WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Fukomys damarensis AYUG00000000.1 (AYUG01) 208 77 15 49 38 17 5 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Fukomys damarensis V1 ighv AYUG01067088.1 103 VQSDVQLVESGGGLVKPGESLKLSCMASGFTFSNYAMHWVRQAPGKGLEWISAISYNSGSTYYADSVKGRFTISRENDRNTLYLQMKNLRTEDTALYYCAK
Fukomys damarensis V33 ighv AYUG01074512.1 1994 VQAEVQLVESGGGLVQPGGSLKLSCVTSGFTFSNYWMHWVRQAPGKGMEWVGRINGNSGTINYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCT
Fukomys damarensis V38 igkv AYUG01076354.1 15278 GRCDIQLTQSPSLSGSLGATVTITCRASQGISNNLHWYQQTPGKAPKLLIRYATTLESGVPSRFSGSGSGTDFTLTISNLQPEDAATYYCQQGYNSP
Fukomys damarensis V39 igkv AYUG01076355.1 3260 GRCDIQLTQSSSLSGSLGATVTITCRASQGISNNLHWYQQTPGKAPKLLIRYATTLESGVPSRFSGSGSGTDFTLTISNLQPEDVATYFCQQSNNYP
Fukomys damarensis V40 igkv AYUG01076355.1 14840 GRCDIQLTQSPSLSGSLGATVTFTCRACQGISNDLHWYQQTPGKAPKLLIRYATTLGSGVPSRFSGSGSGTDFTLTISNLQPEDVATYYCQQDYNFP
Fukomys damarensis V41 igkv AYUG01076355.1 20352 GRCDIQLTQSPSLPASLGATVTITCQASQGISNYLHWYQQTPGKAPKLLIRYATTLESGVPSRFSGSGSGTDFTLTISNLQPEDVATYFCHQSNNYP
Fukomys damarensis V42 igkv AYUG01076355.1 37890 FVAHAVLVQTPASLSTTPGEPVSISCRSSKSLLQTDGYTYLSWFLQKPGQPPKRLMYVVSRLDSGTPDRFSGSGSGTDFTLQISRTEAEDAGVYYCQQL
Fukomys damarensis V43 igkv AYUG01076357.1 8680 STGDIVLTQSPASLTLSSGEKATISCRASQSVDELFGIFKNMHWYQQKPGQPPKLLIYDASNRASGVPDRFSGSGSGTDFTLTIHPVEAQDAAHYFCQQGKELP
Fukomys damarensis V44 igkv AYUG01076358.1 6927 ARCDIQMTQSPYLSAFLGDKVTITCQASQDISKYLNWYQHKPGKAPKRLIYYTSNLDSGVPPRFSGSGSGTDYTLTISSLEPEGVATYYCMQYSSNP
Fukomys damarensis V45 igkv AYUG01076359.1 11293 SNGQIVLTQSPESLAASPGDRVTITCTASSSVSTDRLHWYQKKPGASPKLLVYKTSNLASGVPARFSGSGSGTSYSLTISNVEAEDAATYYCQQWQSY
Fukomys damarensis V46 igkv AYUG01076359.1 38881 ARGDIQVTQSPTSLSAALGATITISCRASEYIGYALSWYQQKPGQGPKLLIKAADELASGVPPRFSGSGSGTDFTLTISSLQPEDVAIYYCLQGYDSP
Fukomys damarensis V47 igkv AYUG01076361.1 5229 SNGEIVLTQSPASLAASPGDRVTITCTASSSVSTSYLHWYQQKPGASPKLLVYSTSNLASGVPAHFSGSGSGTSYSLTISNVEAEDAATYYCQQ
Fukomys damarensis V48 igkv AYUG01076361.1 17040 ARGDIQVTQSPASLSAAVGDTVTTTCKVSEDISYGIHWYQKKSGKAPKQLIYVVDQLRSGVPARFSGIGSGTDFTLTISILQPEDVAVYFCLQGYDSR
Fukomys damarensis V54 ighv AYUG01077812.1 1507 VQAEEQLVESGGGLVPPGGSLKLSCLASGFTFSSYWMGWVRQAPGKGLEWISAINYDGGSTYYADSVKGRFTTSRENGKNTLYLEMSSLRTEDTAVYYCAR
Fukomys damarensis V55 ighv AYUG01077813.1 2245 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYDVSWVRQPPGKGLEWIGVIWDSGNTKYSPALQSRVSIGRDTSKSQVSLSLSGLRSEDTAVYYCA
Fukomys damarensis V56 ighv AYUG01077814.1 12511 VLSQVQLQESGPGLMKPSETLSLTCTVSGFSLTSNGVSWVRQAPGKGLEWIGAIWSGGGTEYNSALQSRVSIGRDTFKSQVSLSLSSLRSEDTAMYYCAR
Fukomys damarensis V57 ighv AYUG01077814.1 32614 AQCEVQLVESGGGLVQPGGSLKLSCLASGFTFSDYWMDWIRQAPGKGLEWLGEINPGSSTTNYAASVKGRFTISRDNAKNTLYLQMNNLRTEDSALYYCST
Fukomys damarensis V68 igkv AYUG01080194.1 196 SNGQIVLTQSPASLAASPGDRVTITCTASSTVSTSRFNWYQQMPGASPKLLVYETSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQTNSYP
Fukomys damarensis V69 igkv AYUG01080194.1 9276 SSREIVLTQSPASLAASPGDRVTITCTASSSVSTSYLQWYQQKPGASPKLLVYSTSNLASGVPSRFSGSGSGTSYSLTISSVEAEDAATYYCHQWYND
Fukomys damarensis V93 ighv AYUG01084207.1 2663 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLSSYNVHWVRQAPGKGLEWIGVIWASGNTKYSPALQSRVSIGRDTSKSQVSLSLRSLRSEDTAVYYCAR
Fukomys damarensis V94 ighv AYUG01084208.1 13099 AHGQVQLVQSGAEMRRPKESVKISCKASGYAFTDYYMYWVRQGPGQGLEWIGGIDPEDGNTEYAQKFQDRVSLTADTSSSTAYMELSGLKSEDTAVYYCE
Fukomys damarensis V95 ighv AYUG01084209.1 709 AQCEVQLVESGGGLVQPGGSLKLSCLASGFTFSDYWMSWIRQAPGKGLEWLGEINPGSSTTNYAASVKGRFTISRDNAKNTLYLQMNNLRTEDLALYYCTR
Fukomys damarensis V96 ighv AYUG01084211.1 6899 VQAEVQLVESGGGLVAPGESRKLSCLASGFTFTDYAMGWVRQAPGKGLEWISYISSSGGSTYYADSVKGRFTISRENGKSTLYLEMSSLRTEDTAVYYCA
Fukomys damarensis V97 ighv AYUG01084211.1 11719 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYGVHWVRQAPGKGLEWIGVIGNGGGTVYNSALQPRVSIGRDTSKSQASLSLRSLRSEDTAVYYCAR
Fukomys damarensis V98 ighv AYUG01084212.1 131 AHGQVQLVQSGAEVKRPKESVKISCKASGYTFTDYYMYWVRQGPGQGLGWTGRINPEDGNTEYAQKFQDRVSLTADTSSSTAYMELSGLKSEDTAVYYCE
