNLSSFELTDSAMYLCASSE
Bison bison bison V120 trbv JPYT01046719.1 7415 AVHAGVTQDPRFQIVRRGQSMTLTCTQDLGHNYMHWYRQDLGHGLRLIYYSAGPPTTEKGDGPNGYRVSRSSKENFPLTLESANRSQISVYFCASSYFMVLH
Bison bison bison V121 trbv JPYT01046719.1 9696 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bison bison bison V122 trbv JPYT01046726.1 3860 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHTALFWYRQTSVRGLELLIYFNNQASIDESGMPKDRFSAKMHNASFSTLKIQPTDPRDSATYLCASSK
Bison bison bison V123 trbv JPYT01046726.1 6346 CISAEVAQSPSHRVIEKKQAVNLSCDPISGHESLFWYYHAVGKEMKLLIYFLRESMQDDSGMPKGRFTAERMEGTSSTLRVHSAELGDSGVYFCASSR
Bison bison bison V124 trbv JPYT01046727.1 85 HVGAMVVQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKQITKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Bison bison bison V125 trbv JPYT01046735.1 746 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bison bison bison V126 trbv JPYT01046735.1 4262 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNAGSDATYEQGYNKDKIPISQPNVTFSSLTVTRVDPADSSLYFCGAR
Bison bison bison V127 trbv JPYT01046743.1 3091 SVDTKVIHSPGHLVKGKGQKTKMDCVPKKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQLFLAPWPQNSPCSLEINSTEAADSALYFCASSQ
Bison bison bison V128 trbv JPYT01046744.1 740 SMDTEVTQSPSHLVKGKGQKAKMDCVPMRGHASVYWYRNKLEAFEFLVCLWNGKITEDTDMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bison bison bison V129 trbv JPYT01046746.1 1087 STDTEVIQSPGHLVKGKGQKAKMDCVPIRGHINVYWYRRKLEEALEFLVYFQKQDIVKGTEVFKERFSAECPQNSPCSLEINSTEAADAALYFCASSQ
Bison bison bison V130 trbv JPYT01046747.1 96 LVDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIDAGTVEEGDVPHGYSVSRKKKESFPLTLASATTNQTSMYLCASSE
Bison bison bison V131 trbv JPYT01046748.1 1743 SVFSALLSQEPSRAIRQRGTSVMIECRQVDSQLTWMYWYRQLPGQSLVLMATANQGSKATYETGFTDNKFPINHQKLEFSTLTVSNASSEDSSSYFCSAG
Bison bison bison V208 iglv JPYT01093088.1 1033 SWAQAVLTQPSSVSGSLGQSVSITCSGSSSNVGNGYVSWYQVIPGSAPRTLIYGETSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAGDSSSST
Bison bison bison V209 iglv JPYT01093102.1 898 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVGWYQQIPGSAPRTLIYRATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bison bison bison V210 iglv JPYT01093109.1 5419 SWAQAVLTQQPSVSGSLGQRVSISCSGSSSNIGHGYGTWYQQIPGSAPRMLIYGATSRASGVPDRFSGSRSGNTATLIISSLQAEDEADYYCAAYDSSSSG
Bison bison bison V211 iglv JPYT01093111.1 270 SWAQAVLTQPPSVSGSLGQTVTISCTGSSNNIGILGVSWYQQLQRSAPRTLIYNSNQRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLNT
Bison bison bison V212 iglv JPYT01093120.1 1562 SWAQSGLTQPSSVSGNLGQTVTISCAGTSSDVGAYNGVGWYQQLPGSAPKTLIYNLNKRSSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKGGGS
Bison bison bison V213 iglv JPYT01093131.1 2399 HLASSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGISDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADIGD
Bison bison bison V214 iglv JPYT01093133.1 411 PVSSYELTQSPPASMSPGQTARITCGGPSVGGENVEWHQQKPGQAHAPVTYGDDNRPTGVPDQFSGANSGNMATLTISGARAEDEADYYCQLWDSSSNN
Bison bison bison V216 trgv JPYT01094706.1 3338 GLGLSKVEQAQISLSTEVKKSINIRCKIESTNFESETVYWYRQKKNQALEHLIYVTSTTTVARNQVDGKNKIEARKDAQMFTSTLTVNFIEKEDVGIYYCAGWS
Bison bison bison V217 trgv JPYT01094708.1 1469 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLVVLDAPALNHLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWL
Bison bison bison V218 trgv JPYT01094709.1 1569 IPITQRITSITKKKGNTAFLECQIKIDKLKKNVYMHWYRQKPEQPLKRVLYISSNENVVHEQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACWV
Bison bison bison V219 trgv JPYT01094709.1 4024 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEIDNKKNGIFYLIINNVVKSDEATYYCACWD
Bison bison bison V220 trgv JPYT01094714.1 14137 MQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bison bison bison V221 trgv JPYT01094721.1 1928 TQVSSNMEGDRMSITRATGSSAVIPCDLPTQNKQYIHWYKFQEGTVPRRLLYYDVSYSKVVLEPGISPGKYHGYEGTDKMYKFVISNLQESDSGVYHCAVWE
Bison bison bison V240 trdv JPYT01105605.1 2626 SSVAQRVAQDQPDISSQVGEVVTLRCQYETRLSSFRIFWYKQLASGEMIYLIGQVSSSQKARDGRYTTDIQRSRKSISLTISDLQLEDSAKYFCAVWE
Bison bison bison V241 trav JPYT01105614.1 2217 VSSLLTVEQRPPLLWVQEGDSTNFICSFPSSSFYALHWYRWKPAKTTKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bison bison bison V242 trdv JPYT01105617.1 72 SGVAQKVTQDQPDISTQVGQSVILNCWYETSWGVYYLFWYKQLPSGQMTYLIQQYSEYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALCE
