WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Erinaceus europaeus AMDU00000000.1 (AMDU01) 163 12 55 7 39 33 5 12
Erinaceus europaeus ANN00000000.1 (AANN01) 141 11 52 4 32 28 5 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Erinaceus europaeus V67 trdv AMDU01021869.1 105837 QGTQGDEVIQGSAAQTVEEGSRVLLLCTYVTGYSNPDLYWYRMRPDGSLQFILYRDNTRSHDADFVQGRFSVQRSGTQKTFHLVISSLKIEDSATYYCALE
Erinaceus europaeus V255 trbv AMDU01081683.1 3042 ASTDTGITQMPKYLVTVKGGKATLKCEQHLGHNAMYWYRQGAQKPPEFMFYYNYQVLLDNNTVPGHFLPACPYSSHLILQVDPMKPEDASVYLCASSR
Erinaceus europaeus V256 trbv AMDU01081684.1 10092 ASMDTGITQMPKYLVMVKAGKATLKCEQHLRHDAMYWYRQSAQKPPELMFHYYYQKLTDNNTIPGRFLPACPDSSHLNLQVDPVKPEDTSVYLCASSK
Erinaceus europaeus V257 trbv AMDU01081684.1 12504 ASMDTGITQMPKYLVTVKAGKATLKCEQHLGHDAMYWYRQSAQKPPELMFYYENRGLLDNNTIPGRFLPACPDSSHLNLQVDPVKPEDTSVYLCASSR
Erinaceus europaeus V258 trbv AMDU01081685.1 2243 PVESEVIQTPKHLVKAPSQAVTLRCSYESGHNYVYWYQQKQGQGPQFMVQYYNGQLNEKGILPALFSVQQKSKNHHSELTVSSLKLEDSALYLCASSI
Erinaceus europaeus V259 trbv AMDU01081685.1 5701 LVETSVMQSPKFQILKTGQETELECGQKMNHNYMYWYRQDPGQGLRLIHFSVGAGVTDKGEVPEGYRVSRPDTESFPLTLESAAPSQTSVYFCASSL
Erinaceus europaeus V260 trbv AMDU01081685.1 8720 QVESEVTQTPKHLIKARRQQVTLNCSYESGHIYVFWYQQILNQGPQLLFLYGDGKEMNKGNASARFSVQQQSNDHRSELTVSSLEPEDSALYLCASSM
Erinaceus europaeus V261 trbv AMDU01081685.1 12377 LLDAGVTQTPTYQILRTGLNVTLECTQDMNHDGMYWYRQDPGHGLRLLHYSVGAGITDKGEVPDGYRVSRPDTESFPLTLESAIPSQTSVYFCASSV
Erinaceus europaeus V262 trbv AMDU01081685.1 23748 PVGTGVTQTPEHLVRARRQPVTLRCFYESGHRSVYWYQQTQGQGPQFMVQYTDMEEMEKGKLPDRFSVQQFKNNHSSELTVSSLDLEDSALYLCASSI
Erinaceus europaeus V263 trbv AMDU01081686.1 58 PVESEVVQIPKHLIKARRQPVTLKCSYESGHYALCWYQQTQAQGLQFLVQYYNGQLNEKGILPANFSVQQFSNDHRSELTVSSLEPEDSALYLCASSI
Erinaceus europaeus V264 trbv AMDU01081689.1 11674 PADSAVTQTPKYVVKAKSQPVTLNCSYETGHFNVFWYQQTLKQGLQFLFRYSDGKEMDKGSTPARFSVQQKSEDHHSELTVSSLELEDSVLYLCASSM
Erinaceus europaeus V265 trbv AMDU01081689.1 14547 MMSAGITQSPKIQILKAGQSVTLGCIQDTENDEMFWYRQDLDHGLRLIHYSVGTGFHGKGEVPEGYHVSRPNITNFPLTLESASPSQTSVYFCASSA
Erinaceus europaeus V266 trbv AMDU01081692.1 2811 LTNAGVNQNPNILLLRKGQNMTLNCTQDLNHDAMFWYRQDPGQGLRLIHYSPVYGSTDKGDVPEGYSVSRSKKEIFSLTVESATPSQTSVYLCASSL
Erinaceus europaeus V267 trbv AMDU01081692.1 8371 LVNGGLIQFPKSQILRRGQRMTLGCFQDMNHNVMLWYRQDLGQGMRLIHYSPGAFYTDKGEVLDGYNVSRPDTILFLLTLESAAPSQTSVYFCASSE