Fukomys damarensis V99 ighv AYUG01084212.1 3922 VQCEVQLVESGGGLVQPGGSLKLSCLASGFTFSDYWMNWIRQAPGKGLEWLGDINQGSSTTNYAASVKGRFTISRDNAKNTLYLQMNNLRTEDSALYYCAR
Fukomys damarensis V100 ighv AYUG01084213.1 5544 VLSQVQLQESGPGLVKPTETLSLTCTVTGFSITTGGYGWNWIRQPPGKGLEWMGYINSNGGTYYNPSLKSRISISRNTDKNEFSLQLNSASAEDTAIYFCTR
Fukomys damarensis V115 igkv AYUG01087056.1 25250 PNGQIVLTRSPASLAASPGNRVTITCMASSSVSTSYLHWYQQKPGASPKLLVYSSSNLASGAPTRFSGSGSGTAYSLTISNMEAEDAATYYCHQTNSYP
Fukomys damarensis V116 igkv AYUG01087057.1 7104 SSGQIVLTQSPASLAASPGDRVTIICTASSSVSTSYLQWYQQKPGASPKLLVYGTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQTNSYP
Fukomys damarensis V117 igkv AYUG01087057.1 13369 SSGEIVLTQSPASLAASPGDRVTMTCTASSSVSTSYLHWYQQKPGASPKLLVYTTSNLASGVPSRFSGSGSGTSYSLAISSVEAEDAATYYCHQWYND
Fukomys damarensis V120 ighv AYUG01087752.1 15539 VLSQVQLQESGPGLVKPSETLSLTCTVSRTPITMGGYEWHWIRQPPGKSLEWMGVIYYSGGTAYSSSLNGRISISRDTDKNQFSLQLNSVTTEDTAVYYCGR
Fukomys damarensis V121 ighv AYUG01087752.1 24990 VQSDVQLVESGGGLVPPGGTLKLSCLASGFTFSDYAMHWVRQAPGKGLEWISAISSSSGTIRYADSVKGRFTISRDNNKNTLYLQMSSLRTEDTALYYCAK
Fukomys damarensis V122 ighv AYUG01087752.1 51798 AQAEVPLVESGGDLVQPGESLKLSCEASGFTFSSYWMSWICQAPGKGLEWVGNINTNGGSAYYPDSVKGRFTISRNNAKNTLHLQMNSLRTKDMAMYYCAR
Fukomys damarensis V123 ighv AYUG01087752.1 56539 VLADLTLQESGPGLVKPSQTLSLTCTVRGASIASYAWSWMRKPPGKALQWMGHWAGTTKYDPAFQGRISITVDRAKSQFSLQLNSVTTEDTAVYYCAR
Fukomys damarensis V124 ighv AYUG01087752.1 65133 AHGQVQLEQSGAEVRRPGDSVKISCKASGYRLINYFMNWVQKVPGQGLEWIGSHSSYTGKTNYAQRFRGRVSLTADTSSSTAYMELSGLRSEDTAMYYCA
Fukomys damarensis V125 ighv AYUG01087752.1 80442 VLSQVTLKESGPGLVTPTQTLRLTCSFSGFSLSTTGTRVGWIRQPPGKGLEWLANIDWDDDKYYNSALKSRLTISKDTNNQVSLMMTSMDPADTATYYCARA
Fukomys damarensis V126 ighv AYUG01087752.1 100761 VLSQVTLKESGPGLVTPTQTLRLTCSFSGFSLSTTNMGVGWIRQPPGKGLEWLAHIWWNDDKYYNSALKSRLTISKDTNNQVSLTMTSMDPADTATYYCARI
Fukomys damarensis V127 ighv AYUG01087752.1 105510 VLSDPTLQESGPGLVKPGQTLSLTCTVTGDSVTSSYAWSWIRQPPGKALQWMGYWVGSTYYNPAFEGRISITADTAKNQFSLQLNSVTPEDTAVYYCA
Fukomys damarensis V128 ighv AYUG01087752.1 110446 VHSQIQLLQSGAELKRPGESVKVSCQGSGYTFTDYGINWVKQAPGKGLLWMGWINTQTAKPTYAEGFTGRFTFSLDASVSTAYLQISSLQAEDTAVYYCA
Fukomys damarensis V129 ighv AYUG01087752.1 117450 VLSQVTLKESGPGLVTPTQTLRLTCSFSGFSLSTTNMGVAWIRQLPGKGLEWMANVWWDNDKYYNSALKSRLTISKDTNSQVSLTMTSMDPADTATYYCARR
Fukomys damarensis V130 ighv AYUG01087752.1 124426 ALSDPTLQESGPGLVKPGQTLSLTCTVTGGSVTSSYYWHWIRQPPGKALQWMGWWSGSTNYNPAFKDRISITADTAKNQFSLQLNSVTPEDTAVYYCA
Fukomys damarensis V131 ighv AYUG01087752.1 133483 VLSQVTLKESGPGLVTPTQTLRLTCSFSGFSLSTTGMGVHWIRQPPGKSLEWLSSIYWDDDKYYNSALKSRLTISKDTNNQVSLTMTSMDPADTATYYCARR
Fukomys damarensis V132 ighv AYUG01087752.1 140693 VLCDPTLQESGPGLVKPGQTLSLTCTVTGGSVTTSYGWSWIRQPPGKAVQWMGWWSGSTNYNPAFKDRISITADTAKNQFSLQLNSVTPEDTAVYYCA
Fukomys damarensis V133 ighv AYUG01087752.1 145507 VHSQIQLLQSGAELKRPGESVKVSCQGSGYTFTDYGINWVKQAPGKGLLWMGWINTQTAKPTYAEGFTGRFTFSLDASVSTAYLQISSLQAEDTAVYYCA
Fukomys damarensis V134 ighv AYUG01087752.1 158699 VHAQLQLVQSGAEVRKPGTSVKVSCKASGYSFTSYWMEWVRQSPSRELEWIGEIDPSDGETNYAQKFQGKVTLTADTSSSTAYMELSSLKSEDTAVYYCA
Fukomys damarensis V135 ighv AYUG01087754.1 4111 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVSWVRQPPGKGLEWIGVIWGNGNTEYNSALQSRVSIGRDTSKSQVSLSLRSLRSEDTAVYYCAR
Fukomys damarensis V136 ighv AYUG01087755.1 5205 VQCEVQLVESGGGLVPPGGSLKLSCLASGFTFSNYGMNWVRQAPGKGLEWISYINSDSSYISYADSVKGRFTTSRDNNKNTLYLQMSSLRTEDTAVYYCAR
Fukomys damarensis V173 igkv AYUG01094661.1 19170 STGDVVLTQTPHTLPITPGESASISCRASQSLLHSNGNTYLYWMVHKPGQAPRGLIYQVSNRYSDIPDSFSGSGAGTDFTLRIGRVEPEDAGIYYCYQG
Fukomys damarensis V174 igkv AYUG01094661.1 32602 STGDVVLTQTPHTLSITPGESASISCTASQSLVHSDGNTYLHWMVLKPGQAPRSLIYLVSNRHSGIPDRFSGSGAGTEFTLKISRVEPDDAGVYYCYQD
Fukomys damarensis V198 ighv AYUG01099372.1 662 VLSQVQLQESRPGLVKPTETLSLTCTVTGFSITTGGYSWNWIRQPQGKGLEWMGYINSNGGTNYNPSLKSRISISRNTDKNEFSLQLNSASAEDTAIYFCTR
Fukomys damarensis V199 ighv AYUG01099372.1 9241 VQAEEQLVESGGGLVAPGGSLKLSCLASGFTFSGYAMNWVRQAPGKGLEWISYISNSGGSTYYADSVKGRFTISRENGKNTLYLEMRSLRTEDTAVYYCAT
