WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cavia porcellus AAKN00000000.2 (AAKN02) 380 93 47 113 68 36 11 12
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cavia porcellus V79 iglv AAKN02007375.1 31709 YGTQPVLYQPPSASSLLGTAVRLTCTLRSDHNIGFYSIFWYQQRPGQPPRFLLRYFSYLDKHQGPKVPPRFSGSKDVSRNQGYLSISELQPEDEAIYYCAVG
Cavia porcellus V157 trbv AAKN02015427.1 133657 ARAQIIHQWPATKVQPVGSPLSLECTVEGTSSPTLYWYWQVAGGPLQLLFYSISLGDVTSEGSQNFLASRPQDGQFILNSKKLLLSDSGLYLCAWS
Cavia porcellus V202 trdv AAKN02019137.1 38486 KDTVCNTLTQRPLDQMVESGSETTLFCTYSTEISDPDLYWYRKMADQSLQFILYRDNTRSLDADFVQGRFFVKHSQTHKTFHLVISPVRMEDQATYYCALS
Cavia porcellus V299 igkv AAKN02027961.1 13210 GKCDIQLTQSPSVSASLGERVTITCQASQDISTILHWYQQKHGKTPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSVEPEDVATYYCQHNYGIP
Cavia porcellus V300 igkv AAKN02027962.1 4400 TIGQTQLTQTPESLAVSLGETVTLSCRASQGVSNYLEWYQQKPGQASRLLIYTASSRATGVPARFSGSGSGTDFTLTISSLQPEDIAVYHCFQYYSGS
Cavia porcellus V301 igkv AAKN02027962.1 10341 VRCDIQMTQTASSLPASVGDTVNIKCKASQGIINALNWYQQKPGKYPQLLIYDATSLGSGVPLSFSGSVFGTDFTLAISSLQPEDVATYYCQHVYGTP
Cavia porcellus V302 igkv AAKN02027962.1 16093 ARCDIQLTQPASASASVGDTVKISCQASQSVSSYLSWYQQKPGQAPKLLIYYANRLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYDSSP
Cavia porcellus V303 igkv AAKN02027962.1 37056 VRCDIQMTQTPSSLPASVGDTVPIKCKASQGIINALNWYQQKPGKAPQLLIYAETSLGSGVPSRFSGSGFGTNFTLAISSLQPEDVATYYCQHGYGTP
Cavia porcellus V304 igkv AAKN02027962.1 42813 ARCDIQLTQPASASASVGDTVKISCRASQSVSNYLSWYQQKPGKAPQLLIYAATSLVSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQYQSWP
Cavia porcellus V305 igkv AAKN02027962.1 63319 VRCDIQMTQTPSSLPASVGDTVTIKCKASQGISNVLNWYQQKPGKAPQMLIYDATSLGSGVPSRFSGSGFGTDFTLAISSLQPEDVATYYCQHVYGTP
Cavia porcellus V306 igkv AAKN02027962.1 96743 VRCDIQMTQTPSSLPASVGDTVTIKCKASQGIINALNWYHQKPGKAPQLLIYAATSLGSGVPLRFSGSGFGTNFTLAISSLQPEDVATYYCQHGYGTP
Cavia porcellus V307 igkv AAKN02027965.1 20291 TIGQTQLTQTPESLAVSLGETVTLSCRASQGVSNYLEWYQQKPGQAPRLLIYTASSRATGVPARFSGSGSGTDFTLTMSSLQLEDIAVYHCFQDYSGC
Cavia porcellus V308 igkv AAKN02027965.1 26624 VRCDIQMTQTPSSLPASVGDTVTIKCKASQGIINALNWYQQKPGKAPQLLIYAATGLGSGVPSRFSGSGFGTDFTLAISSLQPEDVATYYCQHGYGTP
Cavia porcellus V309 igkv AAKN02027967.1 11238 ARCDIQLTQPASASASVGDTVKISCRASQSVSSSLNWYQQKPGQVPKLLIYWAISLASGVPSRFSGSGYGTDFTLTISSLQPEDFATYYCLQYDSSP
Cavia porcellus V310 igkv AAKN02027967.1 101441 TTGQTLLTETPAFLAVSLGETVTLSCRASQGVSNYLEWYQQKPGQAPRLLIYTAFSRATGVPARFSGSGSGTDFTLTISSLQPEDIAVYHCFQDYSGC
Cavia porcellus V311 igkv AAKN02027967.1 132169 VRCDIQMIQTPSSLPASVGDTVTIKCKASQGISNVLNWYQQKPGNAPQLLIYDATNLGFGVPSRFSGSGFGKDFTLAISSLQPEDVATYYCQHVYGTP
Cavia porcellus V312 igkv AAKN02027967.1 137934 ARCDIQLTQPASASASMGDTVKISCRASQSVSSSLNWYQQKPGQAPKLLIYWAIGLASGVPSRFSGSGYGTDFTLTISSLQPEDFATYYCLQYDSSP
Cavia porcellus V313 igkv AAKN02027969.1 105 TTGQTLLTQTPDSLAVSPGETVTLSCRASQGVSNYLEWYQQKPGQAPRLLIYTASSRATGVPARFSGSRSGTDFTLTISSLQPEDIAVYYCFQYYSGS
Cavia porcellus V314 igkv AAKN02027970.1 35774 ARCDIQLTQLASVSASVGDTIMISCRASQSISNYLHWYQKKPGQSPKLLIYYATNLQSGVPSRFSGSGSGADFTLTIRSLQSQHFAIYYCQHSKSVP
Cavia porcellus V315 igkv AAKN02027970.1 53380 ARCDIQLTQPASASASVGDTVKISCRASQSVSNYLSWYQQKAGKAPQLLIYAATSLAYGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQSYSSP
Cavia porcellus V316 igkv AAKN02027971.1 16863 ARCDIQLTQSASASASVGDTVKISCPTSQSVSNYLSWYQQKRGKAAQLLIYAATSLASEVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQYQSWP
Cavia porcellus V345 iglv AAKN02030462.1 2802 RIPAEVTQESSLYISPGGTVALTCASSTRAVTTSNCAAWVQQKPSEKPKGLIYATSNQNSGVPARFSGSLFGDKAAFTITGAQTEDEATYYCALWYSNH
Cavia porcellus V346 iglv AAKN02030462.1 33879 SWTQAVLTQLPSVSGAQGETVTNSCTGSNTNIGSGYGASWYQQLSGMAPKLIIYRNSNRPSGISDRYSGSKPGNSASLTINCLQLEDEADYYCQSYDTSRS
Cavia porcellus V403 igkv AAKN02036451.1 29144 TIGQTQLTQTPESLAVSLGETVTLSCRASQGVSNYLEWYQQKPGQASRLLIYIVSSRVTGVPARFSGSGSGTDFTLTISSLQPEDIAVYHCFQYYSRS
Cavia porcellus V404 igkv AAKN02036451.1 33815 VRCDIQMTQTPSSLPASVGDTVTIKCKASQGISNGLNWFQQKPGKAPQLLIYDATSLGSGVPSRFSGSGFGTDFTLAISSLQPEDVGTYYCQQGYGTP
Cavia porcellus V405 igkv AAKN02036451.1 46215 ARCDIQLTQPASASASVGDTVKISCRASQSVNSYLNWYQQKPGQAPKLLIYYANSLASGVPSRFSGSGSGTDFTLTISSLQPQDFAVYYCQQYQSWP
Cavia porcellus V406 igkv AAKN02036454.1 2075 ARCDIQLTQLASASASVGDTIMISCRASQSISNYLHWYQKKPGQSPKLLIYYATNLQSGVPSRFSGSGSGADFTLTIRSLQSQHFAIYYCQHSKSVP
Cavia porcellus V407 igkv AAKN02036456.1 11554 ARCDIQLTQPASASASVGDTVKISCRASQSVSNYLSWYQQKPGKAPQLLIYYANSLASGVPSRFSGSGSGTDFTLTISSLQPQDFATYYCLQSYSSP
Cavia porcellus V408 igkv AAKN02036456.1 32632 VRCDIQMTQTPSSLPASVGDPVTIKCKASQGISNVLNWYQQKPGKAPQLLIHDATNLGFGVPSRFSGSGFGTDFTLAISSLQPEDVATYYCQHSYGTP
Cavia porcellus V409 igkv AAKN02036456.1 38385 ARCDIQLTQPASASASVGDTVKISCRASQRVSSSLNWYQQKPGQVPKLLIYWAISLASGVPSRFSGSGYGTDFTLTISSLQPEDFATYYCLQSYSS
Cavia porcellus V411 igkv AAKN02036456.1 160158 ARYDIQLTQPASLSASVGDTVKITCQASQSISSYLNWYQQKAGQPPKLLIYYATDLQSGIPSRFSGSGSGTDFTLTISNLQPEDSATYYCQDYLSWV
Cavia porcellus V412 igkv AAKN02036457.1 30633 ARCDIQMTQSPSSISASLGEKVTISCRASEDVSKYLSWYQQKPGKAPRLLIYAATNLDTRIPSRFSGSGSGTDFTITINSLQSEDSYYCLQGLDEP
Cavia porcellus V413 igkv AAKN02036457.1 37518 ARCDIQLMQPPSASASVGDTVKISCRASQGISDDLDWYQQKGGQAPTLLIYWANRLQSGVPSRFSGSGSGTDFTLTISSLKPEDFATYYCLQSNSFP
Cavia porcellus V414 igkv AAKN02036457.1 67542 TSGSAALTQSPAFLSVTPGESVSITCRASERISDYLNWYQQKSGQSPRIIIYDADNKYPGVSDRFSGIQSGTEFIFKISGVEVGDTGTYYCQQDYEVP
Cavia porcellus V415 igkv AAKN02036457.1 104337 ARCDIQLTQPPSASASVGDTVKISCRASQSVGSYLNWYQQKPGQAPKPLIYRATNLQSGVPSRFSGSGSGTDFTLSISGLQPEDFATYYCQQHNSLP
Cavia porcellus V416 igkv AAKN02036457.1 121012 ARCDIQLTQPPSASASVGDTVKISCRASQSVGSYLNWYQQKPGQATKPLIYYATSLESGVPSRFSGSGSGTDFTLSISGLQPEDFATYYCQQHNSLP
Cavia porcellus V417 igkv AAKN02036459.1 37384 ARCDIQMTQTPSSLPASVGDTVTIKCKASESIYSALNWYQQKPGKAPQLLIYATTNLGSGVPSRFRGSGSGTDYTLTISSLQPEDVAIYYCLQYYNSP
Cavia porcellus V418 igkv AAKN02036459.1 44647 AQCDIQLTQPASASGSVGDTVKISCRASQSVNNYLNWYQQKPGQAPKLLIYYATNLQSGITSRFSGSGSGADYTLTITGLQPEDFATYFCQQGNSDP
Cavia porcellus V419 igkv AAKN02036461.1 14103 ARCDIQLTQPPSASASVGDTVKISCQASQSASSYLNWYQQKPGQAPKCLIYGATNLESGVSTRFSGSGSGTDFTLTISSLRPEDFAVYYCE
Cavia porcellus V420 igkv AAKN02036462.1 15848 VRCDIQLTQPPSTAASMGETVTISCRASQGISNELNWYQQKPGQAPKLLIYYANRLKSGVPSRFSGSGYGTDFTLTISSLQPEDFAIYYCQQDYSAP
Cavia porcellus V421 igkv AAKN02036462.1 98972 ARCDIQLTQPASLSASVGDTVKISCQASQSVSSYLNWYQQKPGQPPKLLVYYATILQSGLPSRFSGSGSGKDFTLTISNLQPEDSATYYCQRYLSWV
Cavia porcellus V422 igkv AAKN02036463.1 18802 VRCDIQLTQPPSKSASVGDTVTISCQASQGISNYLNWYQQKPGQAPKLLIYGATNLQSGIPSRFRGSGSGTDFTLSINSLQPEDYATYYCWQYDKLP
Cavia porcellus V423 igkv AAKN02036464.1 79951 TRCDIQMTQSPSSLSVSPGERVTITCRASEDIYTGLNWYQQKPGKAPKLLIYVASNLVPGVPSRFSGSGSGTDYSLTISSVEAEDIATYYCQQLKDSP
Cavia porcellus V424 igkv AAKN02036464.1 120337 ARCDIQMTQSPSCISASLDDIVTISCHVGHDIYKCLFWYQQNPGKAPKLLIYGATSLHTGAPWRFSGSGTGTDFNLTISSLQPEDIATYYCQHSYG
Cavia porcellus V425 igkv AAKN02036464.1 125009 ARSDIQLRQPPSASVSVGDTVTISCQASQGISSYLNWYQHKPRQAPKFLIYCATNLQSAVSSRFHGSGSGTDFTLTISSLLPEDFATYYCQQDSSVP
Cavia porcellus V426 igkv AAKN02036465.1 2058 SRCDIQMSQSPSSLSVSLGDRVTITCKASQNIYDGLAWYHQKPGKAPRILIYAAEDLFALVPSRFSGSGSSTDYTLAISTVEAEDVGTYYCQQYSSKP
Cavia porcellus V427 igkv AAKN02036466.1 31124 ARYDIQLTQPPSASASVGGTVKITCWVSQSVSRYLNWYQHKPGQAPKLLIYYATGLQSGIPSRFSGSESGTDYTPTITGLQSEDFATYFCQQYNSYS