Erinaceus europaeus V268 trbv AMDU01081693.1 856 PVDSEVTQVPKYVVKLRRQPVTLRCSYESGHLSVFWYQQILGQGPEFLAEYFDGQVRDKKTLPVRFSVQQFKNNHSSELTSSSLELEDSALYLCASSL
Erinaceus europaeus V269 trbv AMDU01081694.1 3188 SVDSGVIQTPKYMVKARRQSVTLECSYEPGHLYVYWYQQTQGQGPQFLVQYYDGQERNKEKLPDRFTVQQFKDSYHSKLTASSLELEDSALYLCASSL
Erinaceus europaeus V270 trbv AMDU01081696.1 1642 DSEVIQTPKYVVRARRQPVTLRCSYESGHLSVYWYQQTQGQGPQFLVEYYDGQERNKGKLPAYFKVEQVSKDHRSELTVSSLELEDSALYLCASSL
Erinaceus europaeus V271 trbv AMDU01081696.1 3226 SVGPAVTQMPRYLVKAETQPVTLNCSYESGYLCAYWYQQTQGQGPQFLVHYYDGKDIDKGNVPNRFTFRQLKDHRSELTVSSLELEDSALYLCASSI
Erinaceus europaeus V272 trbv AMDU01081698.1 3366 TGDSGVIQSPRHVIKSRREMVNLNCHPKSGHNTVYWYQQVLGQSLQFLVSYFAKEQGEKGSIPDHFSVQQFDNYSSVLNMKSLEPGDSALYLCASS
Erinaceus europaeus V273 trbv AMDU01081698.1 9662 TGDSGVIQSPRHVIKSRGEMVILNCHPQSGHYTVYWYQQVLGQSLQFLVSYYEKMERDKGSIPDHFSAQQFGNYSSILNMTSLEPGDSALYLCASS
Erinaceus europaeus V274 trbv AMDU01081699.1 6224 SVDPGVIQSPRHVIKGKGEKAILKCSPMSGHSSVSWYQQVLGQGPQFLVSYYEKMEQDKGAIPDRFSAQQLDNYSSEMNMTFLEPGDSALYLCASS
Erinaceus europaeus V275 trbv AMDU01081700.1 7892 QAALLTQNPRYQVVKTGDSVNLSCLQNQKHDVMYWYQQRLNQAPKLLLYYYDDQLNRERDTSEHFQSKRPNSSFCSLEIRSIDLGDAAVYLCASSR
Erinaceus europaeus V276 trbv AMDU01081701.1 3843 SLGEDVAQTPGHLVKGKGQKVSIFCIPVKGHDYVYWYQQIPGKEFKFLISFQKDTVYYEGEIPKERFVAECSASSPCRLKIQSTELQDSAVYFCASSE
Erinaceus europaeus V277 trbv AMDU01081703.1 6121 QGTHVTQNPRYQVVKTGDSVNLSCLQNQKHKVMYWYQQRLNQAPKLLLYYYDDQLNRERDTSEHFQSKRPNNSFCSLEIRSIDLGDAAVYLCASSR
Erinaceus europaeus V278 trbv AMDU01081703.1 11798 SLCAEVVQTPGQLVKGKGQKASVSCVPIKGCDYVYWYQLIPGKEFKFLISFQNEDVLYEGEMSKERFVAECPTGRLEIQSTELQDSAVYFCASSE
Erinaceus europaeus V279 trbv AMDU01081705.1 6118 PTNASVTQNPPHLIRRSGQEATLRCNPEEGHIYVYWYQQLSEGSLKFMAYFRRETPLDESGMPSKRFSAEFPKEGPSTLKIEPTELEDSAAYLCASSL
Erinaceus europaeus V280 trbv AMDU01081706.1 5059 SGLGNLIFQHPSRVLCKNGTSVTIKCSLEGIQGTTIIWYRQLLSQSLTVIATSNMGSNPAYEQGYKREKFSISHPNLTFSDLTVKRVLPEDSSLYFCSAS
Erinaceus europaeus V281 trbv AMDU01081706.1 7511 SSVLGTLVSQHPSRVLCKSKASVVIQCTLVDFQSTTMFWYHQLPNQELTLIASSNTGSTASYEQGFSKEKFLISHPNVTFSSLTVLKVDPKDGSLYFCGAS
Erinaceus europaeus V282 trbv AMDU01081708.1 4740 SGLGELVSQYPSRALCKSGVSVTIQCISVDFQSSIMFWYRQVPSQHLRLIASSNPGSSATYEQGFSKEKFHINHPNLTFSSLMVNNVDPEDSSLYFCSA
