WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Elephantulus edwardii AMGZ00000000.1 (AMGZ01) 155 34 20 4 57 21 10 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Elephantulus edwardii V98 trav AMGZ01058497.1 1950 TVGQDIQQPTELTAVEGTSVQVNCTYQTSGFNGLSWYQQSDGGAPGFLFYIVLDGSDKRDRFFSFLNRSKMYSYLLLTELQLKDSAYYFCAVR
Elephantulus edwardii V99 trav AMGZ01058508.1 13041 GTGAQSVTQPDIQVTVSEGAPLELRCNYSYSIPPDLFWYIQYPNQGLQLLLKATPGNSFVTGIKGFEAERRKTDNSFHLKKSSVHWSESAEYFCALS
Elephantulus edwardii V100 trav AMGZ01058508.1 18574 GVKGVKVEQSPSALSLQEGTSCTLRCNYSTAPDNVQWFRQNPRGGLVRLFFIVSDVKQNGRLKSTINSKEFYSTLHITDSQLEDTATYLCAVEE
Elephantulus edwardii V101 trav AMGZ01058508.1 30873 VNSQKVEQNPQTLSIQEGETVTLLCNFTLTPSVLQWYRQDRDRGLIFLLLIRENEAIKQEERLSVTFERTTKQSSFQIRASQPADSAIYLCAA
Elephantulus edwardii V102 trav AMGZ01058509.1 3299 GTHGDSVIQTEGQVSLLEGAPLTLNCTYQTSYSAFLFWYVQYQNEAPKLLLKSSSGNQEIDNRGFQADHVKGDSSFHLKKPSVQVSDSAVYYCALG
Elephantulus edwardii V103 trav AMGZ01058510.1 8025 EARAQTVTQPDARFSVLEGSSLELRCNYSYGGAISLFWYVQYPRQGLQLLLKYYAGETRVKGINGFEAEFKKSESSFNLKKHSVGWSDSAEYFCAAS
Elephantulus edwardii V104 trav AMGZ01058510.1 17863 GNNGDTVTQTEGQMTLSEGAFLSVNCSYTAKGYPTLFWYAQYPDGRLKLLLLAAKDKDKGVNKGFKATYDKETSSFHLEKASVQESDSAVYYCALS
Elephantulus edwardii V105 trav AMGZ01058511.1 2235 HIRAQSVTQPEGHISMVEGSSLELRCNFSYSGNPYLFWYIKYPSQGLQFLLKYYSGETLVKGINGFEAAFKKSESSFNLRKHSAVWSDSAEYFCAVS
Elephantulus edwardii V106 trav AMGZ01058511.1 11238 GNNGDTVTQTEGQITLSKGAFLTVNCSYTSTTYVTLFWYVQYPDGGLKVLLKAAKDKDKGSNKGFEATYDKETSSFHLEKASVQESDSAVYYCALS
Elephantulus edwardii V107 trav AMGZ01058515.1 4151 QIGAQSVTQPEVQVSVSEGSSLELKCNFSYSGTPYLYWYANYPSQGFQYLLKYYAGETRVKGLNGFEAEFKKSESSFNLKKHSAGWSDSAEYFCAVS
Elephantulus edwardii V108 trav AMGZ01058515.1 18078 RSNGDSVTQTEGQIALFEGTFLTVNCSYTTTQYPALFWYVQYANKGLQLLLKATVAKDKGSYKGFEATYDKETSSFHLEKASVQESDSAVYYCALS
Elephantulus edwardii V109 trav AMGZ01058515.1 28273 ETRAQSVTQLDIEVSVFEGSSLEMRCNYSYGATPYLFWYVQYPRQGLQLLLKYFSGETLVKGINGFEAEFKKSESSFNLRKRSAGWSDSAEYFCAVS
Elephantulus edwardii V110 trav AMGZ01058515.1 37310 DARAQSVTQLDVQVSVSEGFSLELRCNYSVTRTPYLYWYVQYPSEGLQLLLKYFSGETLVKGINGFEAEFKKSESSFNLRKHSAGWSDSAEYFCAVS
Elephantulus edwardii V111 trav AMGZ01058515.1 48455 ETRAQSVTQPDVQVSVSEGFSLELRCNFSYTGTLYLYWYIKYPSQGLQLLLKYFSGETLVKGINGFEAEFKKSESSFNLRKHSAGWSDSAEYLCAVS
Elephantulus edwardii V112 trav AMGZ01058515.1 51061 RSNGNTVIQTEGQMTLSEGDFLIVNCSYISTWYPTLFWFVQYPNEGLQLFLKAETANSKGTNKGFEATYDKETSSFHLEKASVQKSDSAVYYCALS
Elephantulus edwardii V113 trav AMGZ01058520.1 4783 DARAQSVTQPDAYVSVHEGSTLELRCNYSSSITPSLYWYVQQPSQGLQLLLKYYSGETLVKGINGFEAEFKKSESSFSLRKHSASWSDSAEYFCAVS
Elephantulus edwardii V114 trav AMGZ01058521.1 12936 MCHGEKVEQHPSTLTILEGSSSIINCTYSDSSTSYFAWYKQEAGKGPQFIIAIRSTVNKNEGQELIVLLNKTAKHVSLNIPAAQPGDSAVYFCAAS
Elephantulus edwardii V115 trav AMGZ01058521.1 20762 FSISQKVTQDQQVMRAQEKETVTLPCTYDTNERNFGLFWYKQPSNGQMIFLIRQESYNQQNATEGRYSLNFQKEAKSINLVVSALRLEDSAVYLCALRE
Elephantulus edwardii V116 trav AMGZ01058521.1 31819 GVRGMKVEQSPSAVNLQEGTSSTLRCNYSEAVNNVQWFRQSPGRGLISLIFIASGMKQKGKLSFTINSKELYSTLHITDSQLEDSATYLCAVK