Cavia porcellus V428 igkv AAKN02036466.1 40495 ARCDIRMTQTPSSLPASVGDTVTIKCKASQSIGYALSWYQQKPGKTPQLLIYDATSLGSGVPSRFRGTRSGTDYTLTISSLQPEDVATYYCLQSYGTP
Cavia porcellus V429 igkv AAKN02036466.1 47784 ARCGIQLTQPPSASASVGDTVKISCQASQSVSSYLNWYQQKPGQAPKRLIYGATNLESGVPSRFSGSGSGTGFTLTISSLQPEDFATYYCQQGNSYP
Cavia porcellus V430 igkv AAKN02036466.1 72574 ARCDIQITQTPSSLSASVGDTVTINCRASQGINNYLNWYQQKPGQPPKRLIYYATSLESGVPSRFRGSGSRTDYTLTISSLQPEDVAIYYCQQGYDTP
Cavia porcellus V431 igkv AAKN02036466.1 78142 ARCDIKLRQPASTSASVGDIVTIHCRASQGISKYLNWYQQKPGQPPKLLIYYATSLESGVPSRFSGSGSGTDFSLTISSLQPEDFASYYCQQYEKLP
Cavia porcellus V432 igkv AAKN02036466.1 91733 SSGQTLLTQTPASLAVSPGETATVNCRASQSVSKYLAWYQQKPGQAPKLLIYDASSRATGVPARFSSSGSGTDFTLTISSLQPEDVAVYHCYQYSNG
Cavia porcellus V433 igkv AAKN02036466.1 110594 ARCDIQFTQSSSASVSVGDTVTISCQASQGIVKYLNWYQKKPGQAPKLLIYAADSLESGFPVRLSGSGSGTDFTLTSSRLQPINFATYYCQQNYYN
Cavia porcellus V434 igkv AAKN02036466.1 145203 TSGSVALTQSPAFLSVTPGESVSISCRASASISDDLNWYQKKPGESPKILINDANNRYAGVSDRFIGIYSGTEFTFKISRVEAGDAGTYYCQQDY
Cavia porcellus V435 igkv AAKN02036466.1 193401 ARCDIQLTQPPSRAASVGDTVTISCRASQDISNNLHWYQQKPRQAPKPLIYAATNLQSGVPTRVSGSGSGTDFTLTISSLQPEDFATYYCQQDYSAP
Cavia porcellus V436 igkv AAKN02036467.1 37292 ARCDIQMTQTLSSLPASVGDTVTIKCKASEGIYGVLNWYQQKPGKAPQLLIYAATILGSGVPSRFSGSGSGTDYTLTINSLQSVDVATYYCQQGLYTP
Cavia porcellus V437 igkv AAKN02036467.1 43664 ARCDIQLTQPPSASASVGDTVKISCQASQSVSRYLKWYQQKPGQTPKLLIYGATYLQSGVPSRFSGSGSGTDFTLTISSLQPEDSATYYCHQYDSTP
Cavia porcellus V439 igkv AAKN02036467.1 75358 ARCDIQLTQPASTSASVGDTITISCQASQGISSYLSWYQQKPGQATKLLIYGAKNLYSGVPSRFSGSGSGTDFTLTISSLQPEDFAIYYCQQYGSSP
Cavia porcellus V440 igkv AAKN02036469.1 8122 TRCDIQMTQSQSSLSASLGDRVAITCKASHNINSYLAWYQQKQGKAPKLLIYAASNLASGVPSRFSGSGSGTDYSLTISSVEAEDIATYYCQQLSDFP
Cavia porcellus V441 igkv AAKN02036471.1 14714 ARFDIQMTQSPSSISASLGDIVTISCHVSQDIYKWLFWYQQNPGKAPKLLIYSATNLHTGVPQRFFGSGTATDFTLTISSLQPEDIATYYCQHSYG
Cavia porcellus V442 igkv AAKN02036471.1 42000 TRCDIQMTQSPSFLSASLGDRVTITCKASQNIYSNLAWYHQKPGKAPRLLIYSASNLDSGVPSRFSGSGSRTDYTFTISAVEPDDVGIYHCQQYDSYP
Cavia porcellus V443 igkv AAKN02036471.1 84440 SRCDIEMTQSPSSLSASLGDRVTIICTASQNIYSYLSWYQQKPDEPLKLLIYVASNLASGIQPRFRGSRSGTDVALTISGVEAEDVATYYCQQHYRTP
Cavia porcellus V444 igkv AAKN02036472.1 12038 GQCDIQLTQSPSVSASLGEKVTMTCKVSQGIGSSLHWYQQKPAQTPKLLINYATTLQSGIPSRFSASRSGTDFTLTISNLEPEDVASYFCHQSSSFP
Cavia porcellus V446 igkv AAKN02036472.1 65043 ATCDIQLTQTPASLSSALGDTVIITCRASENIGYSLNWYQQKPGKAPKLLIYGADSLESGVPSRFSGSGYETDFTLTISSLQPEDIATYYCQQTYSSP
Cavia porcellus V447 igkv AAKN02036473.1 4650 FIGEVVLTQTPLSLSITPGESASISCRSSQSLLDSDGDTYLYWYLQKPGQAPKLLIYEVSNRVTGVSDRFRGSGSGTDFTLQISSMQSEDTGVYYCFQG
Cavia porcellus V448 igkv AAKN02036475.1 84486 GQCDIQLTQSPSVSASLGEKVTMTCKASQGISNYLHWYQQKPGQTPKLLIRYATTLQSGIPSRFSGSGSGTDFTLAISSLQPEDVATYYCQQSSNLP
Cavia porcellus V449 igkv AAKN02036475.1 213175 SRGQIVLTQSPASMAASPGEKVTITCKASSSVGTSYLHWYQQKPGSSPKLLIYETSKLASGVPARFSGSGSGTSYSLTISNVEAEDFATYYCQQSSS
Cavia porcellus V450 igkv AAKN02036476.1 17202 GQCDILLTQPPYVSASLGEKVTITCKASQGISNNLHWYQQKPGKTTKLLIRYATTLQSGIPSRFSGSGSGTDFTLAISSLQPEDVGTYFCQHSNSW
Cavia porcellus V451 igkv AAKN02036484.1 118641 VCSDIVMTQSPASLAVSPGESATIHCKSSQSLLSSGNNKNYLVWLQQKPGQSPKQLIYLASTRETGVPDRFSGSGSGTDFTLTISRVQAEDVADYYCMQDYSAP
Cavia porcellus V452 igkv AAKN02036485.1 26636 VCSDIVMTQSPASLAVTPGESATIHCKSSQSLLYSYDNKNYLIWYQQKPGQSPKLLIYLASTRNTGVSDRFSGSGSGTDFTLTISRVQAEDVADYYCMQTYSAL
Cavia porcellus V453 igkv AAKN02036488.1 51853 VSGEIVMTQSPATLAVSPGERVTIHCKSSQSLLHSVFNENFLNWYQQKPGQSPKLLIHLASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYFCQQSISAP
Cavia porcellus V454 igkv AAKN02036488.1 100209 VCGDIVMTQSPASLAVSAGESATIRCKSNQSLLYSGNNKKFLSWYQQKQGQPPKLLIYYASTRVSGVPDSFSGSGSGMHFTLTISRMQDKDFAEYYCQQGITTP
Cavia porcellus V455 igkv AAKN02036489.1 24117 VCGDIVMTQSPGFLAVSAGESITIHCKSSQSLLHSYISENLLSWYQQKPGQSPKLLIYWASSRVSGIPDRFSGSGSGMDFTLTISNVQAEDVAYYYCQQGISAP
Cavia porcellus V456 igkv AAKN02036489.1 31851 VSGDNVVIQSPGSLLLSVGESATIHCKSSQSLFSSAYKVNYLSWYQQKPGQSPKLLIYYASTRASGVQDRFSGSGSGTDFTLTISKVQAEDAGSYYCQQNYDTL
Cavia porcellus V457 igkv AAKN02036490.1 28558 FRCDIQMTQSPSSHSASVGDVVTINCKASHNIGSYLAWYQQKPGKEPKFLIYYASRLASGIPSRFSGSGSGTDFTLTISSLQPEDVLTYFCQQHNSYP
Cavia porcellus V458 igkv AAKN02036494.1 67681 VCSDIVMTQSPASLAVTPGERATIHCKSSQSLLYSGNNKNYLDWYQQKPGQSPKLLIYLASTRETGVPDRFSGSGSGTDFTLTISPVQAEDVADYYCMQTFGTP
Cavia porcellus V459 igkv AAKN02036495.1 32627 VCGDIVMTQSPASLAVSPGESTTVHCKSSQSLLVSGINKNIFSWYQQKPGQSPKPLLYYASTWQSGVPDCFSGSGSGTDFTLTISSLQAEDVADYYCQQDTSTP
Cavia porcellus V460 igkv AAKN02036495.1 58876 VCSDIVMTQSPASLAVSPGESATIHCKSSQSLLYSGNNKNYLSWYQQKLGQTPKLLIYLASTRETGIPERFSGSGSGTDFTLTISSLQAEDVADYYCLQHYSS
Cavia porcellus V461 igkv AAKN02036496.1 36825 VSGDILMTQSPATLAVSPGERVTIHCKSSQSLFYSGNNKHLLSWYQQKPGQSLKRLIYFASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYFCLQGFSYP
Cavia porcellus V462 igkv AAKN02036496.1 44407 VCSDIVMTQSTASLTGPARESTTIYCKFSQSLLYSVVDENLLSWYQQKPGEPPRLHIYWASSKESGVPDRFSGSGPGMDFTLTITSIQGEDVVDYYCLWTFSTP
Cavia porcellus V463 igkv AAKN02036505.1 1517 STADVLMTQTPLSLIIAPGEPASMSCRSSQSLLHSDGKIYLSWVVHKPEQAPQGIIYQVSKHESWTPERFSGSGTGTDFTLDISTVEAEDAGVYYCLQGIHAP
Cavia porcellus V465 igkv AAKN02036505.1 19407 STGDIVMTQTPLSLSVSPGEPASLSCKASESLLHSDGNTYLNWVVHKPGQAPRGMIYKVSNRYSGISERFSGSGSGTDFTLKITRVEPEDAGVYYCWQGTKFP
Cavia porcellus V466 igkv AAKN02036505.1 48908 STGDVVMTQTPLLLSVSPGEPASISCRSSQSLLYSDGYTYLHWLVHKPGQAPRGVIYEVSDKYSWTPERFTGSGSGTDFTLKISRVEAEDAGVYYCVQT
Cavia porcellus V467 igkv AAKN02036505.1 68504 SSGDVLMTQTPHSLSVTPGEPATISCRSSQSLLYSNGLTYFNWLVQKPGQVPRLIIYEVSKRDSWVSDRFSGSGSWTDFTLKISRVEAENAGVYYCQQG
Cavia porcellus V468 igkv AAKN02036505.1 123140 STGDIVMTQTPLSLSVTPGEPAVISCRTSQRLPANDGDTNFYWLVHKPDQVPRGVIYLVYKKFSWTPDRFSGGGSGTDFTLIISRVEAEDAGVYYCYQGTDAP
Cavia porcellus V469 igkv AAKN02036505.1 150316 STGDVVMTQTARSLSIAPGEPASISCRASQSLLHSNGKTYLSWLVQKPGQAPRLMIYQVSNRESWVPDRFSGSGSGTDFTLKISRLEAEDAGVYYCYQG
Cavia porcellus V470 igkv AAKN02036505.1 161412 STGDIVMTQTPLSLSVATGEPASISCRVSQSLLASDGKTYLHWVVHKPGQAPRGVIYLLSKKISWTPDRVSGSGSGRDFTLQISRVEAEEAGVYYCYQG
Cavia porcellus V471 igkv AAKN02036506.1 16272 STGDVVMTQTPLSLSVSPGEPASISCRASQSLLHSNGKTYLHWVVHKPGQAPRGMIYLVSNKYSWTPERFSGSGSGTDFTLKISRVEAEDAGVYYCCQG
Cavia porcellus V472 igkv AAKN02036507.1 10456 STGDVLLSQTPLSLSITPGEPASISCKSSQSLLQSDGNTYLHWVVHKPGQAPRGMIYWVSNRESGTPERFSGSGSGTDFTLKISKVEPEDSGIYYCYQG
Cavia porcellus V539 ighv AAKN02042667.1 39428 VLFQVQLQELGPGLVKPSQILSLICSVSGYSITSCYYWHWIHQPKGKSLEWLGYMYYSGSTSYNPSLWSRMSISLDAGKNELSLQLNSVTAEDTATYYCAR
Cavia porcellus V655 igkv AAKN02051722.1 176267 HRRSRSGLTLRAETRIPEPDATGRPACQQSPVKGWDSGPAESSAGEGRAELAAGGRAPPGLRVVPSRFSGSGEGTDFTLTISSLEPEDVATYYCQQHDSIP
Cavia porcellus V706 igkv AAKN02055193.1 63997 STGDVVMTQTPLSLSVSPREPASISCRSSQSLLYSDGDTYLHWLVHKPGQAPRAMIYEVSEKYSWTPERFTGSGSGTDFTLKISRMEAEDAGVYYCVQN
Cavia porcellus V707 igkv AAKN02055193.1 83939 SSGDVLMTQTPHSLSVSPGEPATISCRSSQSLLYSNGLTYFNWLVQKPGQVPSLIIYEVSKRDSWVSDRFSGSGSWTDFTLKISRVEAEDAGVYYCQQG
Cavia porcellus V708 igkv AAKN02055193.1 126778 STGDVVMTQTPLSLSITPGEPASISCRSSQSLLSSNGNTYLHWVVHKPGQAPHGVIYLVSYRYSGISDRFSGSGSGTDFVLKISKVEAEDAGVYYCVQS
Cavia porcellus V709 igkv AAKN02055193.1 159416 STGDVLLSQTPLSLSITPGELASISCKSSQSLLDSDGNTYLHWVVHKPGQAPRGMIYWVSNWESWTPGRFSGSGSGTDFTLKISKVEPEDSGIYYCYQG