Bison bison bison V243 trav JPYT01105625.1 5436 VRGVDVEQSPPALSLQEGASHMLRCNFSASVSNVQWYLQNPKGRLIHLFYIPSGTKQNGRLNATTIPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V244 trdv JPYT01105648.1 5904 SSVAQQVTQVQTVVSSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIRQDSEVGNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALWE
Bison bison bison V245 trav JPYT01105668.1 1127 QTCGDSVRHMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGTNKGFEATYNKETTTFYLEKASVQESDSAVYYCALS
Bison bison bison V246 trav JPYT01105668.1 6258 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDTVNSVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASQLEDAATYLCAVE
Bison bison bison V247 trav JPYT01105680.1 1844 GTRGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLFWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bison bison bison V248 trav JPYT01105686.1 472 RTNGDSVNQKEGPVTVSEGALLTLNCTYQTTYSDPYVFWYVQHLNKAPQLLLKGWMKDQSPVHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V249 trdv JPYT01105691.1 3086 SGVAQKVIQDQPYITSQIGQSVILKCQYELSQSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGHYSVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bison bison bison V250 trav JPYT01105697.1 9916 VPGVDVEQSPPALSLQEGANSTLQCNFSTYPQNVNWYLKNPGGRLIHLVYVPSGTKQFGRLTATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V251 trav JPYT01105708.1 1508 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKGGEVKTQWRWTGRLGESKQHSFLHLTAAQLSDAGTYFCAE
Bison bison bison V252 trdv JPYT01105709.1 2534 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLNTYYLYWYKQLPSGQMTYVIRQGSEVANARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bison bison bison V253 trav JPYT01105712.1 148 VRGVDVEQSPPALSLQEGASYTLWCNFSTSSQSVNWYLQNPGGRIIHLFYISSGTKQDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V254 trdv JPYT01105714.1 947 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETNWDVYYLFWYKQLPSGQMTYVIRQGSLVTNAKEDHYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bison bison bison V255 trav JPYT01105715.1 2090 TVINAKTTQPSCVDCAEGEDVNLPCNHFTIGGNEYMHWYWQNPNQNTQYVPGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRK
Bison bison bison V256 trav JPYT01105742.1 2248 TVTDAKTTQPSSMDYPEGQDVTLPCNHSTIGRNEYIHWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVPRE
Bison bison bison V257 trdv JPYT01105749.1 2736 SGVAQKVTQDQPEISSQVGESATMNCQYETSWNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQKSRKAISLIISALKLEDSAKYFCAVWE
Bison bison bison V258 trav JPYT01105751.1 1466 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKTPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bison bison bison V259 trav JPYT01105756.1 151 TVINAKTTQPGSMDCAEGEDVNLPCNHSTFGGNDYIHWYQQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bison bison bison V260 trav JPYT01105760.1 1225 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVRWYLQKPGGRLIHLIYIPSGTRQEGRSNVTAVPKEQRSSLHISYLRTTDSGTYFCAVQHSAPQ
Bison bison bison V261 trav JPYT01105768.1 1107 KSTQQLEQNPQFLRIQEGGNVTVHCNSSSTFTFFQWYRQKPEQGPVLLMTLTKPKEIKKQKRIRAQFGEAKKDSSLLITAAQPGDAGTYLCAG
Bison bison bison V262 trav JPYT01105770.1 5749 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRNVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bison bison bison V263 trdv JPYT01105780.1 3631 SSMADKVTEAQTTVTAREREAVTIGCTYETSRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCALWE
Bison bison bison V264 trav JPYT01105792.1 1919 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYQNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Bison bison bison V265 trav JPYT01105800.1 4072 PSVAQMVSQPQPEESVQEADTVTLDCTYSTRDTDYYLFWYKQPPSGQMVYIIHQYAFEQQNATNDRYSVNFQKEAKSFSLRISDSQLEDAALYFCAYSG
Bison bison bison V266 trav JPYT01105808.1 3228 VSGKNGVEQSPRYLSAQEGDLVTINCNYLEGMTTLQWLQQNPGGGIISLLILSLEMKRKGRVSATINSRERYSSLNITASQPTDSAIYFCAVE
Bison bison bison V267 trdv JPYT01105815.1 1911 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIDSENKHSREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Bison bison bison V268 trdv JPYT01105825.1 2208 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGGFKGKIDTSKNQYVLNIQKTTIKDVGTYYCGS
Bison bison bison V269 trdv JPYT01105831.1 1102 VMSAVVLVPQDQEKTVVVGKSATLSCSMKGAAFISKYYIFWYRKTPGNTMTFIYQERGVYGPGFEDNFRGKIVNLTNQAVLEVLKASERDEGFYYCATD