Elephantulus edwardii V117 trav AMGZ01058522.1 12667 FSIAQKVNQDQPEMTVQEEKTVTLPCTYDTSDSSFGLFWYKQPSSGEMIFLIRQDSYNQQNATEGRYSLNFQKAAKSINLVISSSQLEDSAVYFCALRE
Elephantulus edwardii V118 trav AMGZ01058522.1 33618 MCQGENVEQHPSTLSVLEGSSAVINCTYSDSASSYFPWYKKEPGKDLQLIIALRSNMNKNEGQGLIVLLNKTAKHVSLHIPGAQHGDSAVYFCAAS
Elephantulus edwardii V119 trdv AMGZ01058524.1 951 FNIAQKVTQDQPAVMAQEKEAVTLHCTYDTNEVRFALLWYKQPSSGQMIFLVRQESYNEQNATESRYSLNFQKAAKSIDLVISASQLEDSAMYFCALRG
Elephantulus edwardii V120 trav AMGZ01058524.1 6381 GVRGIKVEQNPSAANLQEGASSTLRCNYSTTVNNVQWFRHNPGEGLISLIFIASGMKQNGRLYFTIHSKELYSTLHITGSRVEDSATYFCAVME
Elephantulus edwardii V121 trav AMGZ01058527.1 1132 FSLTQKVNKIQLEMMVQEEETVTLNCTYDTSDPSFALFWYKQSSSGQIIFLIRQESYQQNATDGRYSLNFQQTSKSINLAISASQLGDSAVYFCALRE
Elephantulus edwardii V122 trav AMGZ01058527.1 18015 GTSGDSVDQTEGQVTLSERTSLTMNCTYTASGYPTLYWYVQYPNEGLQLLLKAAKANEKGNGKGFEAIYNKEASSFHLTKASVRESDSAVYYCAQS
Elephantulus edwardii V124 trav AMGZ01058532.1 3236 SLSQKKAVEQSPGSLSIPEGATASLNCTYEDRASQYFMWYRQYSGKGPEFLINIYSNDIKNKGRFAAQLKKDSQYVSLLITDAQPDDSAVYLCAVS
Elephantulus edwardii V125 trav AMGZ01058534.1 14137 VSCQLMLEQSPAFLSIQERSHAILNCTVQQKSFLNFQWFWQEPGKWLLSQTVAQSSQGEKGEQAFKNDLGKEKLFSIFNIPDSQLSDSGTYFCAL
Elephantulus edwardii V126 trav AMGZ01058536.1 3766 SLSQKKAVEQSPGSLSIPEGTTGSLNCTYEDRAAQYFTWYRQYSGKGPELLMFIYSNGFKNEERFTAQHDKDKQLVSLLITNSQLGDSAVYLCAV
Elephantulus edwardii V127 trav AMGZ01058539.1 7665 GIGAQTVTQPEDRIFVPEGAPVQIKCNYSYSGSPYLFWYVQYPKERLQFLLRHTSEESVKGFTAELDKGKMSFHLKKSSAQEEDSAKYYCAIS
Elephantulus edwardii V128 trav AMGZ01058540.1 3847 VKSQVVQNPETLQVQEGENAAMNCNYTSTINNVQWYKQDSRGVLVLLILIRSNEKEKPNGRLRATLDTSIKRSSLVITASETADAVAYFCAVD
Elephantulus edwardii V129 trav AMGZ01058540.1 23584 SSMAQSVTQDQSAISVVEREAVTLNCIYKTQNTDYALLWYKQRPTREMIFLIRQEAYNEQSAMKGRYFLDFQKATKSINLTITALQLEDSAVYFCALRF
Elephantulus edwardii V130 trav AMGZ01058540.1 33218 KVQGDSVTQTEGVLILFEGASLILNCTYETTYTNLFFFWYVQYLNKAPQLLLKTVTESQKTENQGFQASLNKREKSFHLHKSHLRTSDSALYYCAMR
Elephantulus edwardii V131 trav AMGZ01058542.1 6366 SRGEDQVEQNPQTLTLREGDDISLNCSYSVSSFRGLQWYKQEPGKGLELLFLLFSIGDKQQKNRLKVTLSKKESSLHITASKPEDLATYFCAV
Elephantulus edwardii V132 trav AMGZ01058543.1 7718 GTGAQSVTQPEVHVTVTEQASLELRCNFSASFSPYLFWYVQYPNQGLQLVLKYVPGNQLVSGIKGFQAEFKNSEKSFHLRKLSAQLSDSADYFCALS
Elephantulus edwardii V133 trav AMGZ01058544.1 1103 VRGVQVEQSPPVLSLQEGDSYILRCNFSTSVRNVQWLHQNPKGRLISLFYIPSGTKQNGRLNATTVAKERLSLLHISSSQTTDSAIYFCAVEPQCFP
Elephantulus edwardii V134 trav AMGZ01058546.1 6239 DQQQVKQNPPFLIVQEGETSVLNCAYENSAFTYFPWYQQLPGKSPVFLMEIYSSTNKKEEGRFIISINKTAKHLSLHITTSQLGDSATYFCAAR
Elephantulus edwardii V135 trdv AMGZ01058549.1 2536 STGAQKVTQDQSALSMQEGETVNLECMYETSQTYYYIFWYRQLSSGKMIFLIRQDSHELSAKNGRYSIDFQKEVKSIKLIISNLQLVDSEKYFCVLW
Elephantulus edwardii V136 trdv AMGZ01058551.1 6397 PTGAQKITQDQSTISMQEGTAVNLECLYETRFTYFYIFWYKQLPSGKIVFLIYQYSPEHNAKSDRYSIDFQKEVKSIRLIISDLQLEDSGKYFCALQE
Elephantulus edwardii V137 trav AMGZ01058553.1 652 VRGVQVDQNPPVLSLQEGDSYTLRCNFSTSVSNMQWFRQSPEGHLISLFYIPSGTKQNGRLNATTVTKERLSLLHISSSQTTDSAIYLCAVEPQCFP