Cavia porcellus V760 igkv AAKN02058073.1 23253 STGDVVMTQTPLSLSVSPGEPASISCRSSQSLLYSDGDTYLHWLVHKPGQPPRGVIYEVSEKYSWTPERFTGSGSGTDFTLKISRVEAEDAGVYYCVQN
Cavia porcellus V765 igkv AAKN02058401.1 16526 SKGDVLLSQTPLSLSITPGELASISCKSSQSLLDSDGNTYLHWVVHKPGQAPRGMIYWVSNRESWTPGRFSGSGSGTDFTLKISKVEPEDSGIYYCYQG
Cavia porcellus V767 igkv AAKN02058664.1 14222 STGDVVMTQTPLSLSVSPREPASISCRSSQSLLYSDGDTYLHWLVHKPGQAPRAMIYEVSEKYSWTPERFTGSGSGTDFTLKISRMEAEDAGVYYCVQN
Cavia porcellus V768 igkv AAKN02058664.1 34286 SSGDVLMTQTPHSLSVSPGEPATISCRSSQSLLYSNGLTYFNWLVQKPGQVPSLIIYEVSKRDSWVSDRFSGSGSWTDFTLKISRVEAEDAGVYYCQQG
Cavia porcellus V774 ighv AAKN02060213.1 7130 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSNYYMHWIRQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAG
Cavia porcellus V867 iglv AAKN02007206.1 42800 SMAFYKLTQPSSLSVTWGKTARITCQAYGLRSYAVNWYQQKPGQAPVLIIYYDDSKPAGIPNRFSGSNKGNTATLTISRALFEDEADYYCQVRDNSDG
Cavia porcellus V868 iglv AAKN02007208.1 77587 TIASYVLTQPPSVSVSLGQTASITCSGNELPSRYACWFQQKPGQPPVQVIYKDSEWPSGISERLSGSNSGTTATLTINGVQAEDEADYYCFSRRRC
Cavia porcellus V869 iglv AAKN02007208.1 63875 SIASYVFTQPPSVSVSPGQTATITCSGDSLPSRYAHWYQQKPGQTPVNVIRKDSERPSGISERFSGSRSGTTATLTISRVQAEDEADYYCGSWDNSANH
Cavia porcellus V870 iglv AAKN02007208.1 41898 SVASYVLTQPSSMSVSPGETARLTCEGNNIGGKAVHWYQQKPAQAPMLVMYYDNERPSGIPDQFSGANSGNTATLTITGAQAEDEADYYCQVWDSNN
Cavia porcellus V871 iglv AAKN02007209.1 392337 SIASYVLTQPPSVSVSLGETVTITCSGDALPKKYAYWFQQKPGQTPVRVIYKDSERPSGVSERFSGSSSGTTATLTISGVQAEDEADYYCLSADSSGSY
Cavia porcellus V872 iglv AAKN02007209.1 381989 SIASYVLTQPPSVSVSPGETVTITCSGNVLPKKYAQWFQQKPGKTVQLIYKNSEWPSGVSERFSGSKSGPTATLTISRVQAEDEADYYCQSWDSSGNL
Cavia porcellus V873 iglv AAKN02007209.1 355661 SVASYVLTQPSSMSVSLGETISLTCDGNNIGGRRVRWYQQKPPQCPMLVMYSDNNRPSGIPDRFSGANSGNPATLTITGAQDEDEADYYCQVWDSNS
Cavia porcellus V874 iglv AAKN02007209.1 336205 SVASYVLTQPSSMSVSLKETVRLTCEGNNIGDKAVHWYQQKPPQSPMLVMYTDKNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVYDSNS
Cavia porcellus V875 iglv AAKN02007209.1 312728 SVASYVLTQPSSMSVSLRETARLTCEGNNIGSKYVHWYQQKPLQAPMLVMNNNNRPSGIPDRFSGAKSGNMATLTITGAQAEDEADYYCQVWDGNS
Cavia porcellus V876 iglv AAKN02007209.1 302595 SMASYILTQPPSVSVTPGQTATITCSGDKLSKQYAHWYQQKPGQVPTLLIYKDSERASGIPDRFSGSSSGNTATLTISGTQAADEADYYCLSRESNDA
Cavia porcellus V877 iglv AAKN02007209.1 290439 SVASYVLTQPSSMSVSLKETVRLTCEGNNIGDKAVHWYQQKPPQSPMLVMYTDKNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVYDSNS
Cavia porcellus V878 iglv AAKN02007209.1 267675 SVASYVLTQPSSMSVSLGETARLTCEGNNIGGKYVYWYQQKPPKAPLQVMYKNNNRPSGIPDRFSGAKSGNMATLTITGDQAEDEADYYCQVWDSNS
Cavia porcellus V879 iglv AAKN02007209.1 236339 SMASYILTQPPSVSVSPGQTAAITCSGDKLSKRYAYWYQQKPGQAPALLIYEDSKRPSGIPDRFSGSSSGNTATLTISGTQAADEADYYCLSRESNDA
Cavia porcellus V880 iglv AAKN02007209.1 215431 SVASYVLTQPSSMSVSLRETARLTCEGNNIGGKYVHWYQQKPLQAPMLVIYDNNNWPSGISDRFSGATSGNTATLTITGAQAEDEADYYCQVWDS
Cavia porcellus V881 iglv AAKN02007209.1 196884 SVASYVLTQPSSMSVSLGETASLTCEGDNIGIYYVYWYQQKPPKAPMLVMYSNNNRPPGIPDSFSSDNWGNTATLTITGVQAEDEADYYCQVSDGNML
Cavia porcellus V882 iglv AAKN02007209.1 176392 SVVSYVLKQPPSVSVSLGQTASVTCSGNELPSRYACWFQQKPGQPPVQVIYKDSEWSSGISERLSGSNSGTTATLTINGVQAEDEADYYCLSMDSMVTI
Cavia porcellus V883 iglv AAKN02007209.1 172079 SIASYVLTQPPSVSVSPGQTATITCSGEALPKRYAQWFQQKPGQTPMSVIYKDSERPSGISDRFSGSSSGTTATLTISGVQAGDEADYYCQSWDSSGNL
Cavia porcellus V884 iglv AAKN02007209.1 160604 SVASYVLTQPSSMSVSPGETAKLTCEGNNIGRKSVQWFQQKPPQAPMLVIYADNLRPSKIPNRFSGANSGNTATLTITGAKAEDEADYYCQVWDSDSAQ
Cavia porcellus V885 iglv AAKN02007209.1 142190 SIASYILTQPPSVSVSPGQTASITCSGDALTKKYAHWFQQKPGQTPVRVIYKDSEWPSGVSERFSGSKSGTTATLTISGVQAEDEADYYCLSTDSSGNY
Cavia porcellus V886 iglv AAKN02007209.1 103946 SVASYVLTQPSSMSVSLGETAILTCDGNNIGGRRVHWYQQKPPQTPMLVIYADNNRPSEIPNRFSGAKSGNTATLTITGAQAEDEADYYCHVWDSSIS
Cavia porcellus V887 iglv AAKN02007209.1 93043 SMASYILTQPPSVSVSPGQTATITCSGEKLSERYAYWYQQKPSQAPALVIYNDSERPSEIPDRFSGSSSGNTATLTISGAQAADEADYYCLSSESDDA
Cavia porcellus V888 iglv AAKN02007209.1 60614 SVASYVLTQPSSMSVSLGETVRLTCEGNNIGGKNVYWYQQKPPQAPMLVMYSDNTRPSGIPDRFSGAKSGNTATLTITGTQDEDDADYYCQVWDS
Cavia porcellus V889 iglv AAKN02007209.1 32794 SVASYVLTQPSSMSVSLGGTVRLTCEGNNIGGKAVQWYQQKPPQAPMLVMYNGNSRPSEIPDRFSGANSGNTATLTISGAQDEDEASYYCQVYDSSS
Cavia porcellus V890 iglv AAKN02007209.1 12710 SVASYVLTQPSSMSVSLKKTVRLTCEENNIGDKAVHWYQQKPPQAPMLVMYIDNNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVYDSNS
Cavia porcellus V891 iglv AAKN02007210.1 11581 SVASYVLTQPSSMSVSLKETVTLTCEGNNIGDKAVDWYQQKPPQAPMLVIYSDNNRDSGIPDRFSGANLGNTATLTITGAQAEDEADYYCHVWDSSS
Cavia porcellus V892 iglv AAKN02007214.1 65495 SLSQELVTQEPSLSAPPGTAARLTCTLRSDLSVGSYRIFWYQQKPGSPPRFLLHYHTDSDKQLGSGFPSRFSGSKDTSANAGVLRISGLQPEDEADYYCGI
Cavia porcellus V893 iglv AAKN02007214.1 16366 AESQAVVTQESSLYISPGGTVTLTCASSTGAVTTSNYAAWVQQKPSEIPKGLIYHTSTRNSGVPARFTGSLLGDKAAFTITGAQTEDEATYYCALWYS
Cavia porcellus V894 iglv AAKN02007214.1 7983 AKSQAVVTQESSLYISPGGTVTLTCASSTGAVTTSNYVDWIQQKPYQTPQQIIGDNSNQVPGVPARFSGSLLGDKAALTITGIQPEDEATYYCTLQYSNPFH
Cavia porcellus V895 iglv AAKN02007215.1 477857 AESQAVVTQESSLSISPGGTVTLTCASSTGAVTTSNYAAWVQQKPSEITKSLIYGTSNRSPGVPARFTGSFLGNKAAFTITGAQTEDEATYYCALWYSNH
Cavia porcellus V896 iglv AAKN02007215.1 419988 SWAQAVLTQPPSVSGPLGETVTISCTGSSTNIGYGYTASWYQQLSGMTPKLIIYRNSNRPSGVSDRYSGSKSGNSASLTISRLQPEDEGDYYCLCYDTSLS
Cavia porcellus V897 iglv AAKN02007215.1 384022 SLSQPVLTQLPSASASLGQTHKLTCTLSSGYSNYNVDWYQQSQGKSPRFVMRVGTSGIVGSKGSGIPDRFSGSGSGSERYLTIQNIQEEDENVYYCGA
Cavia porcellus V898 iglv AAKN02007215.1 354613 AESLAVVTQESSLYVSPGGTVTFTCASSTGAVTTSNYAAWLQQKPYETPQGLIDDTSHRIPGVPARFTGSLLGDKAAFTITGAQTEDEATYYCALWYSNH
Cavia porcellus V899 iglv AAKN02007215.1 335432 SFSQDLVTQEPSLSASPGAAARLTCTLRSDISVGGKNLYWYQQKPGSPPRFLLYYYSDSDKQLGSGFPNRFSGSKDTSANAGILHISGLQPEDEADYYCSI
Cavia porcellus V900 iglv AAKN02007215.1 305859 AKSQAVVTQESSLYISPGGTVTLTCASSTGAVTTSNYAAWLQQKPYETPKGIVGNTSNRISGVPARFTGSLLGAKASLTITGAQNEDEATYYCGLWYSNH
Cavia porcellus V901 iglv AAKN02007215.1 253031 SWAQSGLSQEASLSGSVGQRVTLSCTGSSSNVGSYGAGWYQKIPGAAPKTVMLGTTRPSGIPDRFSGSKSGNRATLSISNLQPEDDADYYCSSWDYSQNV
Cavia porcellus V903 iglv AAKN02007215.1 167554 SLSQPVLTQLPSASFSLGRTHKLTCILSSNYSNYTMDWFQQSQGKGPRFVKRVGTSVIVGSNGHGIPDRLSGSGSGLDRYLTIQNIQEEDENVYYCEV
Cavia porcellus V904 iglv AAKN02007215.1 138266 SFCQPVLKQSPSASASPGGSIKLTCTLSSEHSSYYIEWYQQHPGKSPGYVMQLKSDGSHSKGDGIPDRFTGSSSGADRYLTISNIQPEDEADYICGVSYSGG
Cavia porcellus V905 iglv AAKN02007215.1 108352 SFCQPVLKQSPSASASPGGSIKLTCTLSSEHSSYYIEWYQQHPGKSPGYVMQLKSDGSHSKGDGIPDRFTGSSSGADRYLTISNIQPEDEADYFCGVGYSGG
Cavia porcellus V906 iglv AAKN02007215.1 57895 SYSQDLVTQEPSLSASPGAAARLTCTLKSDISVGNYRINWFQQKPQSPPQFLLHYYSDSDKQLGSGIPSRFSGSKDTSANAGVLRISGLQPEDEADYYCGI
Cavia porcellus V907 iglv AAKN02007219.1 159845 SFCQPVLKQSPSASASLGASVKLTCTLSSEHSSYFISWYQQQPGKSPGYVMSVYSDGRHSTGDGIPDRFTGSSPGADRYLTISNIQPEDEADYFCGVSKRGI
Cavia porcellus V908 iglv AAKN02007219.1 87837 SFSQPVLTQPPFLSASSGASAVLTCTLSSGFVVSGYHISWYQQKSGNHPRYLLRYYSDSNQHQGSGVPSRFTGSKNPSANAGILLISELQYEDEADYYCL
Cavia porcellus V909 iglv AAKN02007219.1 77466 ASSQAVVTQESSLSVTPGGTVTLTCGFSTGAVTTSNYAKWVQQNPYQILQGLIRDTSNQVPGVAARFTGSLLGNKASLTITGAQPEDEATYYCVLWYSNH
Cavia porcellus V910 iglv AAKN02007219.1 43059 VVSQTSVTQEPSMSMSSGETVTLTCCLSSGFVSTNNYPSWYQQNLGQAPYALTYNTNSHFSGVPDHLSGSIALTIMIAQTEDEADYYCLLYVGSNS