Fukomys damarensis V200 ighv AYUG01099372.1 13975 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYGVHWVRQPPGKGLEWIGAIWSGGGTVYNSALQSRVSIGRDTSKSQVSLSLSSLRSEDTAVYYCAR
Fukomys damarensis V201 ighv AYUG01099372.1 21733 VQAEEQLVESGGGLVPPGGSLKLSCLASGFTFSSYWMGWVRQAPGKGLEWISAINYDGGSTYYADSVKGRFTISRDNGKNTLYLEMSSLRTEDTAVYYCAR
Fukomys damarensis V215 trdv AYUG01101019.1 5496 AHTQVVQVNDSMYGFIGTDVVLHCSFANPTPTVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVQFLRPSFTDGTIRLSRLELEDEGVYICEF
Fukomys damarensis V285 igkv AYUG01113414.1 28470 SNGQTVLTQSPESLAASPGDRVTITCTASSSISTSGLHWYQQKPGASPKLLVYGTSKLASGVPARFSRSGSGTSYSLTISNVEAEDAAIYYCQQGSSYP
Fukomys damarensis V286 igkv AYUG01113417.1 11497 STGDIVLTQTPASLTVSPGQRATISCRASQSVSAYGIGIMQWYQQKAGQPPKLLIYGASNRASGVPERFSGIASETDFTLTIQSVEAQDAAHYYCEQGKDLP
Fukomys damarensis V311 trdv AYUG01117901.1 1718 KGILCDKLTQSPLDQVVASGNETTLFCTYSTATANSDLFWYRKVPDQPLQFILYRGNSRSLDANFVQGRFSVKHRQKHKTFHLVISPVRIEDSGTYYCALA
Fukomys damarensis V338 trgv AYUG01123781.1 1397 GLGVQKMEQSQISISTEENKRVDIPCKVSTDNFEVEAIHWYRQKQDQALEHLIQVISTTTSAQGQNSRVLAKKDSATQFSTLTIKFVTKEDVAVYYCAGWEGE
Fukomys damarensis V339 trgv AYUG01123784.1 15252 SQISSNWEGRMTSITRRPGSHVAIICDTQVVRKYILWYLFKEGQAPQHLLYYDFLNSWAAVDSEINAQKCSVYVSTEMSSEFLARKVEESDSGVYYCAAWT
Fukomys damarensis V340 trgv AYUG01123785.1 109120 ALGQLEQPEIVISRATDKSASIPCKASTNNFRNVDIHWYRQKPKQEFEHLMYVRTSYNQRPLGGTNKKLEASKNFDTSASTLKINVLKKEDEATYYCTYWD
Fukomys damarensis V405 iglv AYUG01135762.1 3690 SMAQAVLTQPPALSRVSGETAVLTCTGNSNNVGNEGAGWVQLQQQGQSPKTLVNRNNDRLSGIPERFSGTRSGNSASLTITGVQPEDETDYYCAAWDKSQSA
Fukomys damarensis V406 iglv AYUG01135763.1 7709 SSSQPVLTQPLSLSASLEADARLTCTLSSGFVVSGYHISWYQQTSGSHPRYLLRYYSESNRHQGPGVPSRFSGSKDNSANAGVLLISGLQPEDEADYYCLT
Fukomys damarensis V407 iglv AYUG01135764.1 2953 LFLGSLSQPTLTQLPSASASLGQTVKLTCTLSSGYSSYSVDWYQQSQGKSPRFVMRVGSSGIVGSKGDGIPDRFSGSGSGLDRYLTIQDTQQEDENVYYCGV
Fukomys damarensis V408 iglv AYUG01135764.1 17189 VVPQTVVTQEPSASVSSKGTVTLTCGLSSGSVSTGNYPSWYQQNPGQAPYALIYQTNNRPSGVPDRFSGSISENKAALTITGAQPEDEADYYCLL
Fukomys damarensis V409 iglv AYUG01135764.1 26564 SFCQPVLTQSPSVSASLGASVKLTCTLSSEHSSYYIEWYQQHPGKSPRYVMGVYSDGSHNKGHGIPDRFTGSSSGAARYLTIADLQSEDEADYFCGVGDSSG
Fukomys damarensis V410 iglv AYUG01135767.1 10501 SWAQAVLTQVPSVSGAPGETITISCTGSSTNIGSGYAVQWYQQLSGTAPKLIIYNTNSRPSGVSARYSGSRSGNSASLTIRELQSEDEADYHCQTY
Fukomys damarensis V411 iglv AYUG01135771.1 18809 CWAQSALTQPPSASGSPGEKVTLTCIGTSSDIGGYNYVSWYQQLGGTVPKLLIYDVSSRPSGIPDRFSGSKSGNTASLSIAALAPEDEGDYYCASYRSS
Fukomys damarensis V412 iglv AYUG01135772.1 4454 CWAQSALTQPPSVSGSPGEKVTLTCIGTSSDIGGYNYVSWYQQLPGTAPKPLIYSVSNRPSGIPDRFSGSKSGNTASLIISGLAPDDEADYYCFSYAGS
Fukomys damarensis V413 iglv AYUG01135772.1 13912 TRAQSALTQPPSASGSDGQKITITCDGTSSDIGRYDTVSWYQQLPGTAPKLLIYGVSSRPSGIPDRFSGSKSGNTASLSIAALQPEDEGDYYCSSRGYDTL
Fukomys damarensis V414 iglv AYUG01135772.1 19542 SVASYALTQPSSESVSLGQTARITCEGNNIGSSYVQWYQQRPSLAPVLVIYSDNKRPSGIPDRFSGANSGNTATLTITGALAEDEADYYCQVWDSDN
Fukomys damarensis V415 iglv AYUG01135774.1 1698 SVASYVLTQPSSESVSLGQTARITCEGNNIGSKYVQWYQQRPTLAPVLVMYDNKNRPSGIPDRFSGAKSGNTATLTITGALAEDEADYYCQVWDSGN
Fukomys damarensis V416 iglv AYUG01135775.1 1725 SVASYVLTQPSSESVSLGQTASISCEGNNIESKSVHWYQQRPTLAPVLVMYNDKNRPSGIPDRFSGANSGNTATLTITGALAEDEADYYCQVWDSGN
Fukomys damarensis V417 iglv AYUG01135775.1 6480 SMASYILTQPTSVSVSLEQTAMITCSGEALPEKYAYWYQQNPGQTPVLIIYEDSERPSGIPERFSGSSSGTTATLTISGAQPEDEADYYCQSSDSSDTQ
Fukomys damarensis V419 iglv AYUG01135775.1 18215 TAASSKPTQPSPLSVTLGQTASITCEGAEVESYSVNWYQQELGQAPVLIMHLNNIRASGISDRLSGSKLGSTATLTISEVQAEDEAVYYCQVWDFIND
Fukomys damarensis V420 iglv AYUG01135775.1 26320 SMASYKLTQPSSLSVMWGKTARVTCQGHSIRSYTVNWYQLKPGQAPMLIIYYDDSKPSGIPNRFSGSNKVNTATLTISKVQFEDQADYYCQVWDNSDKN
Fukomys damarensis V457 trbv AYUG01143653.1 15587 ARAQTIHQWPTTKVQLVGSPLSLECTMTGKSSPNLYWYRQVAGGALQLLFYSITVGEVLSEVPGNLSASRPQDKQFILSSKNLLLSDSGLYLCAWS
Fukomys damarensis V461 igkv AYUG01145186.1 1321 SRCDIQVTQSPSSHSASVGDTVSIRCKASQGISSSLAWYQQKPGKAPKLLIYGASNLESGVPPRFSGSGSGTDFTLTISSVEAEDAGTYYCQQYYN