Elephantulus edwardii V138 trdv AMGZ01058555.1 6781 FTWAHKVIQDQSAISMQEGETVNPECLYETSWTYYYILWYKQLPNGKIKLQHSSAQNSKYDRYSINFQKEEKFIRLIISTLELQDSGKYFCVLWE
Elephantulus edwardii V139 trav AMGZ01058558.1 4068 VRGAQVEQSPPVLSLLEGESYTLRCNFSTSMYNVQWFHQNPEGRLISLFYISSGTQQKGRLNATTVTTERLSLLHISSSQTTDSGIYLCAVEPQCFP
Elephantulus edwardii V140 trav AMGZ01058560.1 7400 KSSQQQVKQNPPSLIVQEGRTSALNCAYENSALNYFQWYQQYPGKGLVLLMYISSVVNKKEKGRFTIFFSKTAKHLSLYIASSQPRDSATYFCAAS
Elephantulus edwardii V141 trdv AMGZ01058560.1 11103 TTVAQKVTQKKSAISKQEGEDVNLQCLYETSWTYYSLFWYKQLFSGKMILLISQYSSSQNAKSGRYSINLEKEIKSIKLIISNLELEDSGKYFCALSE
Elephantulus edwardii V142 trav AMGZ01058560.1 32443 VRGVQVEQSPPVLILQEGGSYTLRCNFSTSVNNLQWFLQNPEGQLISLFYIPSGTKQNGRLNATTLISERLSLLHISSSQTTDSGIYLCAASHSASP
Elephantulus edwardii V143 trav AMGZ01058562.1 6410 VSSKVNVEQNPQSLLILEEDSTNFTCSFPSNSFYALHWYLWEPSKSPKVLFVLLSNSDERKGRLRVIFDSKKGYSYLHITGSRPEDSATYLCAF
Elephantulus edwardii V144 trav AMGZ01058562.1 10212 DQQVKQNPSSLKIQEGEVSILNCDYNNNLFDYFFWYKKHPTKGPALIISINSIRNTNEDGRFTVFFNKSNKHLSLHIASSQPGDSATYFCAAS
Elephantulus edwardii V145 trav AMGZ01058567.1 110 TTGQQVKQIPQSLLLQEGGNVTIYCNSSSTLNNLQWYKKKPGGSPVFLMMLVTAGEEKKQKRLTAQFGQTRKDSSLHITTVQAAGVGTYFCA
Elephantulus edwardii V146 trav AMGZ01058570.1 8927 ETRAQSVTQPDGHVSVSEGALVELKCNYSTSGATYLYWYVQYPNKGLQLLLKYITGEPLVKGIKGFEAEFKKSETSFHLRKVSAQWSDSAVYFCALS
Elephantulus edwardii V147 trav AMGZ01058572.1 2918 EKTQQLEQRPQFVSIQKGENFTTYCNFTSIFPAFQWYRQKPGEGPVLLMVLTKGSEVKRQKRLTARFGEARMDSSLHITAAQPEDMGLYLCAG
Elephantulus edwardii V148 trav AMGZ01058574.1 26 LSVEMKVEQSPQILTLPEGRNASLTCNFSISITRMQWFQQNPRGQLMSLFYAASGTQQKGRLTCTVNTRERYSHLYIQDSKPEDLATYFCAVEAQCS
Elephantulus edwardii V149 trav AMGZ01058574.1 6823 DQQVKQNPPILKIQEGDMSILSCDYNNNLFDYFLWYKQYPTKGPTLLITVRSFTGNDEEGRFTVFLNKTAKHLSLHIASSQPGDSATYFCAAS
Elephantulus edwardii V151 trav AMGZ01058575.1 4250 ITSDAKATQPNSMDSIEGKTVNLPCNHSTISGNEYIYWYRQILHRGPEYVIHGLNGNVTNQMAFLIIPTGRKSSTLILPHVTVRDTAMYYCIVR
Elephantulus edwardii V152 trav AMGZ01058577.1 11290 VSGQQLNQNPQSMSLQEGEDSIINCNSSSTFNSFLWYKQDAGEGLVLLITLYKSGEVTRKEKLTAQFGETRKDSLLHISASAPDDTGTYFCAG
Elephantulus edwardii V153 trav AMGZ01058577.1 20016 PRRAAWVRPQETEVYGTEGESVALLCHYGGSTARVIDLYWYRQYPTQAPEYILYRSWGSSAKGYATFAGERFYSEITSSTTTMHISNLFPADTATYYCAMRE
Elephantulus edwardii V154 trav AMGZ01058578.1 3773 VSSNKVIQSPQSLLVQEGNSVTLSCSYEVTYFKDLRWYKQKDNARTLLFRLFSNTIEKSGRLSSTLDKNERRSILQVSASQPEDSATYLCAVQ
Elephantulus edwardii V155 trav AMGZ01058581.1 388 SRRAAWMRPQDTEASGTEGKSVTFLCHYGGLTGIIDLFWYRQYPNQAPEYILFRTRGSSGKGYANFARERFSSEITSNTTNLAITNLVPADTATYYCAMSR
Elephantulus edwardii V156 trav AMGZ01058582.1 14219 PRRAAWMEPMEKELITTEGVDLTLFCRYGDITGIYDLYWYRHYPNKAPEFILYRRWGSSGNGYASFARGKFSLEITQSTSDLHIKNVIPEDSATYFCAVSE
Elephantulus edwardii V158 trav AMGZ01058584.1 4574 PMGAVWMRSQEMKVSESEGNSVNLLCHYGDISGQIVLYWYRQYPTQAPEYILYKVLGSSVKGNANFARERFSSEITSSTTKLQITNLVPADTATYHCAVR
Elephantulus edwardii V159 trav AMGZ01058585.1 3958 PRRAAWMTPERRVVFGTAGKSASLFCYYGGSSARMVDLYWYRQYPKQAPEYVLYRGWGHNGKGDASFAIERFYSKSTANMTNLYIRTLVPTDTATYHCAMRE