Cavia porcellus V911 iglv AAKN02007219.1 7569 SWAQAVLSQPPSVSGPLEGTVTIYCTGSSTNLGSGYYAHWYQQLSGMSPKLIIYENSNRPSGISGRYSGSKSGNSASLTISGLQPEDEADYYCQSYDKSFD
Cavia porcellus V991 trbv AAKN02015428.1 36261 RTETQVIQTPRYLIIETGKNKMMTCFQNMSYDTMYWYRQDPGLGLKLIYFSLNVGVTEKGEVSDGYSIYRKDKQNFFLTVEKARTSQTSVYLCAGST
Cavia porcellus V992 trbv AAKN02015429.1 44606 GSALGVLVLQHPSRVICHSGSSVKIECRFVDLQALTVIWYRQFPKQGFTRIAISTEGSGVAYEQDVTEAKFPISPPNQTYSSLTVTTTNPKDSSFYFCAAS
Cavia porcellus V993 trbv AAKN02015429.1 38939 DSGLGALVLQHPSRTICKSGSSVKIECHFVDLQATTVFWYHQFPKESFVLMATSNTDSIASYEKGFNETKFAIHHPNLTYSTLTVTTTHPEDSSFYFCAAS
Cavia porcellus V994 trbv AAKN02015429.1 31445 FSDDEVIQTPRHLIKWKGQKANMSCIPKKGHTAIYWYQQKQNKELNFLIYFLNSQDMNKMDRFEDQFSAECSQDSHCRLEIKSSEPEHSALYLCASSE
Cavia porcellus V995 trbv AAKN02015429.1 29528 FSDDEVIQVPRHLIKWKGQGANMSCVPKRGHTAVYWYQQNQNKELKFLIYFRNRKDMEKMNMFEKQFSAECPQDSLCRLEIKSSELEDSALYLCASSQ
Cavia porcellus V996 trbv AAKN02015429.1 27589 FSDDTVTQRPTHLIKWKGQKANMSCVPKKGHNAVYWYQQKQSNELKPLIRFQNREPLEEIDRFKDLFSATCPKDLPCSLEIKSSERNNSALYLCASSE
Cavia porcellus V997 trbv AAKN02015429.1 25302 FSEDTVTQRPRHLIKWKGQRANMRCVPKKGHTTFYWYQQKQNKELKFLIYFQNRQDINKMDMFEKQFSAECPQDSLCRLEIKSSEPEDSALYLCASSE
Cavia porcellus V998 trbv AAKN02015429.1 21480 FFDDTVTQRPRHLIKWKGQKANMSCVPKKGHTAVYWYQQKQNKELKFLIRFQNEDPLDEMNKFEDQFSAQCPKASPCSLEIKSSDREDSALYLCASSQ
Cavia porcellus V999 trbv AAKN02015429.1 11169 SMASGVTQTPRNRIIQTGMRTVLECSQTKDHEQMFWYRQDPGQGLQLIYYSIDINDFTPAEISDGYKVSRKEKPKFSLSIEAATLNQTALYFCASSM
Cavia porcellus V1000 trbv AAKN02015430.1 29813 FLDEEVRQTPRHLVKGIGQEVKMYCAPMKGHSYVFWYQQILAKDFKFLISFQKENIFDGTQMPKERFLAACPEKSPCSLEIQPTELQDSAVYLCASSE
Cavia porcellus V1001 trbv AAKN02015430.1 17693 TVDSGITQIPKFRIIKKGQAVTLRCEQNLNHDAMYWYRQDAGQGLRLIYYSPITPDTQKEDATESYSASREKKEIFLLTMESTQRNQAAVYLCASSR
Cavia porcellus V1002 trbv AAKN02015433.1 19506 FLDAEVIQSPRNLIKAKGGKSTLLCYPTSGHISVSWYQQVPGQGLQLLIQYYDMRQRTKGNMPDRFSGQQFSDYHSELNMSTLELEDTAVYLCASSM
Cavia porcellus V1003 trbv AAKN02015433.1 16340 HIEAGITQSPRFKVTKAKEKVTLKCQQTNKHDYMYWYRQDPGHGLRLIHYSYGIKYLEPGEFPKGYNVSRENTEDFPLTLDSATLTQSSVYFCASSD
Cavia porcellus V1004 trbv AAKN02015435.1 38371 PGNAGITQIPVSQVLKTGQHMTLSCVQQLNHDRMYWYRQDPGLGLRLIYYSYDTNITEKGEFSDGYSVSRPSRENFLLTIQSANPSQTSVYFCATSD
Cavia porcellus V1005 trbv AAKN02015435.1 16621 YIEAVVIQTPRYKITKTKEKVTLKCHQTNNHDNMFWYRQDPGHGLKLIHYSYGVDDKNKGEVEGYSVSRENTEDFPLTLDSTNLAQSSVYFCATSY
Cavia porcellus V1006 trbv AAKN02015435.1 2721 HIEAGIIQSPKHKITKTEEKVTLKCHQTNKHDYMYWYRQDPGHGLRLIHYSYGVDIQNKGEVPDGYSVSRENTEDFPLTLDSATLGQSSVYFCATSY
Cavia porcellus V1007 trbv AAKN02015439.1 41371 HTEAGVSQSPRYKITKTKEKVTLNCHQTNSHNSMYWYRQDLGRGLRLIHYSVGVGIQDKGEAPDGYSVSRENTEDFPLTLDSATLFQSSVYFCATSV
Cavia porcellus V1008 trbv AAKN02015439.1 31612 HIEAGITQSPRHKITNIKEKVILKCHQTNSHNYMYWYPQDLGHGLKLIHYSNGVYIQNKGEVPDGYSVSRENKEDFPLTLDSATLAQSSVYFCATSV
Cavia porcellus V1009 trbv AAKN02015439.1 10986 SVFIDHTKAGVSQSPSNKVTIKGQNVTFRCDPVSGHTVLYWYQKNPEQSPKFLMYFRDELPSDTSGMPPERFSAERTEGTFSHLKIQSAQPGDSAVYLCAS
Cavia porcellus V1010 trbv AAKN02015439.1 1140 SVFIDHTEAGVSQSPSYKVTIKGQNVTFRCDPISGHTFLYWYQKNPEQGPKFLMYFQNELPSDTSGMPTERFSTERTEGTFSHLKIKSAQPGDSAVYLCAS
Cavia porcellus V1011 trbv AAKN02015440.1 90994 PVETGVIQTPGHRMKTKRQQVTIRCSPMTGHQSLSCYQWAMGQGPQFIFEYYNELQRAKENLSTRFSAQFHDPLSELNIQTLELGDSAVYLCASR
Cavia porcellus V1012 trbv AAKN02015440.1 84401 LGNAGITQTPMSRVLKTGQHMTLSCVQQANHDLMYWYRQDPGLELRLIYYSYDTNITVKGEVSDGYSVSRPNRESFSLTVLSASPSQTSVYFCSSCD
Cavia porcellus V1013 trbv AAKN02015440.1 81265 HTEVGVSQSPNYKVIKKGQNKTFRCDPISGHTLLYWYQKNPEQGPQYLMYFEDKLLLDTSGMPPEQFSAERLEGTFSNLKIQSAQHGDCVVYLCAS
Cavia porcellus V1014 trbv AAKN02015440.1 25771 HIEAGITQSPRYKITKTKEKVSLKCYQPNSHNSTYWYRQDPGYGLKLNHYSYGVDNQDKGEVPDRYSVSRENTEDFPLTLDSATLFQSFVYFCATSD
Cavia porcellus V1015 trbv AAKN02015441.1 32627 HMAREVKQTPRHKITEMGQAVTLRCDPISGQQYIYWYRQTADKGMEFMAYLVDKTPTDKADFFRDRFSAEKPEGSYSNLKIDPVQLGDSAMYLCASSE
Cavia porcellus V1016 trbv AAKN02015441.1 16789 YMAPGVEQTPRHKITEIGQPVILRCDPISGHQYIYWYRQTAEKGMEFMVYIYNKDPMEKTDLFNDRFSIEKTEGSYYTMKIHPVQIGDSAMYFCASSQ
Cavia porcellus V1017 trbv AAKN02015442.1 139792 HMAPGVKQTPSHKITEVGQPVTLWCDPISGHPYVYWYQQTAEKGMEFIVYIYDEDNTEKADFFQDRFSVEKPEGSYSNLNIQPVQLGDSAIYLCASSL
Cavia porcellus V1018 trbv AAKN02015442.1 118548 HMAPGVKQTPSHKITEMGQPVTLWCDPISGHEDIYWYRQTAGKGMEFMVYLYRNSTMKKADFFKDRFSALKFVSSFIIKIQPVQLGDLAMYFCASSS
Cavia porcellus V1019 trbv AAKN02015442.1 101340 SVFIDYIKAGVSQSPSYKVTKKGQNVTFRCDPISGHIFLYWYQQNPDQGPKFLMYFQDKLPSDTSGMPTERFSAQRPEETFSYLKIQSAQPGDSAVYLCSS
Cavia porcellus V1020 trbv AAKN02015442.1 76238 PMNTTIIQTPRYLVMGTSNKKSLKCEQHLGHNAMYWYKQNAKKPPELMFAYNLQDLLQNETVPSHFLPSRSEKSHMYLNLTALHPEDSAVYLCASSQ
Cavia porcellus V1021 trbv AAKN02015442.1 17575 HMAPGVKQTPRHKITEMGQPVTLRCDPISGQQNIYWYRQTAEKGMEFMAYLLDKTPTDKADFFRDRFSAEKPEGSYSNLKIDPVQLGDSAMYLCASSA
Cavia porcellus V1022 trbv AAKN02015444.1 45843 PMNSTIIQTPRYLVMGTANKKSLKCEQHLGHDAMYWYKQNAKNPPELMFVYSFQKLTQNETVPSRFSPWCSEKTHMYLNLTALHPEDSAVYLCASSE
Cavia porcellus V1024 trbv AAKN02015444.1 34327 HMAPGVKQTPSHKITEVGLAVTLSCDPISGHQYISWYRQTAEKGMEFMVYLIDKNPTEMADFFMDRFSAEKVRSEFIMKIQPVQLEDSAVYLCASSE
Cavia porcellus V1025 trbv AAKN02015444.1 19654 HLVPGVKQTPSHKITEMGHPVTLRCDPISGQNYIYWYRQTAERGMEFMAYLYDNDPMDKADFFKDRFSLEKPKGSHSIMKIQPVQLGDLAVYLCASSA
Cavia porcellus V1026 trbv AAKN02015445.1 37857 PMNTTIIQTPRYLVMGTANKKSLKCEQHLEHNAMYWYKQNAKKPPELMFAYNYQQLVQNETVPSRFSPWCSEKSHIYLNLTALHPEDSAVYLCASSQ
Cavia porcellus V1060 trav AAKN02019139.1 29086 ISVAQKVTQSRPEISIPEAATATLDCTYDTSETNYYLFWYKQPPSGQMIFIIRQDAYKQQNATEARFSVNFQKAAKSFSLKISDSNLGDAATYFCAFS
Cavia porcellus V1061 trav AAKN02019140.1 65020 VSSQELRQSQSLVTPEGEELTINCSSSTTLYALHWYRQTDGGPVFLMTLHKGGDEKSHGKITANLDEKMQQSSLRITATRPSHSGTYFCAGNAQ
Cavia porcellus V1062 trav AAKN02019140.1 42832 VSGQQLKQSPQTITTQEGKDVSMNCSASTTLNYFLWYKQYPGEAPVLLITIYKSDELITSGKVAAWSDETRKNSFLSIPASKLDDVGTYYCAG
Cavia porcellus V1063 trav AAKN02019140.1 29798 RGKTDSITSQKTEVSSTEKKTVSLLCNYEVSSTSSIIFFWFRQYPNQAPEYILHRGWQNSLKGDASFAMGRFYSKSTANSIELYIRDLILTDTAVYYCALR
Cavia porcellus V1064 trav AAKN02019140.1 4949 VNMAQKVTQSRPEISIPEAATATLDCTYDTSDSNYYLFWYKQPPSGQMIFIIRQEAYKQQNATEARFSVNFQKAAKSFSLKISDSDLGDTATYFCALW
Cavia porcellus V1065 trav AAKN02019141.1 30073 IRAQIKVEQSPQVQIIQEKRSSSLTCNYSTSISVQWFQQTPEGRLVSLFYIASGEQQKGRLKATVNFKERYSRLYIRDSQPGDSALYFCAVQAQCSP
Cavia porcellus V1066 trav AAKN02019142.1 6051 MNGKQVKQIPRFWHVLEGENFSAYCNSSASLNNLEWYKQKPGGHPVLLVRLVKGGEVKKQDRLTTRFEEGRQDGSLHITATRGTDVGTYFCAA
Cavia porcellus V1067 trav AAKN02019143.1 50336 MSGQQKEVQQSPESHSVPAGATAFLNCTFRDSDSRNFAWYRQYPGKGPELLISIYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHRDSATYFCAV
Cavia porcellus V1068 trav AAKN02019143.1 22905 VNSQQAETPRAQIIQEGENASVSCSYKSMNTNLQWYRQDSRGSLALLLLMRSNEREKYRGRLKATLDASTKTSSLFISAAQLVDAATYFCAT
Cavia porcellus V1069 trav AAKN02019143.1 722 QQKEKHDQQPEKQSPPFLTNQEGETSILNCTYERSTFDYFLWYRQFPGKTPTFLIAVSSYTDEKQDGRFTVFFSESSKYLSLHIKDSQPGDSATYFCAA
Cavia porcellus V1070 trav AAKN02019144.1 58283 VRGVRVEQSPLTLSLQEGARHALRCNFSTTMRTVQWFLQNEEGRLLNLFFLTSGTKKNGRLESTFNSKERFSTLQITASDLGDAGSYFCAGEAQCSP
Cavia porcellus V1071 trav AAKN02019144.1 53126 RTCGQSVTQMGGQVTTTEETFLTINCTYTASGYPELSWYVQYPGKGPQLLLKAVKANQREISKGFEAIYDKETKSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1072 trav AAKN02019144.1 41069 VSSQQKEVEQSPETLSVPEGDTASLNCTYRDSLSNTFGWYRQYPGKGPELLISMYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHRDSAAYFCAV
Cavia porcellus V1073 trav AAKN02019144.1 16911 GSNGDSVTQTVGQMTLPEGPRLTINCSYETTGFPFLFWYIQYPGKAPQLFLKATKDKEKGSNKGFEATYDRETGSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1074 trdv AAKN02019144.1 1513 SSIAQKVTQAQTAASVQETEAVVLDCTYDTSSTNYGILWYKQPSSGEMIFLIRQDSYKQNAAEGRYSLYFQKASKFIQLVISASQLGDSGLYFCALAD
Cavia porcellus V1075 trav AAKN02019145.1 123806 IRGAQVEQSPSTLSLQEGANITLRCTASTTQNTVHWFLQNARGGLVSLFVMSPGTKQAGRLQSTFNFKERSSTLHMTAAEPGDSGFYLCAVGAQC
Cavia porcellus V1076 trav AAKN02019145.1 117056 SSIAQKVTQAQSPVSAEEMEAVILYCTYDTSEPSYNLFWYKQPSSGEMVLLIRQNSYDTQNATEGRYSLRFQKAGKSIHLIISASQLEDSAVYFCALRE
Cavia porcellus V1077 trav AAKN02019145.1 75628 GGGAQSVAQPDHHVTVAEGHALLLKCNYTHSVTPYLFWYVQRPEKDLQLLLKYVPGSSVVTGTRGFKAEFKKSETSFHLQKSSAQGSDAAMYFCALS
Cavia porcellus V1078 trav AAKN02019145.1 67235 KDKGDQQQVKQNPPYLTVQEGDTSILNCTYENSAFDYFPWYRQLPGKSLELLIAIRSVLNEKEDGRFKVFLKKSDQELSLHIRTSQLGDSATYFCA
Cavia porcellus V1079 trdv AAKN02019145.1 42011 PSVAQKVTQVQPVTSGRQGETATLDCEYETQWSSDTLSWYKQLPSGEMVLLIWSTSGQTKKAGRYSVEFPKANSMSFIISGLQIEDSAKYFCATRE
Cavia porcellus V1080 trdv AAKN02019145.1 8411 SSAAQTVTQAQSALWRPEGEAVTLDCSYDTSQSSYSLYWYKQLPSGDMISLIRQHSFEQSTQSDRYSVNFQRKAKSMSLTISALQMGDSAKYFCALK
Cavia porcellus V1081 trdv AAKN02019146.1 24813 SSAAQTVTQAQLALWRPEGEAVTLNCSYDTSQSSYSLYWYKQLPSGDMIFLILQNSFEQSTQSGRYSVNFQRKAKSMSLTISALQMGDSAKYFCALK
Cavia porcellus V1082 trav AAKN02019146.1 10516 VRGVQVEQSPLTLSLQEGARHALRCNFSTTMRTVQWFLQNQEGRLLNLFFLTSGTKKNGRLESTFNSKERFSTLQITASELGDTGSYFCAGEAQCSP
Cavia porcellus V1083 trav AAKN02019146.1 5336 RICGQSVTQMGGQVTTTEETLLTINCTYTASDYSEFLWHVQYPGKGPQLLLKAVKANQREISKGFEAIYDKETSSFHLKKASVQESDLAVYYCALS
Cavia porcellus V1084 trav AAKN02019146.1 1711 GSEEESVTQTQGQVTLSERTALTVNCSYETAVYPGLFWYVQYPGEGPQLLLKATKDKEKGSNKGFEATYDRETGSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1085 trav AAKN02019147.1 62979 KNHGDSVTQTEGPVTLTELETLILNCTYQTTYSGPVLFWYVKYMDKAPQLLLRSATETKTENQGFQATLIKSRSSFHLQKPSLELSDSAVYYCALG
Cavia porcellus V1086 trav AAKN02019147.1 44367 MRGQQIKQIPRFWHVWEGENFTAYCNSSGTLNSLQWYKQKPGGRPVLLVRLMTGGEVKEQDRLITRFGERRQDGSLHITATRGTDVGTYFCAA
Cavia porcellus V1087 trav AAKN02019147.1 31469 EGGAQSVAQPDRHVTVTEGHALVLKCNYTYGATPYLFWYIQQPEKDLQLLLKYVPGSSVVISNRDFKAEFKKSETSFHLQKSSAQWSDAAMYFCALS
Cavia porcellus V1088 trav AAKN02019147.1 6963 TGSLAKTTQPFSMDSYEGQEVNLSCTHPDIATSEYIFWYRQVHHQGPQFIIQGYKTDVANEVASLFIPKDRKSNTLSLPRVALRDTAVYYCIVAE
Cavia porcellus V1089 trav AAKN02019148.1 6106 VRGEQVEQSPSTLSLQEGANITLRCNVSTTTNVMHWFRQNPRGGLVSLFFMSPGTKQAGRLQSTFNFKERSGTLHIAKASKPGDSGFYLCAVD
Cavia porcellus V1090 trav AAKN02019150.1 102806 GSRAQSVAQPDHHVTVAEGHALLLKCNYTYSATPYLFWYVQRPGQGLQLLLKYFGGSSVVTGNRGFKAEFKKSETSFHLQKSSAQGSDAAMYFCALS
Cavia porcellus V1091 trav AAKN02019150.1 93977 RSYGDSVTQTEGPVILPERSQLTLNCTYQTTYSVTFLYWYVQYSSTAPRLLLRSATENQPAENRGFQATLAKSQRSFPLQKPSLQLSDSATYYCALG
Cavia porcellus V1092 trdv AAKN02019150.1 84563 SSVAQKVTQVQPLTSRPEGEMVTLDCSYETTWSSYYLYWYKELPSGEMVFVIKQHSSYSNAISGRYSVNFQREAKSISLTISALQMEDSAKYFCAILE
Cavia porcellus V1094 trav AAKN02019150.1 64940 ISGQQVKQIPQFWCIWEGENFTAYCNSSGTFNTLLWYKQKPGGHPVLLVRLVKGGEVKEQDRLTTQFGERRQDGSLHITATRGSDVGTYFCAT
Cavia porcellus V1095 trav AAKN02019150.1 55008 GSGAQSVAQPDRHVTVPEGHALLLKCNYTYGGAPYLFWYFQRPGQGLQLLLKYLGGSSVVTGNRGFKAEFKKNEASFHLQKSSVQGSDAAMYFCAVS
Cavia porcellus V1096 trav AAKN02019150.1 46547 DQQQVKQNPLYLTVQEGETSILNCTYENSAFNYFAWYRHLPRGKGLELLIAIRSVVNENEDGRFKVLLKKNDQELSLHIRTSQLGDSATYFCAAG
Cavia porcellus V1097 trdv AAKN02019150.1 29805 FSVAQKVTQVQPLTSRPEGETATLDCSYETTQDSYFLHWYKQLPSGEMVFLIMQYSSHSNAKSGRYSINFQSTAKFISLTISALQMEDSAKYFCAIEE
Cavia porcellus V1098 trav AAKN02019150.1 8361 VSSQQKEVEQSPETLSVPEGDTADLNCTYRDSNSNIFRWYRQYPGKGPELLISIFSNGEQEDGRFKAQLNRANRHISLHIGASQSLDSATYFCAV
Cavia porcellus V1099 trav AAKN02019151.1 84122 GSEEESVTQTQGQVTLSERTALTVNCSYETKTTQYAVLSWYVQYREEGPQLLLKATKDKEKGSNKGFEATYDKGSSSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1100 trav AAKN02019151.1 58096 FSIAQKVTQAQPPVSVEEMEAVILQCTYDTSDTGYSLFWYKQPSSGEMVLLIRQNSYDTQNATAGRYSLHFQKAGKSIHLIISASQLEDSAVYFCALRG
Cavia porcellus V1101 trav AAKN02019151.1 36236 VSGQQKEVEQSPETLSVSEGDSIDLNCSYSGRNFQTFIWYRQHPGKGPEFLISLFSSGDRKEGRFTAQLSTASRHFSLHITDSQHHDSAAYLCAMS
Cavia porcellus V1102 trdv AAKN02019151.1 31302 LIVAQKVTQGQTALSRPEGTAVVLDCSYKTNVALYDLYWYKQLFSGEMVLLIHQSYTGNNANTGRYSVSFQKRAQTISLTISPLQMEDFATYFCVFRE
Cavia porcellus V1103 trav AAKN02019151.1 6135 FSIAQKVTQAQLPVSVEEMEAVILKCTYDTSYSDTSYSLFWYKQPSSQEMVLLLRQNSYDTQNATQGRYSLHFQKAHKSIHLIISTSKLEDSAVYFCALSD
Cavia porcellus V1104 trav AAKN02019155.1 8675 ISSQQKEVEQSPETLSVSEEHTASFNCTYRDSGSYAFRWYRQYPGKGPELLISIYSDGDQEEGRFKAQLNKANRHVFLHIGACQSLDSATYFCAV
Cavia porcellus V1105 trav AAKN02019156.1 96214 VSSQQKEVEQSPETLSVSEGDSVDLNCTYSDRNFQTFIWYQQHPGKRPEFLMSLFSSGDRKEGRFTAQLSTASRHFSLHVTGSQHHDSAAYFCAM
Cavia porcellus V1106 trav AAKN02019156.1 82525 GSGAQSVAQPDRHVTVAEGHALLLKCNYTYSGTFYLFWYIQRPGQGLQLLLKYVTGSPVVTGTRGFKAEFKKSETSFHLQKSSAQGSDAATYFCALS
Cavia porcellus V1107 trdv AAKN02019156.1 56509 PSVAQKVTQVQPVTSGRQGETATLDCEYETQWSSDTLWWYKQLPSGEMVLLIWSTSGQTRKAGRYSFEFPKANSMSFIISGLQMEDSAKYFCAIRR
Cavia porcellus V1108 trdv AAKN02019156.1 28710 SSVAQKVTQVQSPISRPKGEIVTLDCSYETTWSSYFFYWYKQLPSGEMVFLIWQHSSSSSANSGRYSLNIQKAAKSISLTISALKMEDSAKYFCAIVE
Cavia porcellus V1109 trav AAKN02019156.1 15434 VSSMPVLEQSPSFLSVQEGTLAILNCTTGERTRLNFHWFRQNPGKELVSLTSIQKEQTDRHFKDQLGKSKLYSVLNLPSPQLSDSATYFCAL
Cavia porcellus V1110 trav AAKN02019157.1 87416 VSSLHVREQSSSFLSVQEGTLAILNCTTGERTRLNFHWFRQNPGKELVSLTSIQSGQEEQMDRHFKDQIGKSKLYSVLNLPSPQLGDSATYFCAL
Cavia porcellus V1111 trav AAKN02019157.1 62317 VSSQQKDVEQSPETLSVPEGDTADLNCTYRDSNSNNFRWYRQYPGKGPELLISIFSNGDQEEGRFKAQLNRANRRVSLHIGASLFPDSATYFCAVR
Cavia porcellus V1112 trav AAKN02019157.1 33382 GSEEDSVTQTQGQMTLSERTALTVNCSYETTGYPGLFWYVQYPGEGPQLLLKATRDKEKGSNKGFEATYDKETRSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1113 trav AAKN02019157.1 9730 VRGAQVEQSPSILNLQEGANITLRCNFSTTTNTVHWFWQNSRGSLVSLFLMFPGTKQAGRLDLTFNFKERSSTLHITASELGDSGFYLCAVEAQC
Cavia porcellus V1114 trav AAKN02019157.1 3173 SSIAQKVTQAQPPVSVEEMETVILRCTYDTSVTSYSLFWYKQPSSGEMVLLLRQNSYDTQNATAGHYSSHFQKAHKSIHLIISASQPEDSAVYFCALSD
Cavia porcellus V1115 trav AAKN02019158.1 107632 GSKEQSVTQTQGQVTLSEKTALTVNCSYETTGYPGLFWYVQYPGEGPQLLLKATKDKEKGSNKGFEAMYDKGTSSFHLKKTSVQASDSAVYYCALS
Cavia porcellus V1117 trav AAKN02019158.1 81244 SSFAQKVTQVQPPVSVEEAEAVILHCTYDTSESRYSLFWYKQPSSGEMVLLIRQNSYDTQNATEGRYSSHFQKAHKSIHLIISASQLEDSAVYFCALSE
Cavia porcellus V1119 trav AAKN02019158.1 17122 GSRAQSVAQPDRHVTVAEGHALMLKCNYTYGATPSLFWYIQRPGQGLQLLLKYLGGSSVVTDNRGFKAEFKKSETSFHLQKSSAQGSDVAMYFCALS
Cavia porcellus V1120 trdv AAKN02019158.1 6977 SSVAQKVTQVQPPISRPEGEMVTLYCSYETTWNFYYLDWYKQLPSGEMVFIISQYSSDSNAKNGRYSVSFQRAAKSIILTISALQMEDSAMYFCA
Cavia porcellus V1121 trav AAKN02019161.1 33096 VRGMQVEQSPPAQILQEGTSFTLSCNFSDSVTNVQWFRQDSEGYLVNLFYVPSGTKKNGRLQATTVPKERCSSLSISSSQLTDSASYFCAAAHSAP
Cavia porcellus V1122 trdv AAKN02019161.1 27567 SSVAQKVTQVQPLTSRAVGETVTLDCSYETTWSSYYLYWYKQLPSGEMLFLIRQYSSDSNAKSGRYSVNFQKAAKSISLTISTIQMEDSAKYFCAIRE
Cavia porcellus V1123 trav AAKN02019161.1 9631 VSSQQKEVEQSPETLSVPEGDTASLNCTFRNSASTNFRWYRQYPGKRPELLISIFSDGDQEEGRFKAQLSRANRRVSLHIGASLSLDSATYFCAV
Cavia porcellus V1124 trav AAKN02019161.1 435 VSSQQKEVEQSPETLSVPEGDTTFLNCTYKDRSSNNFRWYRQYPGKSPELLISIYSDGDQEEGRFKAQLNRANRHISLHIGASQSLDSATYFCAV
