WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Gasterosteus aculeatus AANH00000000.1 (AANH01) 166 56 10 51 20 28 1 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Gasterosteus aculeatus Vs213 iglv AANH01004322.1 159448 VSGVTVVTQKPVVAVTTGETVSIDCNLGTDSDVRWYKQIPGGVPQFVLYYYHSGGSPTYGTGFSSAKFTSTHQSTSDYRLTIKNIEEGDSAVYYCQTW
Gasterosteus aculeatus Vs40 iglv AANH01004322.1 181549 VSGVTVVTQKPVVAVTTGETLSIDCNLGTVTNSYARWYKQIPGGVPQFVLSYHHSASSPTYGTGFSSPKFTSTHQSTTDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs211 trbv AANH01004122.1 20439 CLGLDVRQSVSDLIMKPGDEEQISCSHDRTDYRQMLWYQQSPGDTAMKLIGYLNFKASTMEESYKDHFIISGDLGGNTAKNGSLVVRGVKQEHSAVYYCAACE
Gasterosteus aculeatus Vs210 trbv AANH01004122.1 21453 PSKNSVAQSPGALIKHPGEEVRIDCNHSNTDFNMIQWYKQSAGESDMLLVGYVRFNFPVLEAPFKDSYNVSGNGGSRACLHIPKPGVPEDGAVYFCAASR
Gasterosteus aculeatus Vs217 ighv AANH01004435.1 60418 SKCEQLTQPASVTVQPGQRLTITCQVSYSPSSYRTAWIREPAGKGLELIGSGRVGYTTYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARN
Gasterosteus aculeatus Vs216 ighv AANH01004435.1 63405 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYEMHWIRQAPGKGLEWIAYISTSGSTINYSPSVKGRFTISRDNPSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs215 ighv AANH01004435.1 64731 VKCEQLTQPASVTVQPGQRLTITCQISYSMSSYHTAWIRQPAGKGLEWIGMKHTGASYYKDSLKSKFSINLDASRKTVTLNGQNVQPGDTAVYYCARDPK
Gasterosteus aculeatus Vs214 iglv AANH01004324.1 4404 VSGVTVVTQKSVVAVTTGETVSIDCNLGTVTDRAAFWYKQIPGGVPQFVLYFYHSWSSPTYGTGFSSPKFTSTHQSTSDYRLTIKNIEEGDSAVYYCQTW
Gasterosteus aculeatus Vs219 ighv AANH01004435.1 57535 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYSMTDHYIHWIRQRPGNALEWIGRMDAGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs218 ighv AANH01004435.1 58967 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSSVMNWIRQAPGKGLEWIAFIHTDSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs42 trav AANH01004365.1 45800 SVTKNESCFPPPKKILLRQTGRIAVLNCPIESHCFKDLRYRWFVFKENMHAHLDFRSDFGLEKYTQEGASLQINSVQVNDSGIYHCAVESGVDP
Gasterosteus aculeatus Vs189 trbv AANH01003795.1 241053 VSQSVLITQWPRYISSPPNGSAEMTCYQNDTNYDYLYWYQQLSGRSFQLIVSTVGGFSSFEVGFKSGFQSVKFSEKQWSLTVTGLQGNHAAVYLCAAS
Gasterosteus aculeatus Vs188 trbv AANH01003795.1 241920 IVISSLLIKQSPVHVLIKPEQVKAHFGCYHGDNNYPYMLWYRSAAGGRRDMELIGLLSYGNANLEKNFEARCNMTGHSTGRAELVISNAKPADSAVYFCAAS
Gasterosteus aculeatus Vs187 trbv AANH01003795.1 244128 HCQGVTQHPEINWSLASKSAEMNCSHNKDASHTQMYWYRQRPGETMTLVVYTVFGGQPDYGKLPQTKYSAVKESSESGALTVKDLQLEDAGVYFCAVS
Gasterosteus aculeatus Vs186 trbv AANH01003795.1 245345 SSLSDQVHQTPADIYNKPTEEATINCSHSIPNYDQILWYKLSRDNKLQFLGYVLKTLRIPEAGLGVKMDGSADKDQMCQLRIEGLVLNSSAVYFCAAS
Gasterosteus aculeatus Vs185 trbv AANH01003795.1 246141 ASLSDQVHQTPSEMFTRPEGTAHIYCSHSIKDYDKILWYKQSRDDAMLFLGYMFATNKNPEVGLGVNMTGSANQHQTCTLTMERVALNSSAVYFCAAW
Gasterosteus aculeatus Vs184 trbv AANH01003795.1 248697 IVISSLLIKQSPVHVLIKPDQVKAHFGCYHGDNNYPYMLWYRSAAGGRRDMELIGLLHYENANLEKNFEARCNMTGHSKGRAELLISNAKPADSAVYFCAAS
Gasterosteus aculeatus Vs183 trbv AANH01003795.1 250972 HCQGVTQHPEINWSLASKSAEMNCSHNKDASHTQMYWYRQRPGETMTLVVYSVFGGQPDYGKLPQTRYSAVKESSESGALTVKDLQLEDAGVYFCAVS
Gasterosteus aculeatus Vs109 igkv AANH01010450.1 55035 SRGQVTVTQSGAVSSAAGGSVSISCTTSQSVHGSNHLAWYQQRDGGAPKLLIYYATTRASETPGRFTGSGSGSSFTLSISGVTAEDAAHYYCQS
Gasterosteus aculeatus Vs108 igkv AANH01010450.1 47730 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGVGSNLHWYLQKPEESPKLLIYYATERQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQSNSFP
Gasterosteus aculeatus Vs208 trbv AANH01004122.1 23225 LTGGSDVVQNPMLWEVEGVDATMNCTHTKGPLFFQMYWYRQLPGETMKQIVYTSTASADHDFGNFSKDKFSATKPDAASGTLTVKKLQQGDKGWYFCAVS
Gasterosteus aculeatus Vs204 trbv AANH01004122.1 29682 CLGLDVRQSVSDLIMKPGDEEQISCSHDRTDYRVMLWYQQSPGDTAMKLIGYLHYKAPTMEESYKDHFIISGDLGGTTAKNGSLVVRGVKQEHSAVYYCAACE
Gasterosteus aculeatus Vs206 trbv AANH01004122.1 26778 PSKNSVAQSPGALIKHPGEEVRIDCNHSNTDFDMIQWYKQSAGESDMLLVGYVQFTSTVVEAPFKDSYNVSGNGGSHACLHIPKPGVPEDGAVYFCAASR
Gasterosteus aculeatus Vs207 trbv AANH01004122.1 24337 CLGLDVRQSVSDLIMKPGDEEQISCSHDRTDYRVMLWYQQSPGDTAMKLIGYLYFKDPTMEESYKDNFNISGDLGGNTAKNGSLVVRGVKQEHSAVYYCAARE
Gasterosteus aculeatus Vs201 trbv AANH01004122.1 35440 LTGGSDVVQNPMLWEVEGVDATMNCTHTKGAQFFQMYWYRQLPGETMKQIVYTSTASADHDFGNFSKDKFSATKPDAASGTLTVKKLQQGDKGWYFCAVS
Gasterosteus aculeatus Vs203 trbv AANH01004122.1 33676 PSKNSVAQSPGALIKHPGEEVRIDCNHSNTDFDMIQWYKQSAGESDMLLVGYVRFTSTVVEAPFKDSYNVSGDGESRACLHIPKPGVPEDGAVYFCAASR
Gasterosteus aculeatus Vs261 ighv AANH01004436.1 5112 VSSQTLSESEPAVKLPGESHKLTCTYAGISDDAAAISWIRQAEGKGLEWIAHISAPSGSNKYYSTSVLNRFTISRDNAVDQVSLQMNSLTTEDSAVYYCARR
Gasterosteus aculeatus Vs39 iglv AANH01004322.1 168973 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTGRVACWYKQIPGGVPQFVLYYHHSHSSPTYGTGFSSPKFTSTHQSTSDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs198 trbv AANH01003800.1 2448 ASHPKGVFQTPPSIIKELGQSVVGKEISCSHNMPNYDVFLWYKREKERGDLKLLGFLNVDYPNPEDDVKGKIDLKGDARDIATLTISDLVLNDTGVYFCAAS
Gasterosteus aculeatus Vs190 trbv AANH01003795.1 240182 QVSAATFQQSPPQIVEESTEVHINCSHDDSNLVVMLWYQQRRDNGSLALIGYGWVGSPNYEGQFKEQFELTRADTMRGALVVRTAAPSHSAVYFCAAS
Gasterosteus aculeatus Vs191 trbv AANH01003795.1 239653 YVKSVRFEPQSPRIVNDKARVEIKCSHNDSSFYVMLWYQQTQRGLVHFIGYSYAGSAPVYEKQFEVGFEITREGTQTGALVVARANQSDSAVYFCAAS
Gasterosteus aculeatus Vs192 trbv AANH01003795.1 238593 LAVVVLQSGDQTSHPGHAVSFVCNMGQGVSMGSYTMLWYRQTHRGAPLDFLSKEYDQTTGHFQSSIDTSRNNFSLQITEVLLNDSSTYYCAA
Gasterosteus aculeatus Vs193 trbv AANH01003796.1 2813 ASPSDHVHQTPSEMFTRPEGTAHIYCSHSIKDYNKILWYKQSRDDAMLFLGYMFANNKNPEVGLGVNMTGSANQHQTCTLTMERVALNSSAVYFCAAW
Gasterosteus aculeatus Vs194 trbv AANH01003797.1 2823 ASLSDQVHQTPSEMFTRPEGTAHIYCSHSIKDYDKILWYKQSRDDAMLFLGYMFANNKNPEVGLGVNMTGSANQHQTCTLTMERVALNSSAVYFCAAR
Gasterosteus aculeatus Vs195 trbv AANH01003797.1 2043 SSLSDQVHQTPADIYNKPTEEATINCSHSIPNYDRIFWYKLSRDNKLQFLGYVLKTLRIPEAGLGVKMDGSADKNQMCQLRIEGLVLNSSAVYFCAAS
Gasterosteus aculeatus Vs196 trbv AANH01003797.1 827 HCQGVTQHPEINWSLVSKSAEMNCSHNKDAGHNQMYWYRQRPGETMTLVVYTVFGGQPDYGKLPQTKYSAVKESSESGALTVKDLQLEDAGVYFCAVS
Gasterosteus aculeatus Vs197 trbv AANH01003798.1 1368 SSLSDQVHQTPADIYNKPTEEATINCSHSIPNYDRIFWYKLSRDNKLQFLGYVLKTLRIPEAGLGVKMDGSADKNQMCQLRIEGLVLNSSAVYFCAAS
Gasterosteus aculeatus Vs110 igkv AANH01010450.1 64042 SSGEIQLTQSPGSQSVLPGQTVSIRCKASSAISTYLHWYLQKPEESPKLLINYASSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQSNSSP
Gasterosteus aculeatus Vs111 igkv AANH01010450.1 68219 SRGQFTVTQPGAVSSAAGGSVSISCTTSQSVYNSNYLAWYQQRDGGAPKLLIYDATTRASETPGRFTGSGSGSSFTLSISGVTAEDAAHYYCQSFM
Gasterosteus aculeatus Vs112 igkv AANH01010450.1 70585 SSGEIQLTQSPGSQSVVPGQTVSIRCKSSSGVGSNLHWYLQKPEESPKLLIYYATERQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGYSFP
Gasterosteus aculeatus Vs113 igkv AANH01010450.1 78563 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNYLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGYSSP
Gasterosteus aculeatus Vs115 igkv AANH01010454.1 1160 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNDLHWYLQKPEESPKLLIYYASNRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSRP
Gasterosteus aculeatus Vs116 igkv AANH01010454.1 9501 SSGEIQLTQSPGSQSVLPGQTVSIRCKSSSGVGSNLHWYLQKPEESPKLLIYYATSRQSGISERFSGSGSGSDFTLTIRGVLTEDAGDYYCQQ
Gasterosteus aculeatus Vs117 igkv AANH01010454.1 16163 SSGEIQLTQSPGSQSVLPGQTVSIRCKASSGISNNLHWYLQKPEESPKLLIYWATSRQSGISERFSGSGSGSDFTLTIRGVLTEDAGDYYCQQSNSSP
Gasterosteus aculeatus Vs118 igkv AANH01010454.1 22768 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNDLHWYLQKPEESPKLLIYYASSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSRP
Gasterosteus aculeatus Vs297 trav AANH01010714.1 19665 PIEAAEVQQVSLTEAELGGNVTFQCPVSETENSYLNWYKQPLGCTIQTVSTRTFTKQTFSPQFNNSRFRVTLHSLTIMNISKEDEATYFCFTGTLY
Gasterosteus aculeatus Vs296 igkv AANH01010713.1 4351 NVPVITKSAPADPVRPGDSVTLQCSVLSVSEETECPEGQKVFWFKAGSDRSPPHVIYVHGNRDGCEQSPEAPPPHRCVYSFSKNISSSDAGTYYCAA
Gasterosteus aculeatus Vs330 ighv AANH01016096.1 2809 VWSEIKHEQSPFEVKKPGEKVKMSCFTSGYTMTDHYIHWIRQRPGNALEWIGRMNTGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCARE
Gasterosteus aculeatus Vs254 ighv AANH01004436.1 21479 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYSMTNFYISWIRQRPGNALEWIGRMDAGSNSAIYSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs141 iglv AANH01014092.1 10931 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTDRAAFWYKQIPGGVPQFVLYYHHSHSSPTYGTGFSSPKFTSTHQSTSDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs276 igkv AANH01007248.1 92082 HLLAGIQSAAVRQDTGVKSASVGDNVTLHCFYNTQVAMHFSWYRQTLGGGPELLSNFYKHDEPSKVFHWLEKNPRYSVQREEGMNHLNISEVQLSDSATYFCGS
Gasterosteus aculeatus Vs25 igkv AANH01002538.1 1485 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNNLHWYLQKPEESPKLLIYYASSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGYSSP
Gasterosteus aculeatus Vs24 igkv AANH01002537.1 69078 SRGQVTLTQPGAVSSAAGGSVSISCTTSQSVHGSNHLAWYQQRDGGAPKLLIHYATSRPSGTPGRFTGSGSGSSFTLSISGVTAEDAAHYYCQS
Gasterosteus aculeatus Vs23 igkv AANH01002537.1 64914 SSGEIQLTQSSGSQSVLPGQTVSIRCKASSGISNYLHWYLQKPEESPKLLIYRASSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGLSFP
Gasterosteus aculeatus Vs22 igkv AANH01002537.1 57085 SSGEIQLTQSPGSQSVLPGQTVSIRCNASSGISTYLHWYLQKPEESPKLLIYRASSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGYSQ
Gasterosteus aculeatus Vs21 igkv AANH01002537.1 55165 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISTYLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCSQSGYSFP
Gasterosteus aculeatus Vs20 igkv AANH01002537.1 48539 SSGEIKLTQSPGSQSVLPGQTVSIRCKANSGISSNLHWYLQKPEESPKLLIYHATNRQSGISDRFSGSRSRSDFTLTIRGVLTEDAGDYYCQQGYSSP
Gasterosteus aculeatus Vs257 ighv AANH01004436.1 15121 FKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYYTAWIRQPAGKGLEWIGQRFTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs256 ighv AANH01004436.1 17295 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYAMNWIRQAPGKGLEWIAFIHTSSSHIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs331 ighv AANH01016096.1 1226 VKCEQLTQPASVTVQPGQRLTITCQVSYALGYYTAWIRQPAGKGLEWIGWKSTGDSDYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCAR
Gasterosteus aculeatus Vs298 trav AANH01010714.1 10423 PIEAAEVQQVSLTEAELGGNVTFQCPVSEEEKNILYWYKQPLGCTIQTVATITFTKQTLRTQFNNSRFRVTQDSLTIMNISKEDEATYFCFTG
Gasterosteus aculeatus Vs253 ighv AANH01004436.1 23125 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFRSYYMTWIRQAPGKGLECIAYIGTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARQ
Gasterosteus aculeatus Vs252 ighv AANH01004436.1 24989 FKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGSKYTGDSRYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs143 trav AANH01014739.1 9287 NTLEDDITANSAEVLSSEGFSVSLSCKYSVKANNLQWYRQNPGSSPQFLLLITDTQQPSVVHAQPPEPRLTAELNKERTQVHLKISSATVSDSAVYYCAVQ
Gasterosteus aculeatus Vs142 iglv AANH01014424.1 3815 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTNSGARWYKQIPGGVPQFVLYYYHSGGSPFYGTGFSSSKFTSTHQSTTDYRLTIKNIEEGDSAVYHCQTW
Gasterosteus aculeatus Vs140 igkv AANH01013895.1 295 ADVPVITKSAPADPVRPGDSVTLKCSVLSVSEETECPEGQKVFWFKAGSDRSPPHVIYVHGNRDGCEQSPEAPPPHRCVYSFSKNISSSDAGTYYCAA
Gasterosteus aculeatus Vs145 trav AANH01014739.1 15434 CSGEDTVTQSTGEVIATEGHTVTLDCTFEISSSINAYLFWYKQEVNNQLMYILRRDTLNTEDNSPEFQKDRFDATINKTSVPLKISSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs144 trav AANH01014739.1 11032 RGSMQQETSIKPESTEEHVSEGRSINLTCKYQGTIYSIQWYRQYRRSIPEFLLYITEEGSIHQTAPGVSAHINKADKRVDLEISSAAVSDSAVYYCAVK
Gasterosteus aculeatus Vs260 ighv AANH01004436.1 6989 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYTMTDHYIHWIRQRPGNALEWIGRMDTGSNSATFSSSFQSRFIMTEDVPKSTQYLEVTSLTAEDSAVYFCARE
Gasterosteus aculeatus Vs148 trav AANH01015297.1 27 PIEAAEVQQVSLTEAELGGNVTFQCPVSEEEKNVLYWYKQPLGCTIQTVSTRTFTKQTFSPQFNNSRFRVTQDSLTIMNISKEDEATYFCFTGSQFS
Gasterosteus aculeatus Vs13 igkv AANH01002537.1 6824 SSGEIQLTQSPGSQSVLPGQTVSIKCKASSGISTYLHWYLQKPEESPKLLIYYTTNRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSRP
Gasterosteus aculeatus Vs16 igkv AANH01002537.1 23863 SRGQVTVTQPGAVSSAAGGSVSISCTTSQSVHSSNYLAWYQQRDGGAPKLLIYLATTRASETPGRFTGSGSGSSFTLSISGVTAEDAAHYYCQS
Gasterosteus aculeatus Vs17 igkv AANH01002537.1 26257 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNYLHWYLQKPEESPKLLIYDATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSSP
Gasterosteus aculeatus Vs14 igkv AANH01002537.1 11092 SRGQVTVTQPGAVSSAAGGSVSISCTTSQSVYSSNSLAWYQQRDGGAPKRLIYSATTRASGTPGRFTGSGSGSSFTLSISGVTAEDAAHYYCQS
Gasterosteus aculeatus Vs15 igkv AANH01002537.1 13417 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNNLHWYLQKPEESPKLLIYYAASRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSPP
Gasterosteus aculeatus Vs18 igkv AANH01002537.1 33672 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNYLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGYSQ
Gasterosteus aculeatus Vs19 igkv AANH01002537.1 42206 ESGEIKLTQSPGSQSVVPGQTVSIRCKASSGISSNLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSPP
Gasterosteus aculeatus Vs212 iglv AANH01004322.1 221388 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTNSDARWYKQIPGGVPQFLIRFHRGDSSPTYGTGFSSPKFTSTHQSTTDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs251 ighv AANH01004436.1 29790 VDGQTLTQSEAVIKRPEETHRLTCTTSGFTFSSYHMNWIRQAPGKGLEWIAFISTSSSSIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs317 trbv AANH01014909.1 11865 ASLSDQVHQTPSEMFTRPEGTAHIYCSHSIKDYDKILWYKQSRDDAMLFLGYMFATNKNPEVGLGVNMTGSANQHQTCTLTMERVALNSSAVYFCAAR
Gasterosteus aculeatus Vs250 ighv AANH01004436.1 31143 FKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYATQWIRQPAGKGLEWIGSKYTLASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs313 iglv AANH01014091.1 4455 VSGVTVVTQKPVVAVTTGETVSIDCNLGTGTDGARWYKQIPGGVPQFVVYHYHASSPTYGTGFSSPKFTSTHQSTSDYRLTIKNIEEGDSAVYYCHTW
Gasterosteus aculeatus Vs310 trav AANH01013893.1 7118 PIEAAEVQQVSLMEAELGGNVTFQCPVSEKEKNILYWYKQPLGCTIQTVATRFFTKQTFRPQFNNSRFRVTQDSLTIMNISKEDEATYFCFTG