Elephantulus edwardii V160 trdv AMGZ01058585.1 9674 FSRSQRIIQSPVEIFTQEGESVTLNCKYITDSPNYVLTWFEKNPNGEIFYLISQPSAVSKITRNGRFSLNLQRAVNTIILTISAVKPNDSGKYFCAIQ
Elephantulus edwardii V161 trav AMGZ01058587.1 4912 FSISQTVTQSQREMPVQEAEMVTLSCTYDTSESNYYLFWYKQLPSGQMIFIIRQEAFKQQNTTENRFSVDFQKASKSISLRISDVQLGDAAMYFCAFSG
Elephantulus edwardii V162 trav AMGZ01058589.1 4698 STMAQTVTQSQREMSVQEAKMVTLSCTYDTSDANYDLFWYKQPPSGEIIFIIRQGSYNVGNARENRFSVDFQKASKSISLRISDAQLGDAAVYFCAFSV
Elephantulus edwardii V163 trav AMGZ01058606.1 3338 GSGRTEITQPSNMAATIGTDATLECQYNVPDGNYDSVYWYLQRANQRLTYVYHTFQGVVESDRYQLSVNRKLSATNLTIKHVQPKDKATYYCAVR
Elephantulus edwardii V164 trdv AMGZ01058606.1 13063 VSLDITLETDDKTLSVLAGESVTFRCSLTGGDLKNYQVSWYKKNEDNSLVLVYKSSNSSNDDFKSHFKGKIFALKGQFVLEIKKATAKDVGTYYCGTD
Elephantulus edwardii V165 trdv AMGZ01058609.1 8353 ALSAAVLVPLTEIMTVSVGESTTLTCTMGGDKITNYYISWYRQTQGNILTYIYREGSTYGPGFQDRFRVKIVAPRNQVLLEIQKVSVSDKGSYYCAGD
Elephantulus edwardii V233 trbv AMGZ01099402.1 2992 STDTGVFQMPRSLVTGVGNRKILKCEQRLGHEVMYWYKQAPGKAPELMFYFNNQELIGNESIPSRFSPKCPDSSHLELHVDALQPGDSAVYLCASSK
Elephantulus edwardii V234 trbv AMGZ01099403.1 10768 HTGAGVIQTPRHMVTMSGQAVVFRCDPISGHATLYWYRQAPGQGLEFLMYFQNKEAADTSGMPKARFSAERPEGATSTLSIQPAEPGDSAVYLCASSL
Elephantulus edwardii V235 trbv AMGZ01099403.1 30578 HMDASVTQTPRHKITKTGRKVTLQCTQDMSHNYMYWYQQNPGLGLQLLHYSVGAGILEKGDLPDGYNVSRPKTEHFSLTLASAVPSQTAVYFCASSI
Elephantulus edwardii V236 trbv AMGZ01099405.1 2319 HTDAGVTQTPRHKVAEIGRPVSLHCKPISGHNALFWYRQTSGQGLELLSVFQNQAVIEQTESLKDRFSAEMPNATSSTLKIKSAEPGDTAVYLCASSL
Elephantulus edwardii V237 trbv AMGZ01099405.1 9376 PMVAVVTQNPKYQVARVGKLVSLSCSQNLGHDAMYWYQQKPGQALKLLFYYYDTTFNNGTDTSDNFQPSRPNTSSCGLSIRSPAVGDSAVYLCASSR
Elephantulus edwardii V238 trbv AMGZ01099405.1 16549 SGLGASVSQHPSRAICRNGASVKIQCHAEGVQATTMLWYRQPPTQGFTLIATSNQGADATYEQGFSKAKFPISHPNLSFSALTVTSAQAEDSSLYFCGAS
Elephantulus edwardii V239 trbv AMGZ01099405.1 28145 SVDTEVTQTPGQLVRGTKQKARMECVPIKGHNYVHWYRLKLGEELKFLIYFQNKDIIDASGMSDKRFSAQCPPDLPCSMEIEPTELEDSAVYFCASSE
Elephantulus edwardii V240 trbv AMGZ01099405.1 34425 SVDTEVTQTPGQLVRGTKQKARMECVPIKGHNRVYWYRQKPGEDLTFMIYFVNEEATDESGMPSERFSAQCPKNSRCSMKIEPTELQDSAVYFCASSE
Elephantulus edwardii V241 trbv AMGZ01099406.1 12462 SVDTEVTQTPGQLVRGTKQKARMECVPIKGHSYVYWYHQKLGEELKFMIYFVNEEASDKSGMPSERFSAQCLKNSRCSMEIEPTELEDSAVYFCASSE
Elephantulus edwardii V242 trbv AMGZ01099408.1 5950 SVDTEVTQSPGQLVRGTKQKARMECVPIKGHSYVYWYRQKLGEELKFFIYFQNQDIIDKSEMPSERFSAQCPKNSPCSMEIEPTELEDSAVYFCASSQ
Elephantulus edwardii V243 trbv AMGZ01099410.1 375 SVDTEVTQIPGQLVRGTKQKARMECVPIKDHYRVYWYRQKPGEDLKFMISFQDEEGSDKSGMPSERFSAKCPTNSPCSMEIKPTELEDSAVYFCASSE
Elephantulus edwardii V244 trbv AMGZ01099410.1 4635 SVDTEVTQTPGQLVRGTKQKARMECVPIKGHSYVYWYRQKLGEELKFMIYFVNEEASDKSGMPTERFSAQCPKNSPCSMEIEPTELEDSAVYFCASSQ
Elephantulus edwardii V245 trbv AMGZ01099411.1 1800 CTGTGITQTPRNRIAQTGKSVTLECSQTKNHEYMYWYQQDPRLGLRLIYYSLGINDINKGEASEGYDVSRKEKAKFSLSLKSVTPNHTALYLCATSE