Cavia porcellus V1125 trav AAKN02019162.1 45997 RTYGDSVTQTEDQVTVPEETVLTINCTYTATGYPALFWYVQYPGEGPWLLLKATKDKDKGGNKGFEATYNKDTRSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1126 trav AAKN02019162.1 39313 RNNGDSVTQMEGQLILSEKDPLTVNCSYPSSLHPTLFWYVQYPGENLQVFLKATKDKEKGSNKGFEAMYDKGTSSFHLKKASVQASDSAVYYCALS
Cavia porcellus V1127 trav AAKN02019162.1 20022 AVSGDSVIQTEDRMTLFERDSLTVDCSYENTQYPNLFWYVQYPGEGLQLLLKARTANEQGRNKEFEATYDKATGSFHLEKASVKESDSAVYYCALS
Cavia porcellus V1128 trav AAKN02019162.1 9221 VSSQQKEVEQSPDFLRVPEGDSAHFNCTYSNSASQNFGWYRQYPGKGPELLVSIYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHRDSAAYFCAL
Cavia porcellus V1129 trav AAKN02019163.1 31719 LSGGEQLEQHPSFTSVLEGDSSVLNCTYTDSTSSYFYWYKQEPGAGLQLLINIFSNTANKQDGRFIVFLNKKDKHLSLNITSTRPGDSASYFCAA
Cavia porcellus V1130 trav AAKN02019163.1 22974 GRAEQLEQLPSTLRVQEGDTSVINCTYSDSASSYFPWYRQEAGKGPQLIIDIRSNAVSVQKQRLLVSFSKTAKQVSLHITDTQPGDAAVYFCAAS
Cavia porcellus V1131 trav AAKN02019164.1 15132 GRAEQLEQLPRTLRVQEGDTSVINCTYSGSGSFYFPWYKQEAGKGLQLIIDIRSNAARAQKGRLLVSFSKTAKQVSLHITDIQLGDAAVYFCEAS
Cavia porcellus V1132 trav AAKN02019165.1 53676 GRAEQLEQLPRTLRVQEGDTSVISCTYSDSGSSYFPWYKQEAGKGPQLIIDIRSNAVSVQKRRLLVSFSKAAKQVSLHITDIQLGDAAVYFCAAS
Cavia porcellus V1133 trav AAKN02019165.1 37174 TGSLAKTTQPISMDSYEGQEVNLSCIHPNIATNENIIWYRQAHLQGPQFVIQGYKTDVANGVASLFIPKDRKSSTLSLPRVALRDTAVYYCIVAD
Cavia porcellus V1134 trav AAKN02019165.1 28817 LSGGEQVEQHPSFKSVLEGDSSVLNCTYTDSASSYFYWYKQEPGAGLQLLIYILSNTANKQDGRFIVFLNKKDQHLSLNITAAHPGDSASYFCAA
Cavia porcellus V1135 trav AAKN02019166.1 13296 LSGGEQVKQHPSFKSVLEGDTSVINCTYTDSAFSYFYWYKQEPGAGLQLLINIFSNTASKQDGRFIVFLNKKDKHLSLNITAAHPGDSASYFCAA
Cavia porcellus V1136 trav AAKN02019167.1 1235 TGSLAKTTQPISMDSYEGQEVNLSCTHPNIATNEYIFWYRQVHLQGPQFVIQGYKTDVANGVASLFIPKDRKSSTLSLPRVALQDTAVYYCIVAD
Cavia porcellus V1137 trav AAKN02019169.1 10871 VSCQHKEVEQSPETLSVPEGDTTSLNCTYRDSSSYNFRWYRQYPGKGPELLISIFSDGDQEEGRFKAQLSRPNRHVSLHIGASQPLDSATYFCAV
Cavia porcellus V1138 trav AAKN02019170.1 31979 LSGGEQVDQHPSFKNVLEGDSSVLNCTYTDSTFFYFYWYKQEPGAGLQMLINIFSNTASKQDGRFIVFLNKKDKHLSLSITAARPGDSASYFCAA
Cavia porcellus V1139 trav AAKN02019170.1 6475 LKGETQVEQRPRTLVPQEGDIISMSCTYPVSIFKGLLWYRQDEGLGLQHLFSMYSAGDVKQKGRLRATLLKNGSSLSITASEPEDSATYFCAV
Cavia porcellus V1140 trav AAKN02019171.1 17762 TGSLAKTTQPFSMDSYEGQEVNLSCTHPDIATSDNIVWYRQVHHQGPQFVIRGYKTDVANEVASLFIPNDRKSSTLSLPRVALRDTAVYYCIVAE
Cavia porcellus V1141 trav AAKN02019176.1 10891 AVGQSVEQPPELMAMEGTSVQVNCTFQTSGFNGLSWYQQHNGGAPVFLFYNVLDGFQNGSRFFTFFNQSNKLGYLLLRELQMKDSASYLCAVR
Cavia porcellus V1240 igkv AAKN02027962.1 118542 ARCDIQLTQPASASASVGDTVKISCRASQSISNYLHWYQKKPGQAPKLLISYATSLASGVPSRFSGSGSGTDFTLTISGLKPEDFATYHCQQSNSAP
Cavia porcellus V1241 igkv AAKN02027967.1 182655 ARCDIQLTQPASASASVGDTVKISCQASQSVSSLLNWYQQKPGQAPKLLIYWATNLQSGVPSRFSGSGSGTDFTLTISSVNPEDFATYYCQQSKSNP
Cavia porcellus V1242 igkv AAKN02027967.1 76815 ARCDIQLTQPASASASVGDTVKISCQASQSVSSLLNWYQQKPGQAPKLLIYWATNLQSGVPSRFSGSGSGTDFTLTISSLKPEDFATYYCQQSKSNP
Cavia porcellus V1243 igkv AAKN02027971.1 48228 ARCDIQLTQPASASASVGDTVKISCRASQSVSSYLNWYQQKPGQAPKLLIYWATNLQSGIPSRFSGSGSGTDFTLTISSLKPEDFATYYCQQSKSNP
Cavia porcellus V1294 trgv AAKN02032280.1 55499 ALGQLKQPEVVISRATDKSADIPCKASFSGFDNTVIYWYRQKPNEGLQYLLNVKTSTTGVNFDGKKNKFEASKNSGASTSTLKINSLEAQDEAMYYCAYWASS
Cavia porcellus V1295 trgv AAKN02032280.1 49449 GLGQLKQPEIFISKATDKSASISCKGSFSGFGRREIHWFRQKPNEGLQHLLHVWSSTNSVNFGKKNKFEASKNSGASTSTLKINTIEAEDAAMYYCAYWADS
Cavia porcellus V1296 trgv AAKN02032280.1 43322 VLGQLKQPEVVISRATDKSADISCKASFSGFDSTGIHWYRQKPNEGLQHLLHVKTSTARVNFDGKKNKFEASKNSGTSTSTLKINSLEVQDEAMYYCAYWASS
Cavia porcellus V1297 trgv AAKN02032280.1 10058 GLGQLEQPELSISRAPDESVYIPCKASISNFKNVAIHWYRQKSKQGFEHLMYVWTAFNQYPLGGVNKKLEASKNYDTSTSHLKINFLKKEDEATYYCTYWD
Cavia porcellus V1298 trgv AAKN02032281.1 25411 GSQTSSNMDEGLIVMTRSRGSYVEITCIVDTGSSYVHWYQFREGQVPQRLLYYFSRSKAVLDSGVSSEKYNAYRGSGKSSKLVIQNVEESDSAVYYCAAWT
Cavia porcellus V1299 trgv AAKN02032282.1 24220 VSQTSSNMDMGIISITRTPGSTVTITCNLRIGKSYVHWYRFREGQVPQRLLYYDFTSSRAVLDSGFRSGKYSAHQATQDSNKIVVWSVEESDSAVYYCAVWA
Cavia porcellus V1300 trgv AAKN02032282.1 17887 GSQTSSNMDEGMTVMTRSRGSYVEITCSVYTGSRYTHWYQFREGQVPQRLLYYDSSRSKAVLDSGVSTAKYDAYSGSGKSNKFVVRNVEESDSAVYYCAAWT
Cavia porcellus V1301 trgv AAKN02032282.1 14738 GSQTSSNVESGMISLIRKPGSMLTIDCDVPAGKSHVHWYQFQEGQAPHRLLYYDSSSSKAVLDAGVRSGKYSAYQVTQHSSKFVVLDVEESDSAVYYCAVWA
Cavia porcellus V1302 trgv AAKN02032282.1 9767 GSQTSSNMEMGMISVTRTPGSHLTITCDLHTEKSYVHWYRFREGQAPQRLLYYDHSSSKVMLDSGFRPGKYNAYQATWKSNKFVVRNVEESDSGVYYCAIWA
Cavia porcellus V1303 trgv AAKN02032283.1 21207 GLGVTKLEQSQVSVSTQVTKSVDIHCRISSSQFEPETIHWYLQKPNQTLEHLIQITSTRAPAQTKERVMAKKDASTVSSILTINRIQKEDEAVYYCAGWG
Cavia porcellus V1304 trgv AAKN02032284.1 64022 GLGVSNLEQSQISVSTGLNKRVDIHCKISTEGFSQEYIHWYVQKQDQDLEHLIQVVSLTNAAQGKDSRISARKISETVSSILSITRIKKEDEGVYYCAGWV
Cavia porcellus V1333 igkv AAKN02036456.1 101218 ARCDIQLTQPASASASVGDTVKISCRASQSVSSYLNWYQQKPGQAPKLLIYWATNLQSGVPSRFSGSGSGTDFTLTISSLKPEDFATYYCQQSKSNP
Cavia porcellus V1334 igkv AAKN02036457.1 82439 GTCDIQLTQSPSILYASPGDKITITCRASQGISSYLGWYQQKPGNAPELLIYDSYNLYAGVPARFSGSGFGTDFTLTISSLECEDSAIYYCQQ
Cavia porcellus V1335 igkv AAKN02036471.1 123005 TKCDIQMIQSPAFLSASLGDTVTINCWASQDIRKDLAWYQWKPGQAPKLLIYDATNLQSGVPSRFSGSGFGTDYSLTIRRLETEDVATYYCFQE
Cavia porcellus V1336 igkv AAKN02036472.1 49730 IQMTQSPSSIPASIGERVTIRCRASQGINKWLAWYQQKPGKAPKLLIYQANKFESGVPSRFSGSGEGTDFTLTISSLEPEDVATYYCQQHDSIP
Cavia porcellus V1337 igkv AAKN02036472.1 16484 NKCDIQMTQSPSSISASIGERVTISCRASQGINKWLAWYQQKPGKAPKLLIYQANKLESGVPSRFSGSGAGTDFTLTISSLEPEDVATYYCQQYDSSP
Cavia porcellus V1339 igkv AAKN02036479.1 12850 VSGDIVMTQSPATMAVSPGERVTIHCKSSQSLFYSGNNKHLLSWYQQKPGQSPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVADYFCQQFISAP
Cavia porcellus V1340 igkv AAKN02036482.1 15720 VCSDIVMTQSPASLAVTPGESATIHCKSSQSLLYSVNHKNCLAWYQQKPGKSPKLLIFLASTRAYGIPDRFTGSGSGRDFTLTISRVQAEDVADYYCFQTLSAS
Cavia porcellus V1341 igkv AAKN02036484.1 106320 YRGDIRMTQTPLSLSVSPREPASISCSSSQSLLHSNGKTYVYWLVHKPGRDKQGFIYFTATLNSGISDRFSGSGSGTDFTLKISRVEAEDAGVYYCLQA
Cavia porcellus V1342 igkv AAKN02036484.1 99778 STGDIMMTQTLFSWSFDPGETASISCSSSQRLQHSDGKTYLNWVVQKTGQAPTGMIHQVSNQYSGISDRFSGSGSGTDFTLTIIRMEAEDAGVYYCVQA
Cavia porcellus V1343 igkv AAKN02036493.1 58246 STGDVVVTQTPLSLSIAPGEPASISCKASQSLLHSDGKTNLNWVVHKSGQAPRRMIYQVSNRDSWVSDRFSGTGSGTDFSLKISRVEAEDAGVYYCWQG
Cavia porcellus V1344 igkv AAKN02036493.1 41700 STVEVVMTQTPLSVPISPGKQASISCRSTQSHLYSNGKTYLHWVVHKLGQAPQGVIYQVSNGHSGISDRLSESASGTDFVLKISRVEAEDAGIYYCVQDLYIP
Cavia porcellus V1345 igkv AAKN02036493.1 8043 SNGQIVLTQTPASLAAFPGEKVTITCIVRSSVSINYLHWYQQKAGASPKLLIYEKSELASGVPARFSGSGSGTSFSLTISNVEAEDVATYYCQQYSSY
Cavia porcellus V1346 igkv AAKN02036498.1 37010 VCGDIVMTQSPASLIVSPGESATIRCQSSQSLLYSGNNKNLLSWYQQKPGQSPKLLIYWASTRASGIPERFSGSGSGTDFTLTISGAQAEDVASYYCWQGISAP
Cavia porcellus V1347 igkv AAKN02036498.1 4419 VSGDIVMTQSPASLAVSPGERVTIHCKSSQSLFYSGNNKHLLSWYQQKPGQSLKLLIYFASTQASGVPDRFSGSGSGTDFTLTISSLQAEDVADYFCQQGINYP
Cavia porcellus V1348 igkv AAKN02036499.1 14298 VCSDIVMTQSPASLSVTPGESTTIRCKSSQSLLYSGNSKNNLAWYQQKPGQSPKLLIYWASTRDTGVPDRFSGSGSGTDFTLTISSVQAEDVADYYCMQYYDF
Cavia porcellus V1397 ighv AAKN02042638.1 84811 VLSQVQLQESRPGLVKPSQNLSLTCSVSGLSITNSHYWWDWIRQPPGKSLEWMGVISYDDSTGYNPSVKSRISISRDTGKNQFFLQLTSVTTEDTAIYYCA