Fukomys damarensis V484 trgv AYUG01150930.1 22474 SQMSSGLEGGMMSIARKHGSYVVITCDVLEENNYIHWYLFKAGQPPHHLLYYDFFASKAVVDFGLNPAKYHAYEVTKNSYKFVLRKVEESDSGVYYCAVWA
Fukomys damarensis V485 trgv AYUG01150930.1 37492 GLGVQKMEQSQISISTEENKRVDIPCKVSAGRFENRAIHWYLQKQDQALEHLIQVISTTTSAQGQNNRVSAKKDSATRFSILTIKFVTKEDMAVYYCAMWF
Fukomys damarensis V584 igkv AYUG01076359.1 65652 SRCDIQMTQSPSSHSASIGDTVSIRCKASESISSYLAWYQQKPGKAPKLLIYYASSLESGIPPRFSGSGSGTDFTLTISSVEAEDVGTYYCQQYKSLP
Fukomys damarensis V585 igkv AYUG01076361.1 47028 SRCDIQMTQSPSSHSASIGDTVSIKCKASQSIGSALAWFQQKPGKAPKQLIYGASNLGSEVPPRFSGSGSGTDFTLTISSVEAEDVGTYYCMQASSYP
Fukomys damarensis V586 igkv AYUG01076361.1 23798 SRCDIQMTQSPSSHSASIGDTVSIKCKASQSIDSYLAWYQQKPGKAPKRLIYGASSLGSGVPPRFSGSGSGTDFTLTISSVEAEDVGTYYCLQHYN
Fukomys damarensis V595 ighv AYUG01077622.1 517 VQAEVQLVESGGGLVQPGGSLKLSCVTSGFTFSNYWMHWVRQAPGKGMEWVGRINGNSGTINYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCT
Fukomys damarensis V618 ighv AYUG01082814.1 6540 VLSQVQLQESGPGLVKPAETLTLTCKVTGYSITSGYWWSWIRQPPGKSLEWMGGIYSSGSTSYSPSLKSRMSISRDTGKNEFSLQLNSVTAEDTAVYYCAR
Fukomys damarensis V630 igkv AYUG01087056.1 17770 STGDIVLTQTPASLTVSPGQRATISCRASQSVSAYGIGIMQWYQQKAGQPPKLLIYGASNRASGVPEWFSAIASETDFTLTIHPVEAQDAAHYYCELGKDLP
Fukomys damarensis V631 igkv AYUG01087056.1 6889 SRCDIQMTQSPSSHSASIGDTVSIKCKASQSISSYLAWYQQKPGKAPKLLIYDASSLESGIPPRFSGSGSGTDFTLTISSVEAEDAGTYYCQHGYSNP
Fukomys damarensis V632 igkv AYUG01087057.1 49343 SRCDIQMTQSPSSHSASIGDTVSIRCKASESIGSYLAWYQQKPGKAPKLLIFAASSLESGIPRRFSGSGSGTDFTLTISSLEPEDVGIYFCQQDYS
Fukomys damarensis V633 igkv AYUG01087057.1 31379 SRCDIQMTQSPSSHSASIGDTVSIRCKASQSVGSALAWYQQKPGKAPKQLIYGARNLGSEVPPRFSGSGSGTDFTLTISSVEPEDVGTYYCQQYNSYP
Fukomys damarensis V656 ighv AYUG01091528.1 23024 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTDYGVHWVCQPPGKGLEWIGVIWSGGGTEYNSALQSRVSISRDTSKSQLSLSLRSLRSEDTAVYYCAR
Fukomys damarensis V657 ighv AYUG01091528.1 8158 AHGKGQLVQSGAEVRRPKESVKISCKASGYAFTDYYIDWVRQGPGQGLEWIGGIDPEDGNTEYAQKFQDRVSLTADTSSSTAYMELSGLKSEDTAVYYCE
Fukomys damarensis V658 ighv AYUG01091528.1 4005 AAGGVRGGLVQPGGSVKLSCVASGFTFSNYWMGWVRQAPGKGLEWLGEINQGSSTTNYAASVKGRFTISRDNAKNTLYLQMNLRTEDSALYYCAR
Fukomys damarensis V659 ighv AYUG01091531.1 871 AHGQVQLVQSGTEVRRPTESVNISCKASGYAFTDYYMHWVRQGPGQGLEWIGRINPEDGYTEYAQKFQDRVSLTADTASSTAYMELSGLKSEDTALYYCV
Fukomys damarensis V660 ighv AYUG01091533.1 21274 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSFTDYAVTWVRQPPGKGLEWIGVIGSSGNTEYNSALQSRVSIGRDTSKSQVSLSLSSLRSEDTAVYYCAG
Fukomys damarensis V661 ighv AYUG01091533.1 13379 VQAEVQLVESGGGLVAPGGSLKLSCLASGFTFSDYWMHWVRQAPRKGLEWISHISSGSSTIRYADSVKGRFTISRDNNKNTLYLEMSSLRTEDTAVYYCAR
Fukomys damarensis V675 igkv AYUG01094958.1 70435 SNGQIVLTQSPASLAASPGDRVTIICTASSSVSTSNLHWYQQKPGASPKLLVYRTSNLTSGVPARFSGSGSGTSYSLAISSVEAEDTATYYCQQSSSYP
Fukomys damarensis V676 igkv AYUG01094958.1 58017 ARGDIRVTQSPASLSAAVGDTVTITCRASEDISYGVHWYQKKSGKAPKQLIYVVDQLLSGVPARFSGSGSGTDFTLTISSLQPEDVAVYFCLQGYDSR
Fukomys damarensis V677 igkv AYUG01094958.1 26127 STGDVVMTQTPHTLSITPGESASISCRASQSLVSSSGNTYLHWMVHKPGQAPRGLIYKVSNRYSDIPDRFSGSGASTDFTLKITRVEPDDAGVYYCYQSTYTP
Fukomys damarensis V678 igkv AYUG01094958.1 18782 STGDVVLTQTPHTLSITPGESASISCRASQSLVHSNGNTYLNWMVHKPGQAPTGLIYLVSNRYSGIPDRFSGSGSGTDFTPRISRVEPEDAGIYYCYQS
Fukomys damarensis V679 igkv AYUG01094958.1 5711 SAGDVVMTQTPLTLSITPGESASISCRASQSLVHSNGKTYLNWMVHKPGQAPRGLIYQVSNRYSDIPDRFSGSGAGTDFTLRISRVEPEDAGIYYCNQGTNIP
Fukomys damarensis V702 ighv AYUG01100435.1 14576 VQCEVQLVESGGGLVQPEGSLKLSCVTSGFTFSNYYMHWVRQAPGKGLEWVARIKNKANSYTTDYTTSVKGRFTISRDDSASMLHLLMNSLKVEDTAVYYCTR
Fukomys damarensis V703 ighv AYUG01100435.1 6537 VLSQVQLQESGPGLVKPSETLSLTCKVTGYSITSGYWWSWIRQPPGKSLEWMGYINSNGGTSYSPSLQSRISISRDTGKNEFSLQLNSVTEEDTAVYYCA
Fukomys damarensis V764 igkv AYUG01113414.1 56159 SRCDIQMTQSPPSHSASVGDTVSIRCKASQSISSNLAWYQQKPGKSPKQLIYGASILGSAVLPRFSGSGSGTDFTLTISSVEDEDVGIYYCMQANSFP