Elephantulus edwardii V247 trbv AMGZ01099412.1 6384 LTGAQVTQSPRYLLTGPGRKVLLTCVQHLQHDRMFWYRRDPALGLRLIHYSYGAGSTEKGDVPDGYNVSRETVESFPLTLESTSPSQSSVYLCASSK
Elephantulus edwardii V248 trbv AMGZ01099415.1 9171 SVDAGVIQTPRYYIASRGEMLTVVCEQDLGHDEMYWYRQDPGGSLRLLHYSINVDFVEKGELGSGYQVSRKEKKSFPLTLESAVPNQTALYLCASS
Elephantulus edwardii V249 trbv AMGZ01099415.1 10135 LTGAQVTQSPRYLLTGPGRKVLLTCVQHLQHDRMFWYRRDPALGLRLIHYSYGAGSTEKGDVPDGYNVSRKTVESFPLTLESTSPSQSSVYLCASSK
Elephantulus edwardii V250 trbv AMGZ01099415.1 14319 SVSSVLISQKPSRNICQQGTSVTIQCQVDTQVSFMLWYLQLPGQSLALIATANQGSEATYESGFTKDKFPISQSNLTFSTLTVRAGSPEDSGVYFCSA
Elephantulus edwardii V251 trbv AMGZ01099417.1 331 SVSSVLISQKPSRNICQQGTSVTIQCQVDTQVSLILWYLQLPGQSLALIATANQGSEATYESGFTKDKFLISQPNLTFSTLTVRAGSPEDNGVYFCSA
Elephantulus edwardii V252 trbv AMGZ01099417.1 3988 HVNAEVTQFPRHRIATRGETLTVACTQDLNHDAMYWYRQDPGEGLRLLHYSVNVDIVDKGELPDGYLVSRKEKKSFPLTLESAVPSQTALYLCASS
Elephantulus edwardii V253 trbv AMGZ01099417.1 6425 SVSSVLVSQKPSRDICQQGTSVTIQCQVDTQVSLMLWYLQLLGQSLTLIATANQGSEATYESGFTKDKFPISRPNFTFSTLTVREGSPEDSGVYFCSA
Elephantulus edwardii V259 trgv AMGZ01104298.1 3837 HLKDSMLEMKKMSVTKQIGTSIIITCDVLDQSIKHIHWYKHQEQKAPQHLLYYEFATSKIVLDPGISAGKYNVYKDSTINFFVLRSLEESDSGVYYCAAWI
Elephantulus edwardii V260 trgv AMGZ01104299.1 1255 HLKASHLEMKMMSVTRQIGTSITISCDILDQSINYIHWYQHQEGRAPKRLLYYEFSTSKMVLDSGISSGKYDVYKSSRRSFFVLRYLEESDSGVYYCATWI
Elephantulus edwardii V261 trgv AMGZ01104302.1 774 HLKDSKLEMKRMSVTSQIGTSTTIICDIEDQNIDYIHWYQHQEGKAPHHLLYYELSTSKVVLDPEVSSGKYYAYKHSRRIFFVLRSLKQSDSGVYYCATWI
Elephantulus edwardii V262 trgv AMGZ01104302.1 11923 HLKDSKLKMRMMSVTKQIGTSVVISCEVLDQSINYIHWYQHQEEENPKRLLYYEFSTFKVELDPGISPAKYHAYEGSKRSCKFVVRSLEESDSGIYYCATWI
Elephantulus edwardii V263 trgv AMGZ01104303.1 3063 DQSVMLEQQPSVVGHKGSSTTLECLVHTSVSYIHWYRHQEGKGLERFIYLAMFKSDVHWDSVLTSDKITAMEAKDGKSCTLSVLKLEKGDEGVYYCAAWI
Elephantulus edwardii V264 trgv AMGZ01104305.1 15049 GLGLLQVEQSQISISAVVKQSVDIYCSISSTNFENEVVHWYRMKLNQALEHLIHITSPKTPNRKRFGKKDNKFEARKDFQSSTSIFTINFIEEDMATYYCAGW
Elephantulus edwardii V265 trgv AMGZ01104306.1 12835 ALGQVKLEQPELSISKSTSQSAYITCKALNFDFANTGVHWYQQKPNQTLHLIYVTLTQKSVLTSLGGKKNKLLASVNDQGSISDLTINFVEKEDEAVYYCAVW
Elephantulus edwardii V266 trgv AMGZ01104307.1 2052 ALGQLKLEQSDISVSTVASKSAVIICKMSNFEFTKRFVHWYWQKPNQTLEHLIYISKDQKESVHNVGGKKNKLIATKTVETSTSHLTINFIEKEDEAIYYCAAWD
Elephantulus edwardii V267 trgv AMGZ01104312.1 1718 VLGLSKLDQPEFSVSKSTSRSAYITCKALHFNFANVGVHWYQQKPNQILEHLIYVASREKSVLASLGGKKNKLLASINEHGSISHLIIKFIEKEDEAVYYCAVWA
Elephantulus edwardii V268 trgv AMGZ01104316.1 1582 GDSKMRVSQDQLSFTRKPERTVHISCRLSGIPLTNVIVHWYQQKEGEPLKRILYGSPKSYKQTKPDPRLEIEGKENGVFYLIINKVTKDDEATYYCACWD
Elephantulus edwardii V459 iglv AMGZ01217065.1 996 AASQAVVTQEHSLSTSVGETITLTCGSSTGAVTTSNYATWVQQMPYEVPRALISSTSNRIPGVPSRFSGSLLGGKAALTITAAQAEDEAKYYCAMWFSNH
Elephantulus edwardii V460 iglv AMGZ01217077.1 386 SLAQPVLTQPSAMSGSVGQTVTISCTGSSSNVGRGYPYWFQQFPGSVPRLLIYDADKRPSGIQDRFSGSRSGNTAFLSISGLQSEDEGNYYCFAWDNSNNA
Elephantulus edwardii V461 iglv AMGZ01217084.1 2094 SWAQSVLTQPPLVSGNLGERVTLSCTGSSTNIGGYYAHWYQQLQGTSPKLLIYNNNQRPSGIPDRFSGSNSGNSASLTITGLQAEDEAIYYCHSYDSSQS