Cavia porcellus V1398 ighv AAKN02042640.1 15576 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMHWIRQAPGKDLEWVGFIRNAAYSHTTEYAASVKGRFTISRDDSKSTVYLQMTKLKPEDTAVYYCGR
Cavia porcellus V1399 ighv AAKN02042641.1 50359 FLCQLQLQESGPDLMKPSQTLTLTCLVSGYSITSDSTWKWIRQSPGKSLQWMGHIWYDGDTKYNPTLQSRISISRDTGKNQFSLKLNSVTTEDTATYYCGR
Cavia porcellus V1400 ighv AAKN02042641.1 29903 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMYWIRQAPGKGLEWVALIRNADNSHTTEYAASVKGRFTISRDDSKTTVFLQMTKLKPEDTAVYYCAG
Cavia porcellus V1401 ighv AAKN02042643.1 20467 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSNYYMYWIRQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAR
Cavia porcellus V1402 ighv AAKN02042645.1 17192 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSNYYMHWICQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTLSRDDSKSTLYLQMTKLKPEDTAVYYCAG
Cavia porcellus V1403 ighv AAKN02042646.1 61371 VQAEVLLVESGGGLVQSEGSLRLSCVTSGFTFSNYYMHWIRQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAG
Cavia porcellus V1404 ighv AAKN02042646.1 25794 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMHWIRQAPGKDLEWVGFIRNAAYSHTTEYAASVKGRFTISRDNAKSTVYLQMTKLKPEDTAVYYCAR
Cavia porcellus V1405 ighv AAKN02042648.1 51547 VLSQVQLQESGPGLVKPSQSLSITCTVSGFSITTTNYWWHWICQPPGKSLEWLGEISYDGNTKYNPSVKSRLSIARDTGKNQFSLQLTSVTTEDTATYYCAR
Cavia porcellus V1406 ighv AAKN02042648.1 28102 VLSQVQLQELGPGMVKPSQTLSLTCLDSGLSITTSGSYWSWICHPLGKSLEYMGYLHSSGSPNYNPSVKSQFSIFRDIDRKQSSLQLNSVTGEDTATYYCAK
Cavia porcellus V1407 ighv AAKN02042650.1 158042 VLSQVQLQESGSGLVKPSQTLSLTCSVSGFSITTGSYEWSWIRQTPGKSLEWMGYISSNGGTSYNPSFKNRISISRDTGKNQFSLQLNSVNTEDTATYYCAR
Cavia porcellus V1408 ighv AAKN02042650.1 112705 VLPQVQLQESGSGLVKPSQTVSLTCSVSGFSITTTNYWWSWIRQPPGKSMEWMGYIDYIGGTSYNPSLQSRLSISRDTGKNQFSLQLNSVTTEDTATYYCAR
Cavia porcellus V1409 ighv AAKN02042650.1 52891 VLSQVQLQESGSGLVKPSQTLSLTCSVSGFSITTGSYEWSWIRQTPGKSLEWMGYISSNGGTSYNPSFKNRISISRDTGKNQFSLQLNSVNTEDTATYYCAR
Cavia porcellus V1410 ighv AAKN02042650.1 13532 VLSQVQLQESDSGLVKPTQTLSLTCSVSGISITTSYYCWNWMRQPPGKSLEWMGYICYSGSTGYNPSLQSRISVSRDTGKNQFSLKLNSVTTEDTAIYYCAR
Cavia porcellus V1411 ighv AAKN02042651.1 23784 VLSQVQLQESEPSLVKPSQTLSLTCSVSGFSITTSYYYWNWVRQPPGKSLEWMGYIRYDGSTNYYPSFKRRVSISRDKGKNQFSLRLTSVTAEDTATYYCAR
Cavia porcellus V1412 ighv AAKN02042652.1 74711 ILSQVQLQESGTGLVKLSQTLSLTCIVSGFSITTSSYEWHWIRQPPGKSLEWMGAIGSSGGTGYNPSLKSRISISRDTGKNQFSLQLNSVTAEDTATYYCA
Cavia porcellus V1413 ighv AAKN02042652.1 14359 VQSEEQLVESGGGLVQPGGSLKLSCVASGFTFSDYWMSWIHQAPGKGLEWLTYINYDGDSTYYADSVKGRFTISRDNSKNMLYLQMSSLKPEDTAVYYCAR
Cavia porcellus V1414 ighv AAKN02042653.1 27720 VLSQMQLQESGPGLVKPSQTLFLTCSVSGFSITTSGYGWSWIRQPRGKTLEVMGGIAYNGGTGYNPSIKSRISISRDTGKNQFSLQLNSVTEEDTATYYCAR
Cavia porcellus V1415 ighv AAKN02042655.1 12755 VLSQVQLQESGSGLVKPSQTLSLTCSVSGFSITTTNYWWSWIRQPPAKSLEWMGHISYSGSTYYNPSFQSRISISRDTGKNQFSLQLNSLTTEDTATYYCAR
Cavia porcellus V1416 ighv AAKN02042657.1 28841 VLSQVQLQESEPSLVKPSQTLSLTCSVSGFSITTSYYYWNWVRQPPGKSLEWMGYIRYDGSTNYYPSFKRRISISRDKGKNQFSLRLTSVTAEDTATYYCAR
Cavia porcellus V1417 ighv AAKN02042658.1 24418 VQSEEQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMSWIRQAPGKGLEWLTYINPDGGSTYYADSVKGRFTISRDNSKNMLYLQMSSLKPEDTAVYYCAR
Cavia porcellus V1418 ighv AAKN02042659.1 7254 ATAGVQGRLAAVRGSLKFSCVTSGFIFSSYVMSWVFQASVKGLEWISDLSTGGNTYYADSVKGRFTISRDNRKDTLYLQMNSLKTEDTAMYYCGREAVRKH
Cavia porcellus V1419 ighv AAKN02042660.1 410249 AAAGVRAWLVKPSQALSLTCSVSGFSITTSYYGWHWIRQPKGKSPEWMGVIAYNGDTGYNPSLQSRISISRETGKNQFFLKLNSVTEEDTAMYYCAR
Cavia porcellus V1420 ighv AAKN02042660.1 335225 VLSQVQLQESGPGLVKPSQTLSLTCTVTGFSITTSSYYWSWIRQPPGKSPEWMGVIDYDGDTAYSPSLKSRISISRDTGKNQFSLQLRSVTPEDTATYYCAR
Cavia porcellus V1421 ighv AAKN02042660.1 207476 IFCQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYDWAWIRQPPGKSLEWMGYISSGGSTRYNPSLQSRMSISRDTGKNQFSLQLKSVTAEDTATYYCARE
Cavia porcellus V1422 ighv AAKN02042660.1 185167 VQAEEKLVESGGGLVPPGGSLKLSCVASGFTFSSYGMSWVRQAPGKGLEWITSVGTKGNTYYAESLKDRFTISRDNGKNTLYLQMSRLIPEDLAVYYCAR
Cavia porcellus V1423 ighv AAKN02042660.1 44727 IFCQVQLQESGPDLVKPSQTLSLTCTVSGYSITSDYYWAWIRQPPGKGLEWMGYIRYSGSTEYNLSLQSRMSISRDTGKNQFSLQLKSVTAEDTATYYCAR
Cavia porcellus V1424 ighv AAKN02042660.1 5739 VLSQVQLQESGPDLVKPYQALSLTCSVSGYSITSGYSWNWIRQPPGKSLEWMGYISSSGGTGYNPSLQSRISISRDTGKNQFSLQLKSITAEDTATYYCAR
Cavia porcellus V1425 ighv AAKN02042661.1 5083 VLSQVQLQESGSGLVGPSQTLSLTCSVSGFSITTNGYAWGWIRQPPGKSLEWMGHIWYDADTYYNPSIKNRISISRDTGKNQFSLQLSSITTEDTATYYCAR
Cavia porcellus V1426 ighv AAKN02042663.1 128014 VQGAEQLVESRGDLVQPGSSLRLSCMASGFTFSNYDMHWIRQSPGKELEWISVIWYDGSKTYYADSVRGQFTISRDNSKNTLYLQVSSLRPEDMAMHYYCAA
Cavia porcellus V1427 ighv AAKN02042663.1 54456 VLCEEQLVESGGGLVQPGSSLRLSCVASGFTFSSYTMYWIRQAPGKGLEWISYISSSSSNIKYADSVKGRFTISRDNGKNTVYLQMSSLRPDDTAMYYCAR
Cavia porcellus V1428 ighv AAKN02042663.1 51473 VQAEEQLVESGGGLVQPGGSLKLSCVASGFTFSSYDMSWIRQAPGKGLEWISLISSGGSIYYAGSVKGRFTISRDNGKNTLYLQMNSLRPEDTAVYYCAG
Cavia porcellus V1429 ighv AAKN02042663.1 31801 VQAEEQLVESGGGLVQPGGSLKLSCMASGFTFSSYAMSWIRQAPGKGLEWISAIGSSGSNTYYAGSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCAR
Cavia porcellus V1430 ighv AAKN02042666.1 11431 VQDEPQLVESGGGLVQPGGSLKLSCVASGFTFSNAGMHWIRQAPGKGLEWISVIWYDGSKMYYADSVKGRFTISRDNSKNTLYLQMSSLRPEDTAVYYCA
Cavia porcellus V1431 ighv AAKN02042667.1 19490 VQGEAQLVESGGGLVQPGGSLRLSCVAWGFTFSSYAMNWIRQAPGKGLEWISVIWYEGSKMYYADSVKGGFTISRDNGKNTLYLQMSSLRPEDTALYYCAK
Cavia porcellus V1432 ighv AAKN02042669.1 83557 VLSQVQLQESGLGLVMPSQTLSLTCTVSGSSITSGYYWSWIHQIPGKSLEWMGYIYPSRSTSYSPSLQSRISISIDTGKNQFSLQLNSVTAEDTAIYYCAR
Cavia porcellus V1433 ighv AAKN02042669.1 35987 VQGEPQLVESGGGLVQPGGSLRLSCVASGFTFSNSWMDWIRQAPGKGLEWISEIKGDSSTINYIDSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCG
Cavia porcellus V1434 ighv AAKN02042672.1 68015 VLSQVQLQESGLGLVMPSQTLSLICTVSGSSITSGYYWSWIRQIPGKSLEWMGYIYPSSSTSYSPSLQSRISISIDTGKNQFSLQLNSVTAEDTATYYCAR
Cavia porcellus V1436 ighv AAKN02042674.1 2874 VQAELQLVEYGGSLVPPGGSLTLSCVTLEFPFSSYAMGWIRQPPGQGLEWLSLIYHDSSKINYANSVKGRFTISRDNGRNTLYLQMNSLRTEDTALYYCAA
Cavia porcellus V1437 ighv AAKN02042679.1 10941 VHAEEQLVESGGGLVQPGGSLKLSCMASGFTFSTYVMHWIRQAPGKGLEWISYISQTGKNINYADSIKGRFTISRDNEKNTLYLQMSSLKPEDTALYYCAR
Cavia porcellus V1438 ighv AAKN02042680.1 8354 VQAEVQLMESGGGLVQPGGSLRLSCVASGFTFSDYWMSWIRQAPGKGLEWISEIKGDSSTINYIDSVKGRFTISRDNSKNTLYLQMGSLRTEDTAVYYCTT
Cavia porcellus V1439 ighv AAKN02042682.1 35703 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSAGVNWVRQAPGKGLEWIGGIWSGGSTDYNSALKSRVGISRDTSKSQVSLTLRSVSPEDTAVYYCAE
Cavia porcellus V1440 ighv AAKN02042684.1 233845 VQAEEQLVESGGGLVQPGGSLRLSCVASGFTFSNYWMNWIRQAPGKGLEWISEINGDSSTINYIDSVKGRFTISRDNSKNTLYLQMSSLRSEDTAVYYCAT
Cavia porcellus V1441 ighv AAKN02042684.1 190017 VQAEVQLVESGGGLVQPGGSLRLSCLASGFTFSNSWMSWVRQVPGKALEWLTNINGDSSNIKYADSVKGRFTISRDNGKNTLYLQMSGLRTEDTALYYCAA
Cavia porcellus V1442 ighv AAKN02042684.1 153384 VHAEAQLIESGGGLVQPGESLRLSCVASGLTLSNYWTDWVRQAPGKGLEWISAISNSGSTYFADSVKGRFTISRDNVKNTLYLQMSSLRPQDTAVYYCST
Cavia porcellus V1443 ighv AAKN02042684.1 125231 VQAEEQLVESGGGLVQPGGSLRLSCVASGFTFSNYWMNWIRQAPEKGLEWISEINGDSSTINYIDSVKGRFTISRDNSKNTLYLQMSSLRSEDTAVYYCAT
Cavia porcellus V1444 ighv AAKN02042684.1 71491 VQADVQLVESGGGLVQPGGSLRLSCVASGFTFSNYYMYWVRQAPGKGLEWLAAISGDSSNIKYADSVKGRFTISRDNSKNTLYLQMSSLRTEDTAVYYCTR