Bison bison bison V273 trav JPYT01106052.1 1340 VQGLDVEQSPPALSLQEGASHMLRCNFSASVNNVQWYLQNPSGHLIHLFNIPSGTKQNGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V274 trav JPYT01106057.1 164 NVFDAKTTQPSSMDYPEGEDVTLPCSHSTISGNEYIHWYRQSPNQSPQYVIHGLRGTVNSSMASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bison bison bison V286 trav JPYT01119445.1 1322 TVIDAKTTQPSSMDCAEGEDVNLPCNHSTVGGKDYIHWYRQNPNQSPQYVVHGLRGTVNRSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bison bison bison V287 iglv JPYT01121614.1 2361 SVVSYELTQLTSVSVALGQTAKITCSGDLLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bison bison bison V293 trav JPYT01145974.1 561 VSSLLTVEQHPLLLWVQEGESTNFTCTFPSSSFYALHWYIWKPAKGPKNLIVISVNGDEKKQGRVRVTLNTKESYSSMYLRRSQPEDSATYLCA
Bison bison bison V294 trav JPYT01146981.1 467 RTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTYYLFWYVQRLNKAPQRLLMGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V296 trav JPYT01158995.1 37 VRGMDVAQSPPALSLQEGASSILQCNFSTFADSVQWYLQNPRGRLIHLFYVPSGTKRDGRLNATTVPTERRSSLHISSSPTTDSGTYFCAVQHSAPQ
Bison bison bison V297 trav JPYT01161472.1 181 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIRWYWQNPNQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bison bison bison V300 trdv JPYT01179338.1 527 SGVAQRVIQDQSDTSSQLGQSVTLNCRYATTRSYYYMFWYKVLPNGEMIYLIGQFSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Bison bison bison V301 trav JPYT01186316.1 147 VQGVDVEQSPPALSLQEGASYTLQCNFSTFPQSVNWYLQNPEGHIIHLFYIPSGTKQDGRLHATTVPKEGRSSLCISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V302 trbv JPYT01188869.1 223 GSGLGALVSQQPHRAFSKSGASVTIECRTVDFQASSMFWYRQFPKRGLVLMATSNEGTDATYEQGYTKDKFPISHPDLTFSSLMVTNVDPADSSLYFCGAR
Bison bison bison V304 trav JPYT01214666.1 173 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLVPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V305 trdv JPYT01239176.1 53 SSVAQRVTQDQPEIASQVGEVVTLSCQYETIQSRYNIYWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFQRSHKSISLTISDVQLEDSAKYFCALWE
Bison bison bison V321 trdv JPYT01255848.1 7544 CGVTQKVIQDQPDIYSQLGQSVTLNCRYETTWSFYYMFWYKLLPNGEMMYLIARASSGQNARNGRHFVTFQKIRKSISLTISDLQLEDSAEYFCALWE
Bison bison bison V324 trbv JPYT01256083.1 6572 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQSAQKPPELMFIHNYQELAGNESVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bison bison bison V327 trbv JPYT01257414.1 942 LVDSEVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGEVYQRGNMSDRFSIQQLGDSRSELNLTSFELMDSALYLCASSS
Bison bison bison V328 trbv JPYT01257414.1 2585 AVHAGVTQDPRFQVMRTGQSVTLKCTQDLGHDRMYWYRQDLGHRLRLIHYSAGVHTSEPGDVPDRYSVSRSNTENFPLTLESANRSQTVVYFCASSY
Bison bison bison V329 trbv JPYT01257414.1 4790 LVDSGVTQTPKYLIKSRKKQVILRCSPESGHLSVYWYQQALGLGPQFLIQYYNGKENEKGNMPDRFSGKQFSDSHSELNLSSLELTDSAAYLCASSQ
Bison bison bison V330 trbv JPYT01257414.1 9196 LVDSEVTQTPKYLIKSRKQQVILRCSPESGHRSVYWYQQALGQGLQFLIQYYNRAEYEKGNISDRVSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bison bison bison V331 trbv JPYT01257414.1 11009 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDSGHRLRLIHYSVIPPSTERGAMPEGYRVSRPSTENFPLTLESANRSQTSVYFCTCGY
Bison bison bison V335 trbv JPYT01258404.1 636 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHLSVSWYQQALGQGPQFLVQYYDEKVYQKGNISDRVSGKQFSDAASELSLTPLELTDSAVYLCASSQ
Bison bison bison V336 trbv JPYT01258404.1 2465 AVHAGVTQDPRFQVVRRGQSTTLTCAQDLGHNYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVPDGYSVSRSNTENFPLTLKSANRSQTSVYFCASSY
Bison bison bison V337 trbv JPYT01258404.1 4666 LVDSGVTQTPRYLIKARGQRGTLGCSPASEHLSLSWYQQALGQGPEFLVEYYRQEVRGEAQLPDRFSGKQFSDFRSELYLSSLELTDSAVYLCASSQ
Bison bison bison V338 trbv JPYT01258404.1 9770 AVHAGVSKDHIFHVVRRGQSATLTCTQDLSFSYMYWYQQDPGNGLRLIHYSVIPPSREKGAVPEGYRFSRPSTENFPLTLESANRSQTSVYFCTCGY
Bison bison bison V339 trbv JPYT01258404.1 13409 AVHAGVTQNPRFQVVRTGQNTTVTCTQDLGHDRMYWYRQDLGHGLRLIHYSVGAPDTVKGDIPEGYSVSRPSTKDFPLTLESANRSQTSVYFCVSSY
Bison bison bison V340 trbv JPYT01258404.1 15669 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRYVSWYQQALGQGPQFLVQYFDGKVRTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASSQ
Bison bison bison V345 trbv JPYT01259803.1 4433 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHTSVYWYQQALGQGLQFLIQYYNRAEYEKGNISDQVSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bison bison bison V362 trav JPYT01264610.1 8131 VSGKNQVEQSPPSLVVLEGENCTFQSNYAVRPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATLVATSKHSSLHLTAAQLSNPAFYICVVG
Bison bison bison V366 trbv JPYT01264944.1 7844 TTDANLGVTQTPRHEVTEKGQAVTLSCELIKSHTALYWYRQTSVRGLEFLAYFSNQAPIDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Bison bison bison V370 trav JPYT01265600.1 924 VSLGNQVEQSPTLSVQEGNSSVITCTYTDGNSTYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTTKRLSLHITTTEAGDSSVYFCAAS
Bison bison bison V371 trav JPYT01266288.1 1132 RTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNSYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKRDSSFHLQKRAVQASDSAVYYCALS
Bison bison bison V397 trbv JPYT01271767.1 2900 SVFSALLSQKPSRAIRQRGTSVMIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPNQAFSTLTVSNVSSKDSSSYFCSAR
Bison bison bison V398 trbv JPYT01271767.1 5379 SVFSALLSQKPSRAIHQRGTSVTIECRQVDSQLTSMYWYRQLPGQSLVLMATANQGFKATYESGFTDNKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bison bison bison V402 iglv JPYT01272265.1 458 SVVSYELTQPTSVSVALGQTAKITCSGDLLDKQYTQWYQQKPGQGPVRVIYKDSERPSGISDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Bison bison bison V439 trav JPYT01278860.1 1401 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLPGPTRVKGIKGFEADFKKDENSFHLMKASAHWSDSAKYFCALC
Bison bison bison V440 trbv JPYT01278918.1 2483 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQATTVFWYRQFPKRGLVLMATSNEGTDATYEQGYNKDKFPINQPDRTFSSLMVTSVDPADSGLYFCSAR
Bison bison bison V442 trdv JPYT01279370.1 279 SGVAQTVIQDQPDTSSQLGQSVTLNCRYATTGSYYYSYYYYWYKLLPSGEMIYLIGQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bison bison bison V443 trav JPYT01281473.1 369 GTNGDSVNQTEGPVTVSEGALLTLNCIYQTADSAPFLFWYIQHLNKAPQFLLKGSMSDQNPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V444 iglv JPYT01281478.1 7147 SWAQSGLTQPPSVSGNLGQTVTTSCAGTSSDVGSYNGVGWYQQLPGSAPKTLIYNVSKRPSGIPDRFSGSKSGNTATLTVSGLQAEDEADYYCSSYKGGGS
Bison bison bison V454 trav JPYT01284506.1 4901 MNGQQIKHFPEFLLLQEGENFTTYCHFSSTFYNLQWYKQRPGGSAVFFMILAKVGEVKTEQRLTGRLGETRQHSSLHLMAAQLSDAGTYFCAV
Bison bison bison V460 trav JPYT01285377.1 2435 MNGQQIKHFPEFLLLQEGENFTTYCNSSSHFNNLQWYKQRPGGSPVFLMILAKGGEVKTEQRLTGRLGETKQHSSLHLTAAQLSDAGTYFCT
Bison bison bison V461 iglv JPYT01285442.1 3858 SWAQAVLTQPPSVSGSLGQRVTITCTGSSSYVSRGNHVSWYQLIPGLAPKTLIYNSNKRPSGVPDRFSGTKSGNTGTLTIASLQAEDEADYYCASADLSLTG
Bison bison bison V462 iglv JPYT01285442.1 6650 SLSQPVLTQPVTVSASLGASARLSCTLSSGYNVSNYSIYWYQQKAGNPLRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCAVWHG
Bison bison bison V463 iglv JPYT01285442.1 9675 SWAQAGLTQPASVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPPGVPDRVSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bison bison bison V467 trgv JPYT01286321.1 4570 THVSSNMEEDKLSVMRATGSSIVIECDLTGSYIHWYKFQEGAVPGRLLYYDVYYSKVVLGSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bison bison bison V480 trbv JPYT01290134.1 5341 SMDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDMMEDTALFKQRFSAECPQNSPCSLEINSTEAADSALYFCTSSQ
Bison bison bison V481 trbv JPYT01290134.1 10133 PMDAEIYQIRFLLAEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSG
Bison bison bison V482 trbv JPYT01290134.1 19374 SMDTGVTQTPRNRIANTGKSTVLECSQTKDHESMYWYRQDPGRGLRLIYFSYGINDINKGDVSDGYNVSRKEKAKFSLYLEPATPSQTAIYFCASNI
Bison bison bison V483 trbv JPYT01290134.1 25181 FSDADIYQTPRYCVIGTGKKITLECSQTMGLDNMYWYQQDPGMELQLIHYSYGVNTSENGERSSRSTVSRISKEHFPLTLETANSSQTSSYFCASGD
Bison bison bison V484 trbv JPYT01290134.1 26890 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKEGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Bison bison bison V485 trbv JPYT01290134.1 34389 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Bison bison bison V488 trbv JPYT01290921.1 3098 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHSYVHWYRKKLEEALEFLVYFHKQGIVEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bison bison bison V512 trdv JPYT01295994.1 3967 SSVAQRVTQDQPEIASQVGEVVTLSCQYETIQSRYNIYWYKQLPGGEIIYLIGQGSSSQNARYGRYSVNFQRSHKSISLTISEVQLEDSAKYFCALWE