Elephantulus edwardii V462 iglv AMGZ01217085.1 2797 SWTQSVLTQPPLVSGNLGQQVTISCTGSSTNLGSYYAGWYQQLPGQAPRALVYGNNNRPSGIPDRFSGSYSGNSASLTISGLQGEDEAHYYCGSDDTSLEF
Elephantulus edwardii V463 iglv AMGZ01217099.1 12681 SWAQSVLTQPPSMSGNVGQQLTISCTGSSTNIGGSAVRWYQQLPGAAIKCLIYDNNKRPSGVSDRFSGSKSGNSGSLTITGLQVEDEADYYCQSHDSSLN
Elephantulus edwardii V464 iglv AMGZ01217101.1 12718 SWAQSVLTQPPSMSGNLGERVTLSCAGSSTNIGGRYANWYQQLPGTFPKPLIYDNNKRPSGIPDRFSGSKSGNSASLTITGLQAEDEAHYFCQSYDDSLGD
Elephantulus edwardii V465 iglv AMGZ01217105.1 9801 SLAQSVLTQPSAVSKSVGETVTISCTGSSTNVGRGYPDWLQQLSGSVPRTLIYDADKRPSGIPERFSGSRSGNTAYLSISGLQSEDEAYYYCAAWDNNIN
Elephantulus edwardii V466 iglv AMGZ01217107.1 1147 SWAQSVLTQPSSMSGNLRESVTLSCTGSSSNIGSYYPSWYQQIPGTSPKLLIYGNNNRPSGIPDRFSGSKSGNSASLTITGLQADDEANYYCYSIDNSMRA
Elephantulus edwardii V467 iglv AMGZ01217109.1 26277 SLAQSVLTQPSAMSRSVGETVTISCTGSSTNVGRGYPEWFQQLSGSAPRALIYHGDKRPSGIPDRFSGSRSGNTASLSITRLQSEDEAYYYCSAWDNNINA
Elephantulus edwardii V469 iglv AMGZ01217117.1 11401 SLAQSVLTQPSAMSKSVGETVTISCTGSSNNVGRGYPSWYQQLSDSTPRMLIYNADKRPSGVPDRFSGSRSGNTASLSISGLQSEDEAYYYCAAWDNNIN
Elephantulus edwardii V470 iglv AMGZ01217120.1 3141 SWAQSVLTQPTSMSGNLRERVTLSCSGSSSNIGSNYVSWYQQLPGTSPKLLIYDNSNRPSGIPDRFSGSKSGNSASLTITELQADDEANYFCHSYDDSLS
Elephantulus edwardii V471 iglv AMGZ01217122.1 411 SLAQSVPTQPPAMSKSVGETVTISCTASSNNVGRGYPHWYQQLSGSAPRTLIYDADKRPSGIPDRFSGSRSGNTASLSISGLQSEDEAYYYCSSWDNNIKA
Elephantulus edwardii V472 iglv AMGZ01217138.1 6758 SWAQSVLTQPPSMSGNLGEQVTISCTGSSTNIGSYGANWYQQLPGTSPKQIIYGTSNRPSGIPERFSGSKSGNSASLTITGLQEEDEAQYYCASYDSSSL
Elephantulus edwardii V473 iglv AMGZ01217143.1 3385 SLVQSVLTQTSAMSGSVGQTISISCTGSSSNVGLGYPSWYQQLSGSTPRMLIYYADQRPSGIPDRFSGSRSGNTASLSISGLQAEDEANYYCSAWDNNISA
Elephantulus edwardii V474 iglv AMGZ01217157.1 4787 SWAQSVLTQPPSVSRNMGQQVTISCTGSSTNFGSYSAGWYQQLSSQPPKLLIYANNQRPSGIPDRFSGSKSGNSASLTITGLQAEDEAHYFCQSYDSSLS
Elephantulus edwardii V475 iglv AMGZ01217162.1 1046 CLSQPVLTQSPSVSASLGASAKLTCTLSSEHSTYRIEWYQQNPGKSPCFVMSLGSSGMTGSRGDGIPDRFSGSSSGADRYLTLSNIQTNDEADYICGV
Elephantulus edwardii V481 igkv AMGZ01225453.1 42814 YRGQIILTQTPETLVVPQNSFLSITCRSSSDVGTSMAWYHQKSTKAPRLLVFGASARAAGTPVRVQGSGSGHYFFIAIHEVKAEDAGVYYCQ
Elephantulus edwardii V482 igkv AMGZ01225462.1 3882 TSGTIVLIQSPALLSVSLRESVSITCTAQKDVSDYLSWYQKKPGWAPRMLIYDADNRYPGVSDRFSGTQSGKEFILTISNIQAEDTGDYYCQQDYEVP
Elephantulus edwardii V512 ighv AMGZ01247076.1 1508 VLSQVTLKESGPGLLKPNEVLSLTCTISGFSLSTTDTAVAWLRHPQGKAPEWLSHIYWDDDKRYAPSLKSRLTISRDTSKNQVFLTMTNMSPTDTAMYYCV
Elephantulus edwardii V513 ighv AMGZ01247076.1 9136 VLSQVTLKESGPGLLKPNEVLSLTCTVSGFSLSTCSIGVAWLRQLQGKAPEWLSDIWWDDNKYYAPSLKSWLTISRDTSKSKVFLTMTNMSPTDTAMYYCARQ
Elephantulus edwardii V514 ighv AMGZ01247088.1 1992 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFDDYYMYWVRQAPGKGLQWVSAISYSGGSTYYAESVKGRFTISRDNAKNMVYLQMNSLRREDTATYYCAR
Elephantulus edwardii V515 ighv AMGZ01247096.1 18027 FQCEVQLVESGGDLRQPGGSLKLSCATSGFTFSSYAMNWVRQAPGKELEWVSHINIFSGISYADSVKGRFTISRDNAKNMVYLQMNSLKTEDTAIYYCTA