Erinaceus europaeus V283 trbv AMDU01081709.1 2395 YGLGAHVLQHPSRALCKSGTSVTFQCTTVDILVPTVFWYRQFPTEGLALIATSNEGSSATYEEGFHKEKFSINRQSQTVTNMTLTNLLPGDSSLYFCGAS
Erinaceus europaeus V284 trbv AMDU01081710.1 7690 SASTEVIQSPRYLVKGKEQKAMMNCVPMKSHVHVYWYHQKLHGELKFLVYLQSEDIIDKTETYVEKFLAKCPKNLPCSLEIKSAEAEDSASYFCASSQ
Erinaceus europaeus V285 trbv AMDU01081710.1 17379 LKDAAVTQSPRHRVIDTEKKLTLQCSQDTDHISMYWYRQDPGGELQLIYYSAGPQSTDKGDASEGYSVSRQDLKNFSLTVESSSPRQTSVYFCASSL
Erinaceus europaeus V286 trbv AMDU01081711.1 5592 PVDAQVTQNPRYLISKPQEKLMINCSQNMDHEVMYWYRQDPGLGPKLIYYSINVNIVANGDSPEGYSVSRTEKKNFPLTLESSNMNQTSVYLCASSL
Erinaceus europaeus V326 trdv AMDU01091112.1 12370 AYTQIVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLNPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Erinaceus europaeus V487 iglv AMDU01133625.1 1122 SWAQSVLTQPSSVSGTLGQSITISCIGNSNNIGKKYVQWYQQPSGTAPKLIIYKNSNRPSGIPERFSGSKSGTTGTLTITGLQLEDEADYYCLTYDSSFSA
Erinaceus europaeus V488 iglv AMDU01133625.1 3161 SWAQSVLTQPSSVSGNLGGRVSISCAGNSNSIGGGNSVQWYQQLPGTAPKTIIYYNDKRPTGVPDRFSGSKSGSSGTLTISGLQSEDEADYYCQSYDDSLSS
Erinaceus europaeus V489 iglv AMDU01133625.1 41511 YLSQSEVTLPPSLSAAPGSTARLTCTLNHDISVGNKNIYWYQQKSEIPPRYLLRYLSESNKHQSSGVPNRFSGSKDASANTGLLLISRLQPEDEADYHCAM
Erinaceus europaeus V490 iglv AMDU01133625.1 55157 SWAQSQLTPSVSGSVGQKVTLTCTGSRSNVGIYGAGWYQQIPGASPKTVMMHTTQPSGISDRFSGSRSGNTASLTISSLQPEDEADYYCSAYDV
Erinaceus europaeus V491 iglv AMDU01133626.1 1304 SWAQFQLTQEASVSGSVGQKVTLTCTGSSSNIGTYGAGWYQQVPGAAPKTVMIGNSRPSGIPDRFSGSRSGNTASLTISSLQPEDEADYYCNTYDDSDYN
Erinaceus europaeus V492 iglv AMDU01133628.1 3014 LLSQPVLSLSATPGSTVLLTCTMSSGFSVGTYGMYWYQQKSGGPPRSILYHFLSLKLGPGVPSRFSGSKDATVNAGILLISGLQPEDEADYYCMMDHDNE
Erinaceus europaeus V493 iglv AMDU01133632.1 4864 SASQKEVIQEPTLSTTPGGTVTLTCGFSIGDVTNLDSVIWIQQNYPQEPRGLLHGANSRAPGVPDRFSGSLFGNKAALTITGAQAEDEAEYYCVMYFSNQ
Erinaceus europaeus V494 iglv AMDU01133633.1 3112 TNSQTVTQESKVSVSLGERVTLSCGLDSGPVTKDHYSNWYQQIPGQPPLRLIYWTDSRPSAVPDRFSGSISENKATLTITGGQLEDEADYYCALYMDSDT
Erinaceus europaeus V495 iglv AMDU01133636.1 3211 THSQTVTQEPSLSVSPGGTVKLTCGLDSGSVTTGYYPAWYQQIPGQTPKLLMYSTNNRPSGVPDRFSGSISGNKAALTITGAQLEDEADYYCNL
Erinaceus europaeus V496 iglv AMDU01133636.1 12936 THSQTVTQEPSLSVSPGGTVKLTCGLNSGSVTSSNYPSWYQQTPGQAPKMLMYYTNKRPSGVPDRFSGSISGNKAALTITGAQIDDEADYYCNLYMGSDV