Bison bison bison V518 trdv JPYT01360053.1 112 SSVAQQVTQVQTAVSSQVGQTVTLNCRYEVSWTTGYYNIFWYKQLPRGEMTFLIRQYSEVGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bison bison bison V523 trbv JPYT01424478.1 24 SMDTEVTQSPGHLVKGKGQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bison bison bison V524 trav JPYT01489054.1 76 VSSKQDVSQSPEALNVREGDSVVLNCSYTDSALFFLQWFRQDPGKGLTSLLSIQVNQKEQASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Bison bison bison V525 trav JPYT01526640.1 54 VRGVDVEQSPPALSLQEGASYTLRCNFSTYSQSVNWYLQKPGGHIIHLFYIPSGTKQDGRLHATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSALQ
Bison bison bison V531 trav JPYT01638278.1 1177 PSVAQTVTQPQPQESVQETGTVTLDCAYSTRDTDYYLFWYKQPPSGEMVYIIHQYAFEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAALYFCAYSG
Bison bison bison V533 trav JPYT01642710.1 1046 LNGQQIKHFPEFLFLQEGENFTTYCNSSSTFYSLQWCKQRPGGSPVLLMILAKGGEVKTQQRRTGRLGESKQHSPQHLAAAQLSDAVTYFCA
Bison bison bison V535 iglv JPYT01660063.1 74 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGTGNYVSWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bison bison bison V536 trbv JPYT01660782.1 236 LVDSEVTQTPKYLIKSRKQQGILRCSPESGHTSVYWYQQALGQGLQFLIQYYNRAEYEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bison bison bison V537 trbv JPYT01660785.1 778 SMDTEVTQSPSHLLKGKDQRAKMDCVPKKGHSYVYWYRKKLEEALEFLVYFQKQDIVEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bison bison bison V545 ighv JPYT01703496.1 733 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSDKAVGWVRQAPGKALEWLGGISSGGSTCLNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAP
Bison bison bison V546 trav JPYT01704764.1 1459 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKSPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bison bison bison V548 trav JPYT01705233.1 1732 NVCDAKTTQPSSMDYPEGEDVTLPCSHSTISGNEYIHWYRQSPNQSPEYVIHGLRGTVNSSTISLTISSDRKSSTLVLPQVTLRDTAVYYCILRE
Bison bison bison V549 trav JPYT01705373.1 1029 VSLGNKVEQSPTLSVQEGNSTFITCTYSDGNSNYFPWYKQEPGKGPQLLIAIHSNKAKEEDQRLTVLLNKTAKHLSLHIAITEGGDSAVYFCAAS
Bison bison bison V550 trav JPYT01706829.1 4362 GLRAQSVTQPEAEVRVAERDPVTVKCTYSVSWSPYLFWYVQHSNQGLQFLLKYIGGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bison bison bison V551 trdv JPYT01707022.1 257 SGVAQKVTQDQPDVSSQVGQSVTLNCLYETSWTTYDLYWYKQLPSGQMTYVIRQGSLATNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bison bison bison V552 trav JPYT01707633.1 1701 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPLYVIHGLQGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bison bison bison V555 trav JPYT01713039.1 764 QTHGNSVTQMDGQVSRSEGNSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Bison bison bison V556 trav JPYT01713040.1 55 VSLGNKVEQSPTLSVQEGNSTFITCTYTDGNSNYFPWYKQEPGKGPQLLIGIHSNKAKEEDQRLTVLLNKTAKRLSLHIANTEAGDSAVYFCAAS
Bison bison bison V560 trav JPYT01720125.1 2035 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTADFDPYLFWYIQHLNKAPQLLLKGSMSDQNPKSKGFQATLVRTDSSFHLQKQAVQASDWAVYYCALS
Bison bison bison V561 trav JPYT01721009.1 591 GTGAQLVTQPDGHINVSEGNYVELRCNYSYGGPIYLFWYVQYPNQGLQFLLKYLSGPTRVKGIKGFEAEFKKDENSFHLMKASAHWSDSAKYFCALC
Bison bison bison V562 trav JPYT01721366.1 502 KSRGGKVEQYPSFQSVQEGDNCVINCTYTDSASTYFFWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATNPGDSATYFCATR
Bison bison bison V569 trav JPYT01728380.1 255 GTNGDSVNQTEGPVTVSEGAPMTLNCTYQTASSAPYLFWYVQHLNKAPQLLLKGSMSEQNPKTKGFEATLVKRDSSFHLQKQAVQASDSAVYHCALR
Bison bison bison V574 trav JPYT01731333.1 477 VSLGNEVEQRPSTLSVLEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIHSNMGEKKDQRLTVLLNKNTKHLSLHIATIQPGDSAVYFCAAR
Bison bison bison V577 trav JPYT01731839.1 646 GLRAQSVTQPEAEVPVSEGDPVTVKCTYSVSWSPYLFWYVQHHNQGLQFLLKYISGDTLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Bison bison bison V582 trav JPYT01739393.1 246 QTHGNSVTQMDGHMSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMNANDKGTNKGFEATYNTETTSFHLEKTSGQESDSAVYYCALR
Bison bison bison V583 trav JPYT01740651.1 3084 GINGDSVNQTEGPVTLSEGALLTLNCTYQTTYSGSYHFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVRSDSSFHVQKRAVQASDSAMYYCALS
Bison bison bison V585 trav JPYT01742557.1 195 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPRASLTDTAVYYCIVGD
Bison bison bison V586 ighv JPYT01742565.1 3190 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSDNSVGWVRQAPGKALEWLGVIYYGGSTGYNPGLKSRLSITKDNSKSQVFLSLSSLTPEDTATYYCAR
Bison bison bison V588 trav JPYT01743097.1 995 VSSQQNTVEQSPASLPVPEGAAASLGCTYSDSTSQYFTWYRQYPGKGPEFLLYVYANNNKEEGKFTAQSNKTSKHVSLRIRDSKPSDSATYLCAV