Fukomys damarensis V765 igkv AYUG01113414.1 47320 SRCDIQMTQSPSSHSASIGDTVSIKCKASQSIGGALAWYQQKPGKAPKLLIYAASNLRSGVPPRFSGSGSGTDYTLTISSVEAKDVGTYYCLQYYSNP
Fukomys damarensis V766 igkv AYUG01113414.1 18153 STGDIVLTQTPASLTVSPGQRATISCRASQSVSAYGIGIMQWYQQKAGQPPKLLIYEASNRASGVPERFSGSGSETDFTLTIHPVEAQDAAHYYCEQGKDLP
Fukomys damarensis V767 igkv AYUG01113414.1 7234 SRCDIQMTQSPSSHSASIGGTVSMKCKASEGIYSNLAWYQQKPGKAPKLLIYGASNLESGVPPKFSGSGSGTDFTLTISSVEAEDVGTYYCQQYYN
Fukomys damarensis V774 ighv AYUG01115241.1 9022 VQCEVQLVESGGGLVQPGGSLKLSCLASGFTFSDYWMYWVRQAPGKGLEWLGEIDQGGSTTNYAASVKGRFTISRDNAKNTLYLQMNNLRTEDSALYYCTR
Fukomys damarensis V787 trav AYUG01117906.1 64082 ASVAQKVTQTQPEISIQEAATATLDCTYDTADSNYYLFWYKQPPSGQMILVIRQEAYKQQNATEDRFSVNFQKAAKSFSLKISDSELGDTATYFCALM
Fukomys damarensis V788 trav AYUG01117906.1 50646 ISVTQTIIQSQPEISVQEAATATLGCTYDTTENNYHLSWYKQPPDGQMILIIRQEAYKQQNATEDRFSVNFHKAAKSFRLKISDSELGDTATYFCAFA
Fukomys damarensis V789 trdv AYUG01117907.1 41751 PGIVGKITQLHTTITMQEGQAGTLDCIFETKWNVYVLYWYKQLPSRQMVFLIQQEYSQTNVKQNRYSANLEKAKKVVKFTISPLQLTDSAKYFCVLWN
Fukomys damarensis V790 trav AYUG01117907.1 19768 VSSQELQQSQSLVTQEGEDISINCSSSKSLYVLSWYRQKNGGGPVFLMMLQKGGDEKSHGNIVAKLDEKMQQSYLHITAARPSHSGTYFCAGN
Fukomys damarensis V791 trav AYUG01117907.1 7213 VSGQQLNQSPQSIITEEGEDISMNCSFSSTFNYLLWYKQDPGEGLILLITLYKSGESKSNGKRTAQLDGTRKNTFLSIPASKPDDGGTYFCAG
Fukomys damarensis V792 trav AYUG01117908.1 30702 GSGAQSVAQPDRHVTVSEGAPVLLRCNYTYGATPYLFWYVQHPGQGLQLLLKYVAGPSQVKGIKSFEAEFKKSKTSFHLEKASAHWSDAAVYFCALS
Fukomys damarensis V793 trav AYUG01117908.1 11558 IRAQIKVEQRPRVQILQERKSSSIICNYSTSINSMHWFRQSSEGHLISLFYIASGEQQKGRLRATVNFKERHSQLYIRDSQPEDSASYFCAVE
Fukomys damarensis V794 trav AYUG01117914.1 2466 RTHGDSVTQMGGQVILSEHAVLTINCTYTASRYPTLLWYVQYPGEGPQVLLKAMKASEQGSNKGFEATYDKAASSFHLEKASVQESDSAVYYCALS
Fukomys damarensis V795 trav AYUG01117915.1 49246 VSSQQKEVEQSPETLSVPEGAIACLNCTYRDSTSQNFRWYRQYPRKSPEFLVSAYSSGEQEKGRFTAQLNRASRHVSLNIRDSHHSDSAVYLCAV
Fukomys damarensis V796 trav AYUG01117915.1 15232 GSSGDSVIQTKGKVTLSEEAFLTVNCSYETTGFPILFWYVQYPGEGPQLLLKASKDKDKGSHKGFEATYDKATSSFHLEKSSVQESDSAVYYCALG
Fukomys damarensis V797 trav AYUG01117916.1 21385 GVRGAEVEQSPSASIVQEGTNIKLRCNFSITIRSVQWFQQNPGGRLVNLFFMAPGTKRNGRLESTLNSKDRLSTLQITASELGDSGFYLCAAE
Fukomys damarensis V798 trav AYUG01117916.1 8250 RTCGQSVTQMRGQVSTTEGALLTINCTYTASGYPTLFWYVQYSGEGPQLLLKAVTVNEKGRNKGFEATYDKATSSFHLEKASVQESDSAVYYCALS
Fukomys damarensis V799 trav AYUG01117917.1 45715 MNGQQVKQFPQFQHIWEGENFTTYCNSSGILVNLQWYKQKPGGRPVLLMILTKGGEGKKQERLTARYGEKRKDSSLHITATQTTDAGTYFCAV
Fukomys damarensis V800 trav AYUG01117917.1 32730 GSGAQSVAQPDRHVTVSEGAPVLLRCNYTYGATPSLFWYFQPPGQGLQLLLKYMAGPSLVTGIRDFKAEFKKSETSFHLEKASAQGNDAAMYFCAVS
Fukomys damarensis V801 trav AYUG01117917.1 22849 FFSKSSKELSLHIRDSQPGDSATYFCAASTQCSPGMQPAPWYRQLPGKGLELLTYVRSVMNEKEDGKFKVFFSKSSKELSLHIRDSQPGDSATYFCAA
Fukomys damarensis V802 trdv AYUG01117917.1 15185 SSVAQKLTQVQPAISRPEGETVTLDCSYETSLNSYYLCWYKQLPSGEMIFLIYQFSSGSTIKIDRHSVNFQKGIKSISLIISALQFEDSAKYFCALFE
Fukomys damarensis V803 trdv AYUG01117917.1 1407 SSVAQKMTQVQSAESKPEGEAVTLDCSYETTFSSYYLYWYKQLPTGDMIFIIHHRSSESKTAKSGRYSLNFQKVAKSISLTISALEMGDTAKYFCALG
Fukomys damarensis V804 trav AYUG01117918.1 13979 TSMAQKVSQAQTAVSGLEKEAVTMDCVYETSDSAYSLFWYKQPASGEMIFLIRQDSYSEHNATEGRYSLSFQKAARSIRLTITASQLLDSAVYFCALRE
Fukomys damarensis V805 trav AYUG01117918.1 10507 DSVTQREDSVTQMEGRVTLTEGDPLILNCTYQTIYPGPVLFWYVQYVDRGPRLLLKSATENQRAENQGFEATLVKSPSSFHLQKPSLQLADSALYYCALG
Fukomys damarensis V806 trav AYUG01117918.1 5316 VTGVQVEQSPPALILQEGASSTLWCNFSSTAQNIQWFRQDPGRRLVNLFYIPSGTKQNGRLEATTVPKERHSSLHISSSQPTDSATYFCAMAHSAPQ
Fukomys damarensis V807 trav AYUG01117919.1 159225 VRGMQVEQSPPALVLQEGANSTLSCSFSDSVTTVQWFRQDPGGRLVNLFYIPSGTKQNGRLEATTVPKERHSSLHISFSQPTDSATYFCAAT
Fukomys damarensis V808 trav AYUG01117919.1 135265 VSSQQKEVEQSPETLSVPEGAIASLNCTYRDSASQNFIWYRQYPRKGPELLIFMYSSGDKEEGRFKMQLNTASRHVSLHIRGSQHSDSAVYLCAV
Fukomys damarensis V809 trav AYUG01117919.1 125799 VSSQQKEVEQSPESLSVLEGASISLNCTYKSSAFDYFMWYRQFSGKGLVFLMSLYLNGEKKEGRFTMQVNKADQYVSLDIRDSQHSDSATYFCAV