Gasterosteus aculeatus Vs237 ighv AANH01004436.1 82148 VKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYYTAWIRQPAGKGLEWIGMKHTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs318 trbv AANH01014909.1 11085 SSLSDQVHQTPADIYNKPTEEATINCSHSIPNYDRIFWYKLSKDNKLQFLGYVLKTLRIPEAGLGVKMDGSADKNQMCQLRIEGLVLNSSAVYFCAAS
Gasterosteus aculeatus Vs319 trbv AANH01014909.1 9868 HCQGVTQHPEINWSLASKSAEMNCSHNKDASHTQMYWYRQRPGETMTLVVYTVFGGQPDYGKLPQTKYSAVKESSESGALTVKDLQLEDAGVYFCAVS
Gasterosteus aculeatus Vs236 ighv AANH01004436.1 84223 FKCEQLTQPASVTVQPGQRLTITCQVSYALNSYYTAWIRQPAGKGLEWIGQRFTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs238 ighv AANH01004436.1 79559 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYYMHWIRQAPGKGLEWIAVIGTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARY
Gasterosteus aculeatus Vs129 trav AANH01012461.1 9359 NTLEDDITANSAEVLSSEGFSVSLSCKYAVKANNLQWYRQYSGSSPQFLLLITDTQQPSVVHAQPSEPRLTAELNKERTQVHLKIPSATVSDSAVYYCAVQ
Gasterosteus aculeatus Vs128 trav AANH01012461.1 4030 CSGEDTVTQSTGEVIATEGHTVTLDCTFEISSSINAYLFWYKQEVNNQLMYILRRDTLNTEDNSPEFQKDRFDATINKTSVPLKISSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs321 ighv AANH01015021.1 6432 FKCEQLTQPASVTVQPGQRLTITCQVSYALSSYWTAWIRQPAGKGLEWIGSGCDGCTSHYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs320 ighv AANH01015021.1 10809 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSGYPMNWIRQAPGKGLEWIAYISTSSTPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs327 igkv AANH01015297.1 6411 ADVPVITKSAPADPVRPGDSVTLQCSVLSVSEETECPEGQKVFWFKAGSDRSPPHVIYVHGNRDGCEQSPEAPPPHRCVYSFSKNISSSDAGTYYCAA
Gasterosteus aculeatus Vs326 igkv AANH01015093.1 2510 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGVGSNLHWYLQKPEESPKLLIYRATNRQSGISERFSGSGSGSDFTLTIRGVLTEDAGDYYCSQS
Gasterosteus aculeatus Vs325 igkv AANH01015093.1 9102 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNYLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSRSRSDFTLTIRGVLTEDAGDYYCQQGYSSP
Gasterosteus aculeatus Vs324 ighv AANH01015021.1 1253 VKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYYTAWIRQPAGKGLEWIGQRSTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARN
Gasterosteus aculeatus Vs120 trav AANH01010714.1 1937 PIEAAEVQQVSLTEAELGGNVTFQCSVSEEEKNVLYWYKQPLGCTIQTVATITFTKPTLRTQFNKPRFRVTQDSLTIMNISKEDEATYFCFYG
Gasterosteus aculeatus Vs329 ighv AANH01016096.1 4479 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYYMYWIRQAPGKGLEWIAYISTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs125 trav AANH01012460.1 8385 CSGEDTVTQSTGEVIATEGHTVTLDCTFEISSSINAYLFWYKQEVKNQLIYILRRDTLNTEDNSPEFQKDRFDATINKTSVPLKISSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs127 trav AANH01012460.1 12248 CSGEDTVTQSTGEVIATEGHTVTLDCTFEISGSINAYLFWYKQEVNNQLIYILRRHTLNTEDNSPEFQKDRFDATINKTSVPLKISSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs126 trav AANH01012460.1 10897 NTLEDDITANSAEVLSSEGFSVSLSCKYSVKADNLQWYRQNPGSSPQFLLLITDTQQPSVVHAQPPEPRLTAELNKERTQVHLKISSATVSDSAVYYCAVQ
Gasterosteus aculeatus Vs79 igkv AANH01007248.1 35171 LLHQSPSETIQPGGSVTLNCTVQTGTCDGQHSVYWFKDSEESHPALIYTDRGSTDQCERKPNTQTHTCDYNLPMESLNLSHAGTYYCAVASC
Gasterosteus aculeatus Vs332 ighv AANH01016698.1 798 VWSEIKHEQSPFEVKKPGEKVKMSCFTSGYTMTDHYIHWIRQRPGNALEWIGRMNTGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCARE
Gasterosteus aculeatus Vs70 igkv AANH01007246.1 90520 HAADLKLSSPERQERGFMSVDVGHKITLQCFYQKNDGSWLNWYKQTLGQKPKLISTFYEFNKNGTFHHEFKNNPRFTLDTEKGQNHLTILDLKMSDTATYYCAF
Gasterosteus aculeatus Vs71 igkv AANH01007246.1 90893 WTVPALLHQSPSETIQPGGSVTLNCTVQTGTCDGQHSVYWFKDSEKSHPALIYTDGGSTDQCERKPNTQTHTCDYNLPMESLNPSHAGTYYCAVASC
Gasterosteus aculeatus Vs72 igkv AANH01007246.1 98329 HATDVKLSSSVRQEKGFASVDAGEKIILQCFYEITGGAWLYWLKQTLGKQPKLVSTFYQFNKNGTFHHEFNNNPRFTLDKDKGQNHLTIFDSKISDSATYYCAS
Gasterosteus aculeatus Vs73 igkv AANH01007246.1 105125 QTTDLDSFSSVHQGNSFLSVETWGNLTLKCFYEASSAAKLYWFKHTLGQKPRLISTSYRYTRATFNAEFKNSRYTVDTENDQNHLTIKDLQINDSATYYCVSSN
Gasterosteus aculeatus Vs74 igkv AANH01007247.1 10931 HATDLKLPSPVHQEKGFASVDVGDRITLQCFYQNNVGSWLYWFKKMMEQQPKLISSFYTYNQNGTFHHEFNNNPRFTLDNEKGQNHLTIFDIKISESATYYCAS
Gasterosteus aculeatus Vs75 igkv AANH01007247.1 15175 HSTDLKLSSPVHQARRFASVGVGDKITLECFYQNKGGEWLYWFKQMFGQQPKLISNFYTYNKKENFHHEFENNPRFTLDNEKSHNHLTITNLNISDSATYYCAH
Gasterosteus aculeatus Vs76 igkv AANH01007247.1 36466 LLHQSPSETIQPGGSVTLNCTVQTGTCDGQHSVYWFKDSEESHPALIYTDGGSTDQCERKPNTQTHTCDYNLPMESLNLSHAGTYYCAVASC
Gasterosteus aculeatus Vs77 igkv AANH01007247.1 42774 HSTDLKLSSPVHQARRFASVGVGDKITLECFYQNKGGEWLYWFKQMFGQQPKLISNFYTYNKKENFHHEFENNPRFTLDNEKSHNHLTITNLNISDSATYYCAH
Gasterosteus aculeatus Vs85 igkv AANH01007248.1 79877 LLHQSPSETIQPGGSVTLNCTVQTGTCDGQHSVYWFKDSEESHPGLIYTDGGSTDQCERKANTQTHTCDYNLPMESLNLSHAGTYYCAVASC
Gasterosteus aculeatus Vs84 igkv AANH01007248.1 79494 QTTDLDSSSSVHQGNSFLSVQTGGNLTLTCFHKASSAARLHWFKHTLGQKPRLISSYSRFTIPTFYAEFKNPRITVDKENDRNHLTIKDLQMNDSATYYCVSSN
Gasterosteus aculeatus Vs255 ighv AANH01004436.1 19954 VKCEQLTQPASVTVQPGQRLTITCQVSYALGYYTAWIRQPAGKGLEWIGMKHTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs86 igkv AANH01007248.1 83153 QTTDLDSSSSVYQGNSFLSVQTGGNLTLKCFHEASSAARVHWFKHTLGQKPRLISSYSRFTNLTFYVEFKNPRFTVDTGNNTNHLTIKDLQINDSATYYCVSSN
Gasterosteus aculeatus Vs81 igkv AANH01007248.1 59677 QTTDLDSSSSVYQGNSFLSVQTGGNLTLKCFYEAVSAGTLYWFKHTLGQKPRLISSYNRFTIPTFYAEFKKPRFRVDTENDRNHLMITDLQMNDSATYYCVSSN
Gasterosteus aculeatus Vs80 igkv AANH01007248.1 44122 QTTDLDSSSSVYQGNSFLSVETGGNLTLKCFHEAGSAAKVHWFKHTLGQEPRLISSSYRFKTVTFNAEFKNPRITLDNENDRNHLTIKDLQMNDSATYYCVSSN
Gasterosteus aculeatus Vs83 igkv AANH01007248.1 74287 QTTDLDSSSSVHQGNSFLSVQTGGNLTLTCFHKASSAARLHWFKHTLGQKPRLISSYSRFTIPTFYAEFKNPRFTVDTENDQNHLRIIDLQINDSATYYCVSSK
Gasterosteus aculeatus Vs82 igkv AANH01007248.1 69080 QTTDLDSSSSVHQGNSFLSVQTGGNLTLKCIREAGTAAKLYWFKHTLGQKPRLISSSYRFTNLTFDAEFKNPRFTVDTENDQNHLRIIDLQINDSATYYCVSSN
Gasterosteus aculeatus Vs259 ighv AANH01004436.1 11539 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYRMTWIRQAPGKGLEWIAYISTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARY
Gasterosteus aculeatus Vs258 ighv AANH01004436.1 13699 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYTMTSFYISWIRQRPGNALEWIGRMDAGSNSATFSSSFQSRFIMTEDVPKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs235 ighv AANH01004436.1 86860 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYPMNWIRQAPGKGLEWIAFIHTSSSSMYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARE
Gasterosteus aculeatus Vs234 ighv AANH01004436.1 89439 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGWKYTGDSRYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs138 igkv AANH01013891.1 2351 ADVPVITKSAPADPVRPGDSVTLQCSVLSVSEETECPEGQKVFWFKAGSDRSPPHVIYVHGNRDGCEQSPEAPPPHRCVYSFSKNISSSDAGTYYCAA
Gasterosteus aculeatus Vs139 trav AANH01013893.1 330 PIEAAEVQQVSLTEAELGGNVTFQCSVSEKEKYIFYWYKQPLGCTIQTVATITFTKQTLRTQFNNSRFRVTQDSLTIMNISKEDEATYFCFTG