Bison bison bison V591 trav JPYT01744901.1 1179 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTAYLAPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATPVKHDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V696 trav JPYT01006180.1 3435 GTNGDSVNQTEGPVTLSEGALLTLNCTYQTTYSDSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVRTDSSFHLQKRAVQASDSAVYYCALN
Bison bison bison V697 trav JPYT01006180.1 1226 SLMAQKVTQNRSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPSSGEMIFLIHQESYNELNTTKGQYFLDFHKATSSISLTISDSQLEDSAVYFCALR
Bison bison bison V698 trav JPYT01006186.1 1766 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSGSPYLFWYIQHRNQGLQFLLKYIRGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bison bison bison V699 trav JPYT01006196.1 19086 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSRSPYLFWYVQYGNQGLQFLLKYIGGDSLVKGNYDFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Bison bison bison V762 trbv JPYT01046754.1 9544 VRTQTIHQWPSTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQQLFYSVSAGQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYFCAWS
Bison bison bison V843 trav JPYT01098747.1 6708 LSGEDQVEQSPQTLRIQEGDSLSLNCSYSSFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bison bison bison V844 trdv JPYT01098749.1 895 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNRTKDQYFLNFQKATSSISLTISDSQLEDSTLYFCALS
Bison bison bison V847 trdv JPYT01101270.1 1064 AQAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Bison bison bison V852 trdv JPYT01105855.1 5936 KGVLCNQVTQSPPEQRVASGSKVTLLCTFQTIYSNPDLYWYRKSPDGVFQFVLYRDNTRSRDADFARGRFTMLHSMSQKTFHLVIFSVRPEDTATYYCALRL
Bison bison bison V865 trav JPYT01113141.1 850 VQGLDVEQSPPALSLQEGASYTLQCNFSTYPQNVNWYLKNPGGRLIHLVYVPSGTKQFGRLTATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V869 trdv JPYT01117087.1 1157 SGVAQKVTQDQSDVSSHVGQSVTLNCRYETSWSYYYLYWYKQLPSGQMTYVIRQGSEVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bison bison bison V870 trdv JPYT01117779.1 971 SSVAQQVTQVQTAVSSQVGQTVTLNCLYEISLTMDYYYIFWYKQLPKGDMTFLIHQYSEYGNARNGRYSVNFHKAHKYISLIISALQLEDSAEYFCALWK
Bison bison bison V871 trav JPYT01124012.1 998 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISALQLEDSAVYFCALRE
Bison bison bison V872 trav JPYT01129966.1 659 GTRAQTVTQPESHTYVSEGAPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHTSRESIQGFTAELSQTEASLHLKKPSAQEEDSAVYYCALG
Bison bison bison V874 iglv JPYT01133473.1 1334 SWAQDVLTQPSSVSGSLGQRVSITCSGSSSNVGYANYVSWHQQKEGSAPRTLIYGATSRASGVPDQFSGSKSGNTATLTISSLQPEDEADYYCSSYDSSSNI
Bison bison bison V876 trdv JPYT01139378.1 812 SGVAQSVTQDQPDIVSEVGKAVTLNCRYETSWDMFRYYIFWYKQIPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCLLLD
Bison bison bison V877 trav JPYT01139383.1 453 QTRGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGNNKGFEAAYNTEITSFHLEKASVQESDSAVYYCALS
Bison bison bison V879 trdv JPYT01146130.1 635 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYINSYYIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCALRE
Bison bison bison V880 ighv JPYT01150113.1 362 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSNGVVWVRQAPGKALEWLGGICSGGSTSFNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAR
Bison bison bison V882 trav JPYT01159507.1 489 VRGMDVAQSPPALSLQEGASSTLRCNFSTFADSVQWYLQNPGGHLIHLFYVPSGTKRDGRLNATTVPAERCSSLHISSSKTTDSGTYFCAVQHSAPQ
Bison bison bison V888 trav JPYT01231024.1 441 VQGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVIWYLQNSGGHLIQLFYIPSGTKQDGRLTATTVPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V889 trdv JPYT01238652.1 403 SGVAQNVIQDQPNTSSQLGQSVTLNCRYATAWSYYYMFWYKLLPNGEMIYLISQASSSQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Bison bison bison V890 trav JPYT01238713.1 313 VSSQQNTVEQSPASLPVPEGAAASLGCTYSDSNSLYFTWYRQYPGKGPEFLLQVYANNNKEEGKFAAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bison bison bison V904 igkv JPYT01256812.1 13409 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLYWLQHKPGQSPQSLIYYVSNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQG
Bison bison bison V965 ighv JPYT01274964.1 1064 VLSQVQLLESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGGIDTGGSTGYNPGLKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCTT
Bison bison bison V1000 trav JPYT01287371.1 2447 GTRAQTVTQPESHTSVSKGAPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALV
Bison bison bison V1011 igkv JPYT01289670.1 2754 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLYWLQHKPGQSPQLLIYYVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQD
Bison bison bison V1041 trav JPYT01305235.1 350 GVRGVKVEQSPSVLSLQEGANSTLRCNFSDTVNSVQWFQQNPRGSLTRLFFIASGTKKNERMSSTVNSKERYSTLHITASQLEDSATYLCAVE
Bison bison bison V1042 trav JPYT01353700.1 539 ASSQQNTVEQSPASLPVPEGAATSLSCTYSDSNSQYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bison bison bison V1043 trav JPYT01406292.1 354 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGYYLFWYKQPPSGEMVFIIRQYAYEQQNATNDRYSVNFQKEAKSFSLKISDSQLEDAALYFCAYSG
Bison bison bison V1052 trbv JPYT01643740.1 622 LVDSEVTQSPKYLIKSRKQQATLRCSPDSGHSSVNWYQQALGQGPQFLVQYYRGQVSGGENMPDRFSAKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bison bison bison V1054 trav JPYT01647550.1 351 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSRSPYLFWYVQHRNLGLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVR
Bison bison bison V1055 trdv JPYT01647645.1 1972 SGVAQSVTQGQPDILSEVGKAVTLNCQYETSWYTFSYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAQKSINLTISALELEDSAMYFCVLRA
Bison bison bison V1057 trgv JPYT01647983.1 1224 THVSSNMEEDKLSVMRATGSSIVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVYYSKVELDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bison bison bison V1058 trbv JPYT01648139.1 734 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVQYYSQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAMYLCASSQ
Bison bison bison V1059 trav JPYT01648609.1 476 GAGAQSVTQPDDHIAVSEGARLELKCNYSSSVSPYLFWYIQYPNQGLQFLLKYVSGDNLVSGIKGFEAEFRNSETSFHLRKIPAHWKDSAKYFCALS
Bison bison bison V1060 iglv JPYT01649943.1 1128 SWAQAVLTQLSSVSGSLGQRVSITCSGSSNNIGRYGVGWYQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYDSSSSN
Bison bison bison V1067 trdv JPYT01699858.1 2964 SGVAQKVTQDQPDISSEAGEAVTLNCRYETSWSSYNIFWYKLFASGEMTFLIGQGSYSLNARDGCYSINFQKSHKAISLTISDLQLEDSAKYFCTLWE
Bison bison bison V1069 trav JPYT01701105.1 2425 VSGKNQVEQSPPSLVVLEGENCTFQCNYTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSSGRYTETLVATSKHSSLHLTAAQLSDPAFYLCVVG
Bison bison bison V1074 trdv JPYT01706900.1 329 SGVAQKVTQDQPVIISQVGKVATLNCQYETSRNVHVYCIFWYKQLPSGEMTYLIRQYSEDGNERDGRYSVNFQKARKSISLTISFLKPEHSAKYFCALWE
Bison bison bison V1075 ighv JPYT01707083.1 1286 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSYGVSWVRQAPGKALECLGGIDNGGCTGYNPGLKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAK
Bison bison bison V1076 trav JPYT01708189.1 1223 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLAPYLFWYVQHLNKAPQLLLKGLTADRKVEHEGFQATHVKHDSSFHLQKQAVQASDSAVYYCALS
Bison bison bison V1077 trav JPYT01708292.1 851 QTHGNSVTQMDGQVSHSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHLEKASGQESDSAVYYCAWR
Bison bison bison V1078 trav JPYT01708294.1 3289 DSRGQSVTQPNDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSDFSFNLRKFSAHWSDSAEYFCALT
Bison bison bison V1079 trav JPYT01708502.1 4947 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGEDYIHWYRQNPSQSPQYVIHGFRGTVNSNMASLTIASDRKSSTLVLPQVTLRDTAVYYCTLRE
Bison bison bison V1081 trav JPYT01710851.1 1628 VSLGNKVEQSPTLSVQEGNSSVITCTYADGNSVYFPWYKQEPGKGPQLLIAIRSNKGKEEDQRLTVLLNKTTKRLSLHIATTEAGDSAVYFCAAS
Bison bison bison V1083 trav JPYT01713110.1 1559 GTNGDSVNQKEGPVTVSEGALLTLNCTYQTKYSDFYLFWYVQHLNKAPQLILKGLTADKKVEHEGFQATLVKSDSSFHLQKRAVQASDSAVYYCALS
Bison bison bison V1084 trav JPYT01713994.1 6636 NVFDAKTTQPSSMDYPEGEDVTLPCNHSTISGTEYIHWYRQNPSQSPQYIIHGFRDTVNSSMASLTISSDRKSSTLVLPQVTLRDTAVYYCVLREAH
Bison bison bison V1085 trav JPYT01715866.1 2646 VRGVDVEQSPPALSLQEGASYTLHCNFSTSSQSVNWYLQNPGGRIIHLFYISSGTKQDGRLNATTVPKEGRGSLYISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V1086 trav JPYT01715867.1 571 TVIDAKTTQPSSMDCAEGEDVNLPCNHSTVGGKDYIHWYRQNPNQSPQYVIHGLRGTVNSSTASLTTASDRKSSTLVLPQVTLRDTTVYYCVLRE
Bison bison bison V1088 trdv JPYT01716450.1 1833 SGVAQKVTQDQPYVTSQIGQSVILNCWYEVSWSGYTHYLYWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Bison bison bison V1089 iglv JPYT01716550.1 1216 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bison bison bison V1090 iglv JPYT01716551.1 739 SWAQAGLTQPASVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPSGVPDRVSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bison bison bison V1093 trdv JPYT01719990.1 1240 SSVAQQVTQVQTAVSSQVGQTVTLNCRYEVSWTTEYYNIFWYKQLPRGEMTFLIRQYSEYGNARNSRYSVNFQKADKSVSFIISALQLEDSAKYFCALQE