Fukomys damarensis V810 trav AYUG01117919.1 109936 VRGMQVEQSPPALVLQEGANSTLSCSFSDSVTTVQWFRQDPGGRLVNLFYIPSGTKQNGRLEATTVPKERHSSLHISFSQPTDSATYFCAAT
Fukomys damarensis V811 trav AYUG01117919.1 103241 GSGAQSVAQPDRHVAVWEGDPLLLRCDYTYSGTPYLFWYVQYPGQGLQFLLRYMSGDPVVTGIRDFKAEFKKSETSFHLEKASAHWSDTATYYCAVS
Fukomys damarensis V812 trav AYUG01117919.1 90746 LSAEELQQSPEFLSIKEGKDVTMHCNSSSVFPTIQWYRQKPGGGPVFLMALVKGGEVKEQRSMRAQFGEERKSSSLRITTAQPGDSGTYICAG
Fukomys damarensis V813 trav AYUG01117919.1 70649 VSGQQLNQSPQSITVQEGEDLTINCSSSSTFNNFKWYKQDPGEGLILLTTLYQSGELIRSGRLTAQLGGTRKDSFLSIQASKPDDTATYFCAG
Fukomys damarensis V814 trav AYUG01117919.1 55985 GSNEDSVTQIGGQVTLSERTALTVNCSYKTTQYPALFWYVQYPGKGLQLLLKASKDKDKGSHKGFEATYDKDTSSFHLEKASVQESDSAVYYCAVG
Fukomys damarensis V815 trdv AYUG01117919.1 49231 PSVAQKVTQVQPPTFRPEGERVTLDCSYETSWSSYYIFWYKQLLSGEMIFLIRQSSSAATGQNGRYSVRKIGNSMGLTISALQMEDSARYFCALWE
Fukomys damarensis V817 trdv AYUG01117919.1 38436 LSITQKVTQAQPPVSVQEMEAAVLHCIYDTSSTNYVLSWYKQPSSGEMILLILQESYRQQNATKGRYSLDFQKASKSIQLVISASQLEDSAVYFCALRG
Fukomys damarensis V818 trav AYUG01117919.1 25094 VSSQQKEVEQSPETLSVPEGAIASFNCTYKDSASRNFLWYRQYPWKGPEVLIFMYSSGDKEEGRFKMQLNTASQHVSLHIRGSQHSDSAVYLCAV
Fukomys damarensis V819 trav AYUG01117919.1 10286 VSSQQKEVEQSPETLSVPEGAIASFNCTYRDSGAQNLRWYRQYPGKSPEFLLSAYSSGEQEKGRFTAQLNRASRHVSLNIRDSQHSDSAVYLCAV
Fukomys damarensis V820 trav AYUG01117919.1 656 VNSQQGEEVLQSLSVQEGENATLSCSYKTTITNLQWYRQDAGGGPVLLILIRTNEREKHSGRLRAALDTSSKSSSLSIAAARAADSAAYFCATD
Fukomys damarensis V821 trav AYUG01117921.1 15950 VNSQQGEVLQALSVQEGENATISCSYKSSIRNLQWYRQVAGGGPVLLIWMQSNEREKHSGRLRAALDTSSKSSSLSITAARAADSAAYFCATD
Fukomys damarensis V822 trav AYUG01117921.1 2132 WSHGNSVTQTEGPVILPEGAPLVLNCTYQTTYSASFLFWYVQYFHTAPQLLLKTATENQPAENQGFEATLVKSHSSFHLQKPSLQLADSAVYYCALG
Fukomys damarensis V823 trav AYUG01117922.1 18261 GRGEQVEQRPSTLRVQEGDTSVINCTYSDSASTYFPWYKQEPGKGPQLIIDIRSNKQKEQKQRLVVSLNKAAKHFSLHITATQPGDSAVYFCAA
Fukomys damarensis V824 trav AYUG01117923.1 53509 TGSLAETTQPISTESYEGQEVNLTCDHPDIATNEYIFWYRQVHHQGPHFVIQGYKTNGANEVASLFIPQDRKSSTLSLRHVALRDTGVYYCTVGG
Fukomys damarensis V825 trav AYUG01117923.1 48463 HAGAQSVSQADASVTVPEGAPVELRCTFSYGGAVFLFWYVQYPGQGLHPLLKYYSGDTRVQGIKGFEAEYSKSESSFHLRKRSARWSDAAEYFCALS
Fukomys damarensis V826 trav AYUG01117923.1 32511 RTYGDSVTQMEGQITVPEEAMLTINCTYTATGYPALFWYIQYPGEGLQLLLKASKDKDKGSHKGFEATYDKDTSSFHLQKASVQESDSAVYYCAVG
Fukomys damarensis V827 trav AYUG01117923.1 22711 RNDGDSVTQTEGQVVLLEKDSLSVNCSYESLVYPALFWYVQYPGKSLQLLQKSTKDKEKGSKKGFEATYNKETSSFHLEKASVQESDLAVYYCALS
Fukomys damarensis V828 trav AYUG01117923.1 11580 GRGEQVEQRPSTLRVQEGDTSVINCTYSDSASSYFPWYKQEPGKGPQLIIDIRSNKQKEQKQRLVVSLNKAAKHFSLHITATQPGDSAVYFCAA
Fukomys damarensis V829 trav AYUG01117923.1 6045 RVNGDSVNQTEGQVTVFERASLTLNCSYETKQYPNLFWYVQYPGESLQLLLKAMKANDQGRNKGFEATYVTETSSFHLKKASVQQSDSAVYYCALR
Fukomys damarensis V830 trav AYUG01117926.1 1943 VAGQSVEQPTELVAMEGASAQVNCTFQTSGFNGLSWYQQHKGRAPVFVSYDVLDGFQNRSRSSTFLRHSDGYSHLLLKELQMKDSATYLCAVR
Fukomys damarensis V836 ighv AYUG01119220.1 4519 VLSQVQLQESGPGLVKPAETLTLTCKVTGYSITSGYDWSWIRQPPGKSLEWMGYIYSSGSTSYSPSLQSRISISRDTGKNEFSLQLNSVTAEDTAVYYCA
Fukomys damarensis V844 igkv AYUG01120379.1 54771 VLCDIQMTQSASLLYGSVGDTVTIACKASEDIYSSLNWYQQKPGKAPTLLIYAASYLKSGVPQRFSGSESGTDYTLTISSLEPEDVGTYYCQQSYETP
Fukomys damarensis V845 igkv AYUG01120379.1 4135 ARCDIQVTQSPSSLSASQGNRVTITCKASQSISDYLNWYQQKPGKAPKLLIYRASSLESGVPSRFSGSGSGTDFTLTIASLEPEDVGIYHCQQYDSYP
Fukomys damarensis V846 igkv AYUG01120380.1 6119 ALCDIQMTQSPSYLSASLGDTVTITCQASQSVRNYLNWYQQKPGKAPTLLICNTNNLQSGVSSRFSGSGSNTDFTLSISNLEPEDVATYYCLQHNNFP
Fukomys damarensis V847 igkv AYUG01120382.1 117721 ARCDIQMTQSPSSHSASIGDTVTINCRASQDINKYLAWYQQKPGKSPKLMIYRASNLGSGVPARFSGSGSGTDYTLTINSVEAEDVGTYYCQQYYARP
Fukomys damarensis V848 igkv AYUG01120382.1 104206 ARCDIQMTQSPSLHSASIGDTVTITCRASQDINKYLAWYQQKPGKAPKRLIYYASNLGSGVPARFSGSGSGTDYTLTINSVKAEDVGTYYCQQGNSLP
Fukomys damarensis V849 igkv AYUG01120382.1 97302 ARCDIQMTQSPSSHSASIGDTVTINCRASQNVNSWLAWYQQKPGKAPKLLIYKASNLGSGVPARFSGSGSGTDFTLTINSVEREDVGTYYCQQGDTRP