Gasterosteus aculeatus Vs231 ighv AANH01004436.1 93529 FKCEQLTQPASVTVQPGQRLTITCQVSYALNYWTAWIRQPAGKGLEWIGSKYTGDSYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs230 ighv AANH01004435.1 11928 VSSQTLSESEPAVKLPGESHKLTCTYAGISDDAADICWIRQAEGKGLEWIAQISAPSGSSKYYSTSVLNRFTISRDNAVDQVSLQMNSLTTEDSAVYYCARR
Gasterosteus aculeatus Vs233 ighv AANH01004436.1 90530 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYTMTDHFISWIRQRPGNALEWIGRMNTGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCARE
Gasterosteus aculeatus Vs232 ighv AANH01004436.1 92199 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYYMTWIRQAPGKGLEWIAYISTSSSYIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs132 trav AANH01012461.1 19481 NTLEDDITANSAEVLSSEGFSVSLSCKYSVKADNLQWYRQNPGSSPQFLLLITDTQQPSVVHAQPPEPRLTAELNKERTQVHLKIPSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs133 trav AANH01012461.1 21676 RGSMQQETSIKPESTEEHVSEGRSINLTCKYQGTIYNIQWYRQYRRSIPEFLLYITEEGTIHQTAPGVSAHINKADKRVDLEISSAAVSDSAVYYCAVK
Gasterosteus aculeatus Vs130 trav AANH01012461.1 15264 NTLEDDITANSAEVLSSEGFSVSLSCKYSVKADNLQWYRQNPGSSPQFLLLITDTQQPSVVHAQPPEPRLTAELNKERTQVHLKIPSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs131 trav AANH01012461.1 17010 RGSMQQETSIKPESTEEHVSEGRSINLTCKYQGTIYNIQWYRQYRRSIPEFLLYITEEGSIHQTAPGVSAHINKADKRVDLEISSATVSDSAVYYCAVR
Gasterosteus aculeatus Vs239 ighv AANH01004436.1 77389 FKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGWKYTGDSYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs137 igkv AANH01013773.1 12976 SSGEIQLTQSPGSQSVLPGQTVSIRCKASSGIGTYLHWYLQKPEESPKLLIYYATSRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSPP
Gasterosteus aculeatus Vs134 trav AANH01012461.1 27367 RGSMQQETSIKPESTEEHVSEGRSINLTCKYQGTIYSIQWYRQYRRSIPEFLLYITEEGSIHQTAPGVSAHINKADKRVDLEISSATVSDSAVYYCAVE
Gasterosteus aculeatus Vs69 igkv AANH01007246.1 84672 WTVPALLHQSPSETIKPGGSVTLNCTVQTGTCDGQHSVYWFKDSEESHPALIYTDGGSTDQCERKPNTQTHTCDYNLPMESLNLSHAATYYCAVASC
Gasterosteus aculeatus Vs68 igkv AANH01007246.1 84311 HATDMTVRQERRFASVNVGENITLQCFHQNTGRIWLHWYKQMLGQQPKMMSTFYQFNKNGTFHHEFKNNPRFTLDTEKGQNHLTILDLKMSDSATYYCAQ
Gasterosteus aculeatus Vs322 ighv AANH01015021.1 4484 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYYMYWIRQAPGKGLEWIAVIGTSSSPINYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs240 ighv AANH01004436.1 74726 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSGYPMNWIRQAPGKGLEWIAYISTSSTPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs241 ighv AANH01004436.1 72551 FKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYYTAWIRQPAGKGLDWIGQRFTGASYYKDSLKSKFSIELDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs242 ighv AANH01004436.1 71113 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYYMNWIRQAPGKGLEWIAIIHPSSSPIYYSPSVKGRFTISRDNPSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs243 ighv AANH01004436.1 69459 VWSEIKLEQSPSEVKKPGEKVKMSCITSGYSMTSYNIHWIRQRPGNALEWIGWMNTGSNSATFSSSFQSRFIMTEDVPKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs244 ighv AANH01004436.1 67947 VSSQTLSESEPAVKLPGESHKLTCTYAGISDDAADISWIRQAEGKGLEWIAHISAPSGSNKYYSTSVLNRFTISRDNAVDQVSLQMNSVTTEDSAVYYCART
Gasterosteus aculeatus Vs245 ighv AANH01004436.1 43318 VKCEQLTQPASVTVQPGQRLTITCQVSYALNSYYTAWIRQPAGKGLEWIGMKHTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARN
Gasterosteus aculeatus Vs246 ighv AANH01004436.1 41592 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYPMNWIRQAPGKGLEWIAFIHTSSTPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs247 ighv AANH01004436.1 39324 FKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYWTAWIRQPAGKGLEWIGWKSTGDSDYKDSLKSKFSIELDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs248 ighv AANH01004436.1 37916 VWSEIKLEQSPSEVKKPGEKVKMSCITSGYTMTSFYISWIRQRPGNALEWIGRMNTGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCAR
Gasterosteus aculeatus Vs249 ighv AANH01004436.1 36346 VKCEQLTQPASVTVQPGQRLTITCQVSYALGYYTAWIRQPAGKGLEWIGMKHTGASYYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARN
Gasterosteus aculeatus Vs226 ighv AANH01004435.1 18846 VDGQTLTQSEAVIKRPEDSHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIAYIGRSSSPINYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs227 ighv AANH01004435.1 16546 FKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGWKCTGGSHYKDSLKSKFSIDLDASSKTVTLNGQNVQPGDTAVYYCARD
Gasterosteus aculeatus Vs224 ighv AANH01004435.1 47059 VWSEIKLEQSPSEVKKPGEKVKMSCITSGYSMTSYNIHWIRQRPGNALEWIGRMDTGSNSAIYSSSFQSRFIMTEDVPKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs225 ighv AANH01004435.1 20731 VKCEQLTQPASVTVQPGQRLTITCQVSYSMSSYYTAWIRQPAGKGLEWIGQRYTGASYYKDSLKSKFSINLDASSKTVTLNGQNVQPGDTAVYYCARN
Gasterosteus aculeatus Vs222 ighv AANH01004435.1 51051 FKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGSGRVGYTTYYKDSLKSKFSINLDASSKTVTLNGQNVQPGDTTVYYCARD
Gasterosteus aculeatus Vs223 ighv AANH01004435.1 48491 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIAYIGTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs220 ighv AANH01004435.1 55344 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYWMNWIRQAPGKGLEWIAFISTSSSSIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARD
Gasterosteus aculeatus Vs221 ighv AANH01004435.1 53342 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIAYIGRSSSPINYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCARD
Gasterosteus aculeatus Vs228 ighv AANH01004435.1 15076 VDGQTLTQSEAVIKRPEESHRLTCTTSGFTFRSYEMNWIRQAPGKGLEWIAFISTSSSPIYYSPSVKGRFTISRDDSSSKLYLQMNSLKTEDSAVYYCAR
Gasterosteus aculeatus Vs229 ighv AANH01004435.1 13423 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYTMTDHFISWIRQRPGNALEWIGRMNTGSNSATFSSSFQSRFIMTEDVSKSTQYLEVTSLTAEDSAVYFCA
Gasterosteus aculeatus Vs38 iglv AANH01004322.1 154546 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTNSAARWYKQIPGGVPQFVLYYHHSHSSPTYGTGFSSPKFTSTHQSTTDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs199 trbv AANH01003800.1 1370 HIDGSDVTQTALLWKDKGAEATMNCSHTKGSSYYQMYWYRQLPGETMKQIVYTSLGVNHDFGNFSKEKFSATKPDADSGTFTVKNLQPQDKGLYFCAVS
Gasterosteus aculeatus Vs114 igkv AANH01010453.1 281 SSGEIQLTQSPGSQSVVPGQTVSIRCKASSGISNDLHWYLQKPEESPKLLIYYASNRQSGISDRFSGSGSGSDFTLTIRGVLTEDAGDYYCQQGSSRP
Gasterosteus aculeatus Vs307 trgv AANH01012760.1 15609 LVAMAAQLIQEDLTLTRTVGGKVSFSCGGTDQCSTYYVHWYQKRDTGTFTWILRINKRSGSIDKSYNHPQKDDFTAVKKEYGCDLEIQKVDLTHSASYYCACR
Gasterosteus aculeatus Vs146 iglv AANH01014873.1 2394 VSGVTVVTQKPVVAVTTGETVSIDCNLGTVTGRVACWYKQIPGGVPQFVSYYHHSHSSPTYGTGFSSPKFTSTHQSTSDYRLTIKNIEEGDSAVYYCNTW
Gasterosteus aculeatus Vs78 igkv AANH01007248.1 6733 WTVPALLHQSPSETIQTGGSVTLNCTVQTGTCDGQHSVYWFKDSEESHPALIYTDGGSTDQCERKANTQTHTCDYNLPMESLNLSHAGTYYCAVASC
Gasterosteus aculeatus Vs323 ighv AANH01015021.1 2822 VWSEIKHEQSPSEVKKPGEKVKMSCITSGYTMTDHFISWIRQRPGNALEWIGRMNAGSNSATFSSSFQSRFIMTEDESKSTQYLEVTSLTAEDSAVYFCA