Bison bison bison V1095 trav JPYT01720702.1 3431 VSLGNEVEQSPSTLSVQEGNSSVITCTYKDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQRLTVLLNKNTKHLSLHITTIQPGDSAVYFCAAR
Bison bison bison V1096 trav JPYT01721388.1 1454 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPRASLRDTAVYYCIVGD
Bison bison bison V1097 trav JPYT01723211.1 1397 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKGGEVKTQRRWTGRLGESKQHSSLHLAAAQLSDAGTYFCAE
Bison bison bison V1098 trav JPYT01726131.1 3690 VRGMDVAQSPPALSLQEGASSTLQCNFSTFADSMQWYLQNPGGRLIHLFYVPSGTKRDGRLNATTVPTERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V1099 trav JPYT01726132.1 1462 GAGAQSVTQPDDHITVSEGARLELKCNYSTSVSLSLFWYVQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRNSEMSFHLRKIPAHWKDSAKYFCALS
Bison bison bison V1112 trdv JPYT01734041.1 3705 SSVAQRVTQDQLEIASQVGEVVTLSCRYETIQSRYNIYWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFQRSHKSISLMISVLQLEDSAKYFCALWE
Bison bison bison V1113 trdv JPYT01734191.1 369 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLSAYYLYWYKQLPSGQMTYVIRQDSEATNARKDRYSVNFKKADKSINLTISALQLEDSAKYFCALRD
Bison bison bison V1115 trav JPYT01736962.1 351 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGGEYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bison bison bison V1116 trav JPYT01736964.1 753 VNGQQISQIPQFLPLQEGENFTTYCNSSSILSSLQWYKQRPGGSPVLLMILAKGGKVKTEQRLTGRLGETRKYGSLHLAAAQLSDVGTYFCA
Bison bison bison V1119 trdv JPYT01740041.1 1739 SSVAQKVTQYQPDITSQVQNVVILNCWYETSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDSHYSINFQKTHKFISLTISSLKLKHSGKYFCALWE
Bison bison bison V1120 trav JPYT01740056.1 2481 GTNGDSVNQTKGPVTVSEGALLTLNCTYQTADFDPYLFWYIQHLNKAPQLLLKGSISDQNPKSKGFQATLVRSDSSFHLQKRAVQTSDSAVYYCALS
Bison bison bison V1121 trav JPYT01740057.1 1911 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLLWYVQYQNKELEMLLKSSLGNQKVTSRGFEATHISSDSSFRLQKSSGQTSDSAVYYCALS
Bison bison bison V1123 ighv JPYT01740690.1 1863 VLSQVQLRESGPSLVKPSQTLSLTCTTSGFSLSSYGVGWVRQAPGKALEWLGGISSGGSTCLNPALKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCAK
Bison bison bison V1125 trav JPYT01741882.1 1471 VSTKQDVSQSPEALNVREGDSVVLNCSYTDSALYFLQWFWQDPGKGFTSLLSIQANQKEQTSGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Bison bison bison V1127 trav JPYT01743069.1 3834 VIGVDVEQSPAALTAQEGASSTLWCNFSTSSDSVRWYLQKPGGRLIHLIYIPSGTRQGGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCAPQ
Bison bison bison V1128 igkv JPYT01745205.1 17151 ARCDIQVTQSPSYLSASLGDRVSITCQANQSVSHYLNWYQQKPGEAPKLLIYYATSRYTRVPSRFSGSGSGTDFTLTISSLEADDAANYYCQQDYS
Bison bison bison V1129 igkv JPYT01745205.1 1147 ASGEAVLYQTPAYIAASLGESISITCRANQSISDYLSWYKQKPGQAPMILIYDADNRYNGVPERFTATQSETEFVFTISQVEADDAAMYYCQQDY
Bison bison bison V1130 igkv JPYT01745208.1 4171 SSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGKTYLNWIQYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDP
Bison bison bison V1131 igkv JPYT01745210.1 26621 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWLQHKPGQSPQSLIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCVQE
Bison bison bison V1132 igkv JPYT01745210.1 8332 SSGDVVLTQTPLSLSVIPGEMVSISCKSTQSLKYSDGKTYLRWVQHKPGQSPQGVIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQGTYEP
Bison bison bison V1133 igkv JPYT01745212.1 27899 ARCDLQMTQSPSSLSASLGERISITCRASQSVSNYLAWYQQKPGKAPKLLIYHESRLHTGVPSRFSGSGCGTDYTLTISRLEADDAATYYCQQYNS
Bison bison bison V1136 trav JPYT01745339.1 3940 TVINAKSTQPSSMDCAEGEDINLPCNHSTIGGDDYIHWYRQNPNQSPQYVIHGLRGTVNSSVASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bison bison bison V1137 trav JPYT01745339.1 936 VQGVDMEQSPPALSLQEGASYTLQCNFSTFPQSVSWYLQNPGGCIIHLFYIPSGTKKDGRLNATTVPKEGSSSLYISSSQTTDSGTYFCAVQHSAPQ
Bison bison bison V1176 trav JPYT01761523.1 305 GTNGDSVNQTEGPVTVSEGALLTLNCTYQATYSTYYLFWYVQHLNKAPQLLLKGSMTDQKPKSEGFQATLDRSGSSFHLQKRAVQASDSAVYYCALS
Bison bison bison V1197 trgv JPYT01778134.1 2778 IQQEIRVFQRSVMVGHAGGAITMPCQISRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGADGKSYTMSLRKLAKSDEGLYYCATWGS