Elephantulus edwardii V516 ighv AMGZ01247102.1 4729 VQCEVQLVESGGDLRQPGGSLKLFCAASGFTFSNAWMSWVRQAPGKGLEWVSSINTGSGTNYADSVKGRFTISRDNAKNMLYLQMNSLKTEDTAIYYCAS
Elephantulus edwardii V517 ighv AMGZ01247111.1 2769 VQCEVQLVESGGDLKQPGGSLKLSCAASGFTFSSYAMSWVRQAPGKGLQWVSAISDKSSNTYYADSVKGRFTISRDNNKNMLYLQMNSLRTEDTAMYYCAK
Elephantulus edwardii V518 ighv AMGZ01247114.1 2473 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFSSAWMNWVRQAPGKGLEWVSLIKSDGGTSYTDSVKGRFTISRDNAKNMVYLQMNSLKTEDTAIYYCTA
Elephantulus edwardii V519 ighv AMGZ01247122.1 3138 VQCEVQLVESGGDLKQPGGSLKISCVASGFTFSSYWMSWVRQAPGKGLEWVSRISTGGSNTYYAESVKGRFTISRDDDAKNLLYLQMNSLKTEDTAMYYCTT
Elephantulus edwardii V520 ighv AMGZ01247135.1 1920 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFSNYWMHWVRQAPGKGLQWISRITKDGSSTYYAESVKGRFTISRDNTKNMVYLQMNSLRTEDTAIYYCA
Elephantulus edwardii V521 ighv AMGZ01247136.1 1540 VQCEVQLVASGGDLRQPGGSLKLSCAASGFTFSDYWMHWVHQAPVKGLQWVSRNNKDGSSTRYADSVKGRFNISRDNAKNMVYLQMSSLRTEDTAMYYCAR
Elephantulus edwardii V522 ighv AMGZ01247143.1 13818 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFSNYWMHWVRQAPGKGLQWVSHINKDGGSTYYAESVKGRFTISRDNSKNMVYLQMNSLRTEDTAIYYCAR
Elephantulus edwardii V523 ighv AMGZ01247143.1 21473 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFSSYYMHWVRQAPGKGLQWLSVISPSGSTIYYADSVKGRFTISRDNTKNMLYLQMNNLRTEDTAMYYCTK
Elephantulus edwardii V524 ighv AMGZ01247144.1 46 VQCEVQLVESGGDLRQPGGSLKLSCVASGFTFSSYSMSWVRQAPGKGLQWVSRITSSGGSTYYTESVKGRFTISRDNAKNMVYLQMDSLRTEDTAMYYCAR
Elephantulus edwardii V525 ighv AMGZ01247152.1 1744 VQCEVQLVESGGDLRQPGGSLKLSCAASGFTFSNFPMSWVHQAPEKGLQWVSRITSSGGSTYYADSMKGRFTISRDNAKNMLYLQMDSLRTEDTAMYYCAR
Elephantulus edwardii V526 ighv AMGZ01247157.1 4220 VQCEVKLLESGGDLRQPGGSLKLSCAASGFTFSNYGMHWVRQAPGKGLQWVSIIYYDGSNKYYADSVKGRFTISRDNTKNMLYLQMNNLRTEDTAIYYCAK
Elephantulus edwardii V527 ighv AMGZ01247158.1 12474 VQCEVQLVESGGNLRQPGGSLKRSCAAFSSYGMHWVRQAPGKGLQWVSAINRNGANTYYADSVKGRFTISRDNAKNMLYLQMNSLRTEDTAMYYCAG
Elephantulus edwardii V528 ighv AMGZ01247162.1 249 VLSDLTLQESGPGLVRPSETLSLTCTVSGYSIASGYCWHWIRQPPGKGLQWLSRICYNGNTYYDPSLKSRLTTTRDTSSNKFFLQLRSVTNEDTSMYFCAR
Elephantulus edwardii V529 ighv AMGZ01247179.1 4976 VLCQVQLQESSPQVVSPSQTLTLTCTITGDSLTSSTVTWDWIRQQPGKGLEWMGRIYYRSKWYKDYAPSIKNRLSLNPDTAKNQFSMEVSSMTTADTAMYYCAR
Elephantulus edwardii V551 iglv AMGZ01268633.1 4864 PAASYELTQAPSASVRLGETVHITCGGNNIEKKSVHWYQQRPEEAPTTVIYNDNQRPSGIPDRFSGANSGNTATLTISSTQTGDEGDYYCHVWDSGA
Elephantulus edwardii V552 iglv AMGZ01268635.1 1868 PAASYELTQAPSASVRLGETVHITCGGNNIEKKSVHWYQQRPEEAPTMVIYNDNQRPSGIPDRFSGANSGNTATLTISSTQADDEGDYYCQVWDSSA
Elephantulus edwardii V553 iglv AMGZ01268641.1 10043 PAASYELTQAPSASVGLGETARITCGGDNIGSKYTHWYQQKPGQSPTLVIYSDKNRPSGIPDRFSGANSGNTATLTISSTQAEDEADYYCQVYGSNA
Elephantulus edwardii V631 ighv AMGZ01043474.1 421 VQCEVQLVESGGDLRQPGGSLKLTCAASGFALSSYHINWFCQAPGKGLQWVSHITADGNTYYAGSVKGRFTISRDNAKNLLYLQMNSLRTEDTAMYYCAR
Elephantulus edwardii V632 ighv AMGZ01043476.1 4985 HLERVWSWLLKPIEVLSLTCTISGFSLSTSNTAVAWLRQPQGKAPEWLSHIYWDDDKRYAPSLKSRLTVSRDTPKSQVFLTMTNMSPTDTAMYYCARR