Fukomys damarensis V850 igkv AYUG01120382.1 77268 ARCDIQMTQSPSSHSASIGDTVTINCRASQNVNSWLAWYQQKPGKAPKLLIYRASNLGSGVPARFSGSGSGTDYTLTINSVEPEDVGTYYCQQYDTSP
Fukomys damarensis V851 igkv AYUG01120382.1 66492 ARCDIQMAQSPSSHSASIGDTVTINCRASEDIITKYLAWYQQKPGKGPKPLIYYASILASGVPARFSSSGSGTDYTLSINSVETKDVGTYYCQQG
Fukomys damarensis V852 igkv AYUG01120382.1 58070 ARCDIQMTQSPSSHSASIGDTVNITCWMREDISKYLAWYQQKPKKVPKLLIYRASNLESGVPARFSGSGSGTSFTLTINSVEAEDFETYYCQQYNSYP
Fukomys damarensis V858 igkv AYUG01121850.1 68107 VGGVIILTQTPASLSVSPVETTFISCQTSADVHREIFWIQIKLGQRLEPLISHVTTLASGVPARYSSSGSGTTYVLSISPVEPGDSGEYYCMHDYGWQ
Fukomys damarensis V865 ighv AYUG01122700.1 1859 VQCEVQLVESGGGLVPPGGSLKLSCLASGFTFSNYGMNWVRQAPGKGLEWISYINSDSSYISYADSVKGRFTTSRDNNKNTLYLQMSSLRTEDTAVYYCAR
Fukomys damarensis V892 ighv AYUG01128578.1 12067 VQAEVPLVESGGGLVALGGSLKLSCLASGFTFSNYWMGWVCQAPEKGLEWISSINSNGGSTYYADSVKGRFTISRDNGKNTLYLEMSSLRTEDTAVYYCAR
Fukomys damarensis V893 ighv AYUG01128578.1 7312 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYDVSWVRQPPGKGLEWIGVIWASGNTKYSPALQSRVSIGRDTSKSQVSLSLSSLRSEDTAVYYCAR
Fukomys damarensis V904 ighv AYUG01130248.1 9225 VLSDPTLQESGPGLVKPGQTLSLTCTVTGGSITSYYWSWIRQPPGKAVQWMGNFELGSTEYNPAFKDRISITADTAKNQFSLQLNSVTPEDTAVYYCA
Fukomys damarensis V905 ighv AYUG01130248.1 5016 VLSDLTLQDSGPGLVKPGQTLSLTCTVTGGSVTTSYYWHWIRQPPGKALQWMGSFLLRSTNYNPAFEDRISITADTAKNQFSLQLNSVTPEDTAMYYCAGLG
Fukomys damarensis V906 ighv AYUG01130248.1 683 VLSDPTLQESGPGLVKPGQTLSLTCTVTGGSVTSSYYWSWIRQPPGKALQWMGYWSGSTYYNPAFEGRISITADTAKNQFSLQLNSVTPEDTAVYYCA
Fukomys damarensis V959 igkv AYUG01141569.1 11461 SRCDIQVTQSPSSHSASLGDTVSIRCKASQSIDSYLAWYQQKPGKAPKQLIYYASILHSGVPPRFRGSGSGTDYTLTISSVEAEDVGTYYCLQYDNRP
Fukomys damarensis V960 igkv AYUG01141569.1 3870 SQCDIQVTQSPSFHSASIGDTVSIRCNASQSIGSDLAWYQQKPGKAPKLLIYYASSLASGIPQRFSGSGSGTDFTLTISSVEAEDVGTYYCQQYDS
Fukomys damarensis V972 trbv AYUG01143656.1 6807 PMEAQVIQIPRHLITKTGKSTTVTCSQNMNHDSMYWYRQDPGQGLKLIYYSLNVGMIERGDVPDGFNVSRKEKKSFPLMVDKATTSHTSVYFCASSV
Fukomys damarensis V973 trbv AYUG01143658.1 13777 FSDDEVTQEPRHLVKRNGQSAKMSCVPKEGHNAVYWYHQKQNEELKFLIYFQNKKVVDQIDMAKTRFLTEYTSNSPCSVEIKSSELEDSGLYFCASSQ
Fukomys damarensis V974 trbv AYUG01143658.1 11954 FSDDEVTQEPRHLVKRKGQRAKMSCVPKEGHNAVYWYRQKQNEELKFFIYFLNKEVVEQLDMAKTRFLTEYTSNSPCSVEIKSSELEDSGLYFCASSQ
Fukomys damarensis V975 trbv AYUG01143659.1 82631 FMHAGIIQTPRYCIIRTGKKMTLECSQNMNNYAMFWYRQDPGQGLRLLHYSGSTFSTAKGDAPEGYSATRDENEHFSLTLESASTNQTSMYLCASSE
Fukomys damarensis V976 trbv AYUG01143659.1 69080 LVDASVTQSPSHLIKAKGGKSILKCYPDSGHDSVSWYQQAPGQAPQFLVEYYEMSQRAKGSMPGRFAAQQFDDYHSELNLSALELGDTAVYLCASSL
Fukomys damarensis V977 trbv AYUG01143659.1 66412 HTEAGITQSPRYKVTKTNEKVTLNCHQTNNHDYMYWYRQDPGRGLKLIYYSYEVNRFEKGEVADGYKVSRTNTEEFSLTVDSTSLSQSSVYFCSSSF
Fukomys damarensis V979 trbv AYUG01143659.1 53558 DTNAGVAQTPRHELTKRGQAVTLKCEPVSGHTDLCWYRETVVGRLELLAYFRSRTLINEGEMPKDRFTAQMPDASFSTLKIHPAEPSDTAVYLCASSL
Fukomys damarensis V980 trbv AYUG01143659.1 31728 SLKEEVIQTPGHLVKGKGQNVKMDCVPLKGHNYVYWYQQILKKEFKFLISFQNDKVFDKTGMPKERFLAECPKGYPCSLEIQLAELQDSAVYLCASSE
Fukomys damarensis V981 trbv AYUG01143659.1 16804 IMDGDIIQTPKFQFIEKGKDVTLGCEQNLNHDAMYWYRQDPRQEPRLIYFSQFVSDIQKGDLAEGYTVSREKKELFPLTVTSTQKNQTAIYLCASSM
Fukomys damarensis V982 trbv AYUG01143659.1 6887 FGLCALVSQLPSRAICKSGSSVKIQCRCVDFQATTVIWYRQFPEQSFTRMAISNEGSGVTYETGFERAKFPISHPNLTFATLTVTSTVPEDSSFYFCGAS
Fukomys damarensis V983 trbv AYUG01143659.1 1647 GFGLGALVLQHPSRAICKSGSSVKTECRFVDLQAIAVFWYRQLPKQSLMLIATSNSGSRASYEQDFPEAKFPISHPNQTYSTLTVTSAHPEDSSFYFCGAS
Fukomys damarensis V984 trbv AYUG01143661.1 1234 PGNAGVTQIPKFQVLKIGQHMTLSCTQDLKHESMYWYRQDPELGLRLIYYSYDVNDTKKGDIPDGYTVSRSSSENFPLNLESASPSQTSVYFCASSY
Fukomys damarensis V985 trbv AYUG01143663.1 14763 SVYSRITQIPKSLVTAMGTNRSLKCEQNLGHNAMYWYQQNTKNTLKLMFYYNYKKLIRNETVPNRFTPDNSHSSQLYLHMAALEPEDSGVYLCAT
Fukomys damarensis V986 trbv AYUG01143663.1 13530 HTERGVIQIPSHHVTRLGEMVILSCDPISSHFYFFWYRQTLGQGMEFLVSYSMGKISEKSDIFKDDYSVEKSDGSYFTLKIHPTKLEDSAVYFCASSL