Erinaceus europaeus V497 iglv AMDU01133638.1 1576 SVVHALLTQPSTVTSFLGQQVSLTCTGNGNNVGYEGAVWVQQYPGQVPKTVMDRNNKRPSGISERFSGSRSGSVGSLTISGIQSEDEADYYCTAWDKSLSA
Erinaceus europaeus V498 iglv AMDU01133642.1 3251 TTSQNVVTQEASLFTTPGGTVTLTCGSSSGAVTTSNYASWVQQHPYQVPRGLIGGTSNRVPGVPARFSGSLLGNKAAFTITGAQAEDEAEYYCALWFSNH
Erinaceus europaeus V499 iglv AMDU01133655.1 278 SWAQADLTQPSSVSGAQGKTITISCAGTSSDIGNYNGVSWYQMEPDKHPKLLIYDVSNRASGIPDRFSGSKSGNTASLSISGLQPEDEADYHCSSYAGS
Erinaceus europaeus V500 iglv AMDU01133655.1 4328 SWAQSALTQPSSVSGAQGKTVTISCAGTSNDIGRYNDVSWYQQEPDRRPKLLIYDVSNRASGVPDRFSGSKSGNTASLTISGLQPEDEADYHCSSYAGS
Erinaceus europaeus V501 iglv AMDU01133656.1 7435 SWAQSALTQPSSVSGVQGQTVTISCAGTRNDIGRNDVVSWYQQEPDKRPKVLIYNVNSRPSGIPGRFSGSKSGNTVSLTISGLQPEDEADYYCGS
Erinaceus europaeus V502 iglv AMDU01133656.1 13484 SWAQSALIKPFPMSGVQGQTVTISCAGTSSDIGSNNYVSWYQQDPDKHPKHLIYYVNKRPSGIPDRFSGSKSGNTVSLTITALQLEDKADYYCG
Erinaceus europaeus V503 iglv AMDU01133656.1 17643 SWAQSALTQPSSVSGAQGQTVTISCAGTSNDIGSHNLVSWYQQEPDKRHKLLIYDVNKRLSGIPDRFSASKSGNTASLTISGLQPEDEANYICGSYRSSYN
Erinaceus europaeus V504 iglv AMDU01133662.1 11363 FVTSSNLIQPSSLSVALGQTAKLTCQGLSNSAQWYQQKPGQAPVQVMYGSSNRPSGIPDRFSGSRSGSTATLTISGAQADDEADYYCQQWDTGAQ
Erinaceus europaeus V505 iglv AMDU01133664.1 3082 SMVSSNLIQPPAMSVALGQTAQITCQGVKYYGHWYQQRSGQAPVMIIYANEDRPSGIPDRFSGSKSGSTATLTITRAQAEDEADYYCQQWDSSTQ
Erinaceus europaeus V506 iglv AMDU01133664.1 10064 FVASFQLTQPSSSSLCLGQTARITCQGIINYHANWYQQKSGQVPVNIIYDISKRPSGVPDRFSGSLSGSTATLTISGAQAEDEADYYCQSFDSSGNL
Erinaceus europaeus V507 iglv AMDU01133665.1 14535 SVVFSELTQPSSMSVAMGQTAKITCQGVNYFTHWYQQKPSLAPVQVIYNSNSRPSGIPERFSGSMSGSTATLTISGAQAEDEADYYCLSSDSSGNY
Erinaceus europaeus V508 iglv AMDU01133665.1 20662 PVVSSVLSQPSSMSVALGQTAKITCQPVYHHTNWYQQKSGKSPVEVIYVSTSRPSGIPDRFSGSVSGKTATLTISGIQAEDEADYHCLSFDSSGNY
Erinaceus europaeus V509 iglv AMDU01133677.1 9011 FCALPVLTQAPSASATLTSSVKLTCILSREHSTYWITWHQQEAEKPPRYLMKVNSDGSHSKGTGIPDRFSGSSSGADRYLSINNIQPEDEADYYCATYDNKYY
Erinaceus europaeus V510 iglv AMDU01133680.1 21558 FCALPVLTQAPSASATLTNSVKLTCTLSSEHSNYYIDWYQQEAEKAPRYLMRVYSDGSHSKGTGIPDRFSGSSSGAARYLSINNIQPDDEADYYCGTNDGNYY
Erinaceus europaeus V511 iglv AMDU01133680.1 30268 SVVSYKLTQPSSMSANLGQTAQLTCGGNNIERKSVHWYQQKPSQSPVLTIYNDNSRPSGIPDRFSGSNSGNMATLTISKVRTEDEADYYCQVWDSNDK