Elephantulus edwardii V633 ighv AMGZ01043479.1 12573 VLSQVTLKESGPGLLKPNEVLSLTCTISGFSLSTTDIGVGWLRQPQGKAPEWLSHIWWDDDKRYAPSLKNRLTISRDTSKSQVFLTMTNMSPIDTAMYYCARVQ
Elephantulus edwardii V635 ighv AMGZ01043515.1 2310 VRCEVQLVESGGDLRQPEGSLRLSCVASGFTFSSNHMNWVRQAPGKGLQWVSRISADGSTYYADSVKGRFTISKDNSKNMIYLQMNNLRTEDTAMYYCA
Elephantulus edwardii V636 ighv AMGZ01043517.1 4098 AQCEVQLVETGGDLRHPGGSLTLSCAASGFSVSSYDMDWIREAPGKGLQWVSGITPGGSTYYADSVKGRFTISRDNAKNMLYLQMNNLRTEDTAIYYCVK
Elephantulus edwardii V637 ighv AMGZ01043534.1 1119 VRCEVQLVESGGDLRQPGGSLRLSCKGSGFTFSGYYMHWLRQFPAKRLEWVGFIRNKANGQTTEYAASVKGRFTITRDDSKSTTYLQMSSLKPEDAALYYCAR
Elephantulus edwardii V638 ighv AMGZ01043538.1 1665 VLSQIQLQESGPGLVKPSEALSVTCKVSGFSLSSYGAGWVRQAPGKGLEWFSIVWGGGSTNYNPTLPSRVSITKDNSKSEVYLKLSSLTDKDTATYYCA
Elephantulus edwardii V639 ighv AMGZ01043544.1 24073 VHSEIQLVQSGPELSKPGTSVKISCKASGYTFTSYELHWVQQTPGRRLEWIGYINPSNGGTGYAQKFQGRVTMTRDTSTSTGYMELRNLSPDDTATYYCAR
Elephantulus edwardii V640 ighv AMGZ01043544.1 5673 VHSEIQLVQSGPELSKPGTSVKISCKASGYTFTSYELHWVQQTPGRRLEWIGYINPSNGGTGYAQKFQGRVTMTRDTSTSTGYMELRNLSPDDTAIYYCAR
Elephantulus edwardii V641 ighv AMGZ01043546.1 5245 VHSQVQLVQSGPEMSKPGASVKISCKTSGYTFTYYALHWVQKTPGKRLEWIGYVYPSDGGTSYAQKFQGRVTMTRDTSTSTGYMELRNLSPDDTATYFCTV
Elephantulus edwardii V642 ighv AMGZ01043548.1 5480 VHSQVQLVQSGPEMSKPGASVKISCKASGYTFTSYYLHWVQQTPGRRLEWIGYIYPGNGATNFAQKFQGRVTMTTDTSTSTGYMELRNLSPDDTALYFCAS
Elephantulus edwardii V643 ighv AMGZ01043553.1 1784 VQSQVQLVQSGPEMSKPGASVKISCKASGYTFTSYGLHWVQQNPGQRVEWIGYINPGNGATSYAQKFQGRVSMTRDTSISTGYMELRNLSPEDTATYFCTV
Elephantulus edwardii V644 ighv AMGZ01043554.1 21743 VHSEVQLVQSGPEISKPGTSVKISCKASGYTFTSYELHWVQKSPGQRLEWIGYINPSNGGTGYAQKFQGRVTMTTDTSTSTGYMELRNLSPDDMATYYCAR
Elephantulus edwardii V645 ighv AMGZ01043559.1 28505 VHSEVQLVQSGPEVSKTGASVKISCKASGYTFTSYNLHWVQQTPGQRLEWIGYIYPGNGGTSYAPKFQGRVTVTRDTSTNTGYMELRNLSPDDTATYFCAK
Elephantulus edwardii V646 ighv AMGZ01043559.1 9836 VHSEVQLVQSGPELSKPGASVKISCKASGYTFTNHGLNWVQQTPGQRLEWIGFINTNTGGTDYAQKFQGRVTMTRDTTTSTGYMELRNLSPDDTATYYCAR
Elephantulus edwardii V648 ighv AMGZ01043566.1 37619 ILSQEQLKESGPGLLKPSEVLFLTCTASGFSLTNYHVHWVRQAPGKGLEWVGVITYTGGTKYNPTLTSQVSITRDTSKSQVYLKLNSLSAEDTATYYCAR
Elephantulus edwardii V666 trdv AMGZ01058612.1 17357 ETMLCVKITQNSEDQIVELSSEVTLLCTYQVEYLNPDLYWYRRRPDQSFQFILYRDDTRSKDADFTQGRFSVKRSQKEKTFHLVISSVKVEDIAIYYCASA
Elephantulus edwardii V733 trbv AMGZ01099419.1 7753 VSAQTVHQWPVVVVRRVGSPLTLRCTVTGTSNPNLYWYRRATDGPLQLLFVSISVDDLQAEGPGHLSASRPRDGELTLSAESLQPGDSGTYLCAWG
Elephantulus edwardii V807 iglv AMGZ01136050.1 3902 CGSQPVLHQPPRVSASLGTSVSLACTLSGDYNVGLYKIYWYQQRPGQSPRFLLSFFSSTKKKQGPKVPLRFSSFKDVARNTGYLRITSLQEEDEAVYYCAVG
Elephantulus edwardii V959 igkv AMGZ01225475.1 966 ASGDIVMTQTPASMAVSPGQRVTINCKSSQSVNNYLNWYQQKSGQAPKMLIYAASNRASGVPDRFSGSGSGTDYTLTISSLQAEDVGDYFCLQSYNTP
Elephantulus edwardii V960 igkv AMGZ01225486.1 1538 ASGDIVMTQSPAFTAASPEESVTISCKSSQSISNELSWYQQKSSQAPKLLIYSANTRASGVPDRFSGSGYGTDFTLTISSLQNEDVADYYCMQDYSIP