Cavia porcellus V1445 ighv AAKN02042684.1 45370 VQAEVQLVESGGGLVQPGGSLRLSCLASGFTFSNYGMSWIRQAPGKGLEWISAISDSGASTYYADSVKGRFTISRDNGKNLLYLQMSSLRPEDTAVYYCAR
Cavia porcellus V1446 ighv AAKN02042684.1 2903 VQCEQQLVESGGGLVQPGASLRLSCVASGFTFSNYGMDWFRQTPGKGLEWISYISSNSGTIYYADSVKGRFTISRDNSKSTLYLQMSSLRPEDTAMYYCAR
Cavia porcellus V1500 ighv AAKN02047191.1 6395 VHAEEQLVQSEGGLVQPGGSLKLSCVASGFTFSTYVMRWIRQPPGKGLEWVSSISQTSKKINYADSVKGRFTISRDNEKNTLYLQMSNLKPEDTAMYYCFR
Cavia porcellus V1501 ighv AAKN02047193.1 65851 VQAEVQLVEAGGGLVQPGGSLRLSCVASGFTFSNYYMHWIRQAPGKGPEWLTYISGDSSYIKYADSVKGRFTTSRDNGKNTLYLQMSSLRTEDTAVYYCAR
Cavia porcellus V1502 ighv AAKN02047195.1 11417 VHAEVQLTQSGGGLVQPGESLRLSCVASGSTLSNYWMDWVRKAPGKGLEWISAISNSGSTYYADSVKGRFTISRDNGKNALYLQMSSLRPEDTAVYYCAN
Cavia porcellus V1503 ighv AAKN02047197.1 245339 VLCEEQLVESGGGLVQPGGSLRLSCVASGFSFSTYDMGWIRQAPEKGLEWISLLSYGGGSPDYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTAVYYYCVR
Cavia porcellus V1505 ighv AAKN02047197.1 110511 VHAEVQLTQSGGGLVQPGESLRLSCVASGSTLSNYWMDWVRKAPGKGLEWISAISNSGSTYYADSVKGRFTISRDNGKNALYLQMSNLRPEDTAVYYCAN
Cavia porcellus V1506 ighv AAKN02047197.1 67320 VLCKVRLVESEGGLVQPGGSLRLSCVASGFTFSSYGMDWINQAPRKVLEWISAISSNSKNTYYADSVKGRFTISRDNGKNTLYLQMSSLRLDDTAMYYCAR
Cavia porcellus V1507 ighv AAKN02047197.1 27764 VQAEVQLVESGGGLVPPGGSLRLSCVASGFTFSNYYMHWIRQAPGKGLEWLAYISGDSSNIKYADSVKGRFTISRDNGKNTLYLQMSSLRTEDTAVYYCT
Cavia porcellus V1508 ighv AAKN02047200.1 50527 VQAEVQLMESGGGLVKPGESLRLSCVASGFTFSSYWMNCIRQAPGKGLEWISAIYNDGSSTYYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTAMYYCTT
Cavia porcellus V1509 ighv AAKN02047200.1 40853 VQAEVQLVESGGGLVKPGESLRLSCVASGFTFSSYWMNWIRQAPGKGLEWISAINSDGSSTYYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTAMYYCAR
Cavia porcellus V1510 ighv AAKN02047201.1 39172 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYYMNWIRQAPGKGLEWISMISNDGSSTKYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCAR
Cavia porcellus V1511 ighv AAKN02047202.1 76481 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYYMAWIRQAPGKGLEWITRIGNTGGSTNYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCER
Cavia porcellus V1513 ighv AAKN02047205.1 75268 AAGGVWWRLGAAWGVPETLLCGLCSYGMSWIHQAPGKELEWITYINGDISNINYAALVKGRFVVSRDNGKNTAYLQVNSLRTKDTAMYYCTR
Cavia porcellus V1514 ighv AAKN02047205.1 69304 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSNWYMSWIRQAPGKGLEWIAAISDDSSDIEYANSVKGRFTISRDNNNTLYLQMSGLRPEDTAVYYCA
Cavia porcellus V1515 ighv AAKN02047207.1 21230 VLSQVQLQESGSSLMKPSETLSLTCTISGFPLTRYGVHWVLQAPGKGLEWIGRTGSGGSKNYNSALQSRLRISRYTSKSQVSLRLSSLRPEDWAMYYCAK
Cavia porcellus V1516 ighv AAKN02047207.1 5254 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYEMNWIRQSPGKGLEWISYISSGSGSIYYADSVKGRFTISRDNSKNTLYPQMSSLRAEDTAVYYCAGE
Cavia porcellus V1517 ighv AAKN02047208.1 74729 VLSQGQLQESGPSLVKPSETLSLTCTVSGFSLTSNGFSWVRQAPGKGLEWIGVIANNGGTIYNSALQSRVGISRDTYKSQVSLTLRNLIPEDTAMYYCAR
Cavia porcellus V1518 ighv AAKN02047208.1 37936 VQAEVQLVESGGGLVKPGESLRLSCVASGFTLSNYWMDWVRQAPGKGLEWISAISGGSTYYADSVKGRFTISIDNGKNTLHLQMSSLTPEDTALYYCAA
Cavia porcellus V1519 ighv AAKN02047209.1 61423 VLSQGQLQESGPGLVKPSETLSLTCTVSGLSLTSNAFNWVRQAPGKGLEWIGVIWSGGSTDYNPALKSRVGISRDTSKSQVSLTLSSLSPEDTAMYYCA
Cavia porcellus V1520 ighv AAKN02047209.1 11176 VQAEVQLVESGGGLVQPGGSLRLSCVASGFTFDDYGMSWIRQAPGKGLEWISAISYSGGSTYYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTATYYCAR
Cavia porcellus V1521 ighv AAKN02047211.1 49050 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYSVHWVRQAPGKGLEWIGAIWSDGSTYYNSALKSRVGISRDTSKSQVSLTLSSLSPEDTAVYYCAR
Cavia porcellus V1522 ighv AAKN02047211.1 19822 VLCVVQLVESGGGLVQPGGSLRLSCMASGFTFSNYWMSWIRQAPGKGLEWIAGIDSSSSYIQYAYSVKGRFTISRDNGKNTLYLQMSGLRAQDSAAYYCAR
Cavia porcellus V1523 ighv AAKN02047212.1 8586 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMSWIRQAPGKGLEWITWIRSDGGSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTALYYCAR
Cavia porcellus V1524 ighv AAKN02047213.1 24585 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSVSSYGVHWVRQPPGKGLEWIGVIWSYGSTNYNSALQSRVGISRDTSKSQVSLTLSSLSLEDTAVYYCAR
Cavia porcellus V1526 ighv AAKN02047214.1 11677 VLCEEQLVESGGGLVQPGASLKLSCVASGFTFSSYDMAWIHQAPGKGLEWVTWISYTGGSTKYADSVKGRFTISRDNGKNTLYLQMNSLRSEDTAVYYCAR
Cavia porcellus V1527 ighv AAKN02047215.1 41096 VLCEEQLVESGGGLVQPGASLRLSCVASGFTFSSYYMAWIRQAPGKGLEWVTWISNTGGSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTALYYCVR
Cavia porcellus V1528 ighv AAKN02047216.1 76732 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWIRQSPGKGLEWIAGINDDSSDTQYANSVKGRFTISRDNGKNTLYLQMSGLRPEDTAMYYCA
Cavia porcellus V1529 ighv AAKN02047216.1 44439 VLSQVKLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWVPQAPGKWLEWIGVIWDGGSTDYNSAFKYRVGISRDTSKKQASLTLSSLSPEDKAMYYCA
Cavia porcellus V1530 ighv AAKN02047216.1 28111 VLSQVQKQESGPGLVKPSETLLLTCTGSGFSLSSYHAHWVRQAPGKGLEWIGAIWSGGSTDYNSAFKSRVGISRDTSKSQASLTLSSLSPEDTAVYYCA
Cavia porcellus V1531 ighv AAKN02047217.1 204023 VLCEEQLVESGGGLVQPGASLRLSCVASGFTFSSYYMAWIRQAPGKGLEWVTWIGNTGGSIGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Cavia porcellus V1532 ighv AAKN02047217.1 156120 VLSQVQLQESVPGLVKPSETLSLTCTVSGFSLTNYGVHWIDQAPGKGLEWIGAIWSGGSTDYNSAFKSRVGISRDTSKSQASLTLSSLSPQDTAVYYCA
Cavia porcellus V1533 ighv AAKN02047217.1 110910 VLCEEQLVESGGGLVQPGASLKLSCVASGFTFSSYDMAWIHQAPGKGLEWVTWISYTGGSTKYADSVKGRFTISRDNGKNTLYLQMNSLRSEDTAVYYCAR
Cavia porcellus V1534 ighv AAKN02047217.1 87037 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWICQSPGKGLEWIAGISDDSSDTQYANSVKGRFTISRDNGKNTLYLQMSGLRPEDTTVYYCA
Cavia porcellus V1535 ighv AAKN02047217.1 58608 VLSQVQLQESGPGLVKPSETLSLSCTVSGFSLTSYSVYWVRQAPGKGLEWIGAIWSGGSTDYNSALKSRVRISRDTSKSQVSLTLSSLSPEDTAVYYCA
Cavia porcellus V1536 ighv AAKN02047218.1 33390 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTGYSVSWIRQAPGKGLEWIGAIWSFGSTDYNSAFKSRVGISRDTSKSQVSLTLSSLSPEDTAVYYCA
Cavia porcellus V1538 ighv AAKN02047220.1 182928 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYSVSWVRQAPGKGLEWIGRIWSDGSTDYNSALKSRVGISRDTSKSQVSLTLSSLSPEDTAMYYCA
Cavia porcellus V1539 ighv AAKN02047220.1 134519 VLCDEQLVESGGGLVQPGGSLRLSCVASGFTFSNYYMHWIRQAPGKGLEWISRISSSSSYIDYADSVKGRFTISRDNSKNTLYLQMSSLRPEDTAVYYCTR
Cavia porcellus V1540 ighv AAKN02047220.1 84927 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWVRQAPGKGLEWIGVIWGGGSTDYNSAFKSRVGISRDTSKSQASLTLSSLSPEDTAVYYCA
Cavia porcellus V1541 ighv AAKN02047220.1 71428 VLSQVQLQESGPGLVKPSETVLLTCTASGFSLSSNHAHWVRQATGKGLEWIGAIWSGGSTDYNSAFKSRVGISRDTSKNHVSLTLSSLSPEDTAMYYCAR
Cavia porcellus V1542 ighv AAKN02047220.1 24882 VLCEEQLVESGGGLVQPGGSLRLSCMASGFTFSSYHMSWIRQAPGQGLEWITWIRNDGGSTNYADSVKGRFTISRDNGRNTLYLQMNSLRPEDTAVYYCV
Cavia porcellus V1543 ighv AAKN02047221.1 119761 VLREEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMRWIRQSPGKVLEWIAGINDDSSDTQYANSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCT
Cavia porcellus V1544 ighv AAKN02047221.1 94611 VLSQVQLQESGPGLVKPSETLSLTCMVSGFSLTSYSVSWVRQAPGKGLEWIGRMWSGGSTDYNSAFKSRVGISRDTSKSQVSLTLSSLSPEDTAMYYCA
Cavia porcellus V1545 ighv AAKN02047221.1 44368 VLCQEQLVESGGGLVQPGGSLRLSCMASGFTFSSYHMSWIRQAPGQGLEWITWIRNDGGSTNYADSVKGRFTISRDNGKNTLYLQMNSLRPEDTAVYYCV
Cavia porcellus V1749 igkv AAKN02059258.1 13500 STADVLMTQSPLSLIIAPGEPASMSCRSSQSLLHSDGKIYLSWMVHKPEQAPQGIIYQVSKRESWTPERFSGSGTGTDFTFNISTVEAEDTGVYYCQQGIHTR