Fukomys damarensis V987 trbv AYUG01143663.1 5135 PMNTRIIQTPRHLVMGTTGKKSLTCEQHLNHNAMYWYKQNANKPPELMFLCNFQKVVQNETVPSRFSPKCTDSSHFYLDLTALEPQDSAVYLCASSQ
Fukomys damarensis V988 trbv AYUG01143663.1 3457 HTEPRVRQTPSHEVTNIGQNVILRCYPISNHQYIYWYRQTAKRGMEFMVYLYNNNTMEKADFFKDRFSAEMPKGSSSILKIQPVQLGDSAMYLCASSL
Fukomys damarensis V1026 ighv AYUG01150531.1 1913 AHGQGQLVQSGAEVRRPKESVKISCKASGYTFTDYYMHWVRQGPGQGLEWIGGIDPEDGNTEYAQKFQDRVSLTADTSSSTAYMELSGLKSEDTAVYYCE
Fukomys damarensis V1027 ighv AYUG01150532.1 16456 VQAEVQLVESGGGLVAPGGSLKLSCLASGFTFSNYWMGWVRQAPGKGLEWISSINSNGGSTYYADSVKGRFTISRENGKNTLYLEMSSLRTEDTAVYYCAR
Fukomys damarensis V1028 ighv AYUG01150534.1 33473 VLSQVQLQEVGPGLVKPSQTLSLTCTISGDTVSSTSATWNWIRQPLGRGLEWLGRTYYRSKWYNEYAPSLQGRLTISPDTSKNEFSLQLSSVGTEDTAVYYCAR
Fukomys damarensis V1029 ighv AYUG01150534.1 27670 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTDYGVHWVRQPPGKGLEWIGVIWSGGGTEYNSALQSRVSISRDTSKSQVSLSLRSLRSEDTAVYYCA
Fukomys damarensis V1030 ighv AYUG01150534.1 10244 VQCEVQLVESGGGLVQPEGSLKLSCLASGFTFSDYWMNWIRQAPGKGLEWLGDINQGSSTTNYAASVKGRFTISRDNAKNTLYLQMNNLRTEDSALYYCAR
Fukomys damarensis V1031 ighv AYUG01150537.1 13526 VLSQVTLKESGPGLVTPTQTLRLTCSFSGFSLSTSGMGVAWIRQPPGKGLEWLANFWWDDTKYYNSALKSRLTISKDTNNQVSLTVTSMDPGDTATYYCARA
Fukomys damarensis V1032 ighv AYUG01150537.1 9765 VLSDPTLQESGPALVKPGQTLSLTCTVTGGLVTSSDSWHWFRQPPGKALEWMGRWWGDPTYNPAFEGRISITADTAKNQFSLQLNSVTPEDTAMYYCAGLG
Fukomys damarensis V1033 ighv AYUG01150537.1 5650 VLSDLTLQDSGPGLVKPGQTLSLTCTVTGGSVTTSYYWHWIRQPPGKALQWMGSFLLRSTNYNPAFEDRISITADTAKNQFSLQLNSVTPEDTAMYYCAGLG
Fukomys damarensis V1034 ighv AYUG01150537.1 2252 VLSDLTLQDSGPGLVKPGQTLSLTCTVTGGSVTNYLWSWIRQPPEKALQWMGSYFLGSTKYNPAFEGGISITADTAKNQFSLQLNSVTPEDTTVYYCW
Fukomys damarensis V1035 ighv AYUG01150538.1 72612 VLSQVEVQQSGPGLVKPSQTLSLTCSISGFSITSSGYWWHWIRQNSQKRLEWMGEIGHDSVTKYNPTLASRITISRDTAKNQVFLRLNSVTPEDTALYYCV
Fukomys damarensis V1036 ighv AYUG01150538.1 28799 AHGQVQLVQSGAEVRSPGTSVKVSCKASGYTFTSYWINWVRQGPGQGLEWIARIYPGDGDTNYAQKFQGKVTLTADTSSSTAYMELSNLKSEDTAVYYCA
Fukomys damarensis V1037 ighv AYUG01150538.1 19883 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYNVHWVRQAPGKGLEWIGVMWSGGGTISNSAFQSRVSIGRDTSKSQVSLSLSSLRSEDTAMYYCAR
Fukomys damarensis V1038 ighv AYUG01150538.1 927 VHGQVQLVQSGSEVRRPTESVKISCKASGYAFTGYYMHWVRQGPGQGLEWIGRIDPEDGNTKYAQKFQDRVSLTADTSSSTAYMELSSLKSEDTAVYYCA
Fukomys damarensis V1039 ighv AYUG01150541.1 70288 VLSQVQLQESGPGLVKPAETLTLTCKVTGYSITSGYYWSWIRQPPGKSLEWMGYINYNGGTSYSPFLQSRISISRDTGKNEYSLQLNSVTAEDTAVYYCAR
Fukomys damarensis V1040 ighv AYUG01150541.1 59627 VQCEVQLVESGGGLVQPGGGSLKLSCVTSGFTFSDYYMEWVRQAPGNVPEWVAVSRNKANSYTTEYATSVKGRFTISRDESINTLHLQMNSLKVEDTAVYYCAR
Fukomys damarensis V1041 ighv AYUG01150541.1 52021 VLSQVQLRESGRGLVKPTETLSLKCTVTGLSITASGYWWHWIRQPPGKSLEWMGYINSNGGTGYSPSLQSRISISRDTGKNEFSLQLNSVTAEDTAVYYCA
Fukomys damarensis V1042 ighv AYUG01150541.1 43205 VQCEVQLVESGGDLVQAEGSLKLSCVTSGFTFSNYYMYWFRQAPGKGLEWVGFIRNKANSYTTEYATSVKGRFTISRDEATSTLYLQMNSLKVEDTAVYYCAR
Fukomys damarensis V1043 ighv AYUG01150541.1 26797 VQAEVQLVESGGDLVQPGGSLKLSCLASGFTFSDFTMHWVRQAPGKGPEWISVISSSSGTIRYADSVKGRFTTSRDNNKNTLYLQMSSLRTEDTAVYYCAR
Fukomys damarensis V1044 ighv AYUG01150541.1 18881 VLSQVQLQESGPDLLKPSETLSLTCKVTGFSITTSGYGWDWIRQSPGKSLEWMGIISYSGGTSYNPSLQNRISISRDTGKNEFSLQLNSVTPEDTAVYYCAR
Fukomys damarensis V1045 ighv AYUG01150541.1 1686 VLSQVQLQESGPDLLKPSETLCLTCKVTGFSITASGYYWSWIRQSQGKSPEWMGYISYSGSTAYSPSLQRRISISRDMAKNEFSLCLNSVTPEDTAVYYCAR
Fukomys damarensis V1046 ighv AYUG01150542.1 9229 VLSQVQLQESGPGLLKPSETLSLTCKVTGFSITTSGYWWSWIRQPPGKSLEWMGHISYSGSTAYSPSLQSRISISRDTGKNEFSLQLNSVTAEDTAVYYCAR
Fukomys damarensis V1103 ighv AYUG01161430.1 23669 VQAEEQLVESGGGLVAPGGSLKLSCLASGFTFSDYAMSWVRQAPGKGLEWISAISYNGGSTYYADSVKGRFTISRENGKNTLYLQMSSLRTEDTAVYYCA
Fukomys damarensis V1104 ighv AYUG01161430.1 18937 VLSQVQLKESGPGVVKPSETLTLTCTVSGFSLTSYDVHWVRQAPGNGLEWIGVIWASGNTKYSPAFQSRVSIGRDTSKSQVSLSLSSLRSEDTAVYYCA
Fukomys damarensis V1105 ighv AYUG01161433.1 5236 VQCEVQLVESGGGLVQPGDSLKLSCLASGFTFSDYWMYWIRQAPGKGLEWLGEIKSDSSTINYAASVKGRFTISRDNAKNTLYLQMNSLRTEDSALYYCSR