Erinaceus europaeus V512 iglv AMDU01133680.1 44640 HVASSSLTQPSSMSVALGQTAKINCQGVNYYAHWYQQKPGQAPVNVIYGNSNRPSGIPNRFSGSKSGGTATLTITGVQAEDEADYYCQDANDHS
Erinaceus europaeus V513 iglv AMDU01133681.1 12700 SVASSMVTQPSTASVPLTQTVTITCQGEPLKSHYPAWYQQKPDQAPVMIIYGNNKRPSGIPDWFSGTYPDDKSILTISGAQDEGEADYYCAVWDSKDSS
Erinaceus europaeus V514 iglv AMDU01133682.1 3899 SVVSYELTQQRLMSVNLGQTARITCGGNNIGGKYANWYQQKEGQVPVWVMRDSSRPSGIPDRFSGANSGNMATLTITGVLNEDEADYYCGVWDNSDK
Erinaceus europaeus V515 iglv AMDU01133686.1 8917 SVTSSELTQPSAVSVALGQTARITCQGEILREYYADWYQQKAGQAPVLIIYDNNKRNTGISDRFAVTYTEEKSILTTSGVQAEDEADYYCRLFDESYN
Erinaceus europaeus V516 iglv AMDU01133687.1 2363 SVASSKVTQPSIMSVTLGQTARITCQGEPLKTKYGSWYQQKSGQAPVTVIYGKNNRSSEMPDRFSATAPDDKSILTISGAQLEDEADYYCAVWDETDK
Erinaceus europaeus V594 ighv AMDU01158178.1 68815 VHSQVQLTQSGAEVRNPGTSVKLSCKASGYTFTRYYMHWVLQAPGKGLEWMGRINPKTSNTNYAQKFQSRATMTADTSSNTAYMQLSSLSFENTAVYYCVR
Erinaceus europaeus V595 ighv AMDU01158185.1 4885 VHSQVQLTQSGAEVRKPGTSVKVSCKASGYTFTSYYMHWVRQAPGKGLEWIGRIDPEDSNTKYAQKFQGRATITADTSSNTVYVQLNSLRFEDTAVYYCAR
Erinaceus europaeus V596 ighv AMDU01158192.1 781 VHSQIQLTQSGAEVRKPGTSVKVSCKASGYTFTDYHMHWVQQAPGKGLEWMGWVYPKNGNTKYAQKFQGRATMTADTSSNTAYMQLSSLSFEDTAVYYCAR
Erinaceus europaeus V641 igkv AMDU01172935.1 1792 SSGYIVMTQTPLSLSVVPGQSVTNSCRSSHNLLHQSGVSLLDWHLQKPGQQPQSLIHEASKRFTGVSDRFSGSGSGTEFTLTISRVATEDVGVYYCMQGLDLP
Erinaceus europaeus V728 igkv AMDU01203664.1 4413 AKCSIQMTQSPSSLPVSQGETVKISCQAIQSIYNNLHWYQQKVGKAPKLMIFRASNLQSGVPSRFSGSGSGTDYTLTINNLELDDIATYYCQQAYNMP
Erinaceus europaeus V729 igkv AMDU01203667.1 1440 ARCDIQMTQSSSILPASPGDTVRIHCRASQSVINNLHWYQQKPHQAPKLIVKYASQTISGVPSRFSGSGSGTDFILTISNLEPEDTATYYCQQSNSY
Erinaceus europaeus V732 igkv AMDU01203668.1 18224 AICDIQMTQASSILPVSLQGTVSITCRASQDISKWLAWYQQKPGKAPKLLIYEASKLQTGVPSRFSGSGYGTDFTLTINNIEAEDVATYYCEQYNSYP
Erinaceus europaeus V733 igkv AMDU01203670.1 1160 AICDIQMTQASSIMPASLRGTISITCRASQGITNDVAWYQQKPGKAPKLLIYEASSLQTGVPSRFSGSGYGTDFTLTINNLEAEDSATYYCQQYNSYP
Erinaceus europaeus V734 igkv AMDU01203674.1 876 SRGDIVMTQTLPSLSVALGKPASISCRSSQGIQHSNGKTYLNWIQQKPGQSPKLLIYLVSQRQSGVPDRFSGSGSGTDFTLTISKVEAEDVGDYYCMQATELP
Erinaceus europaeus V735 igkv AMDU01203675.1 5203 ARCDIQMTQSPSIHPASPGGRVSINCQASEGISNYLHWYQQKSGEPPKLIVEYASKTISGVPSRFSGSGSGTDFTLTISNLEPEDIATYYCQQGNSYP
Erinaceus europaeus V751 iglv AMDU01208289.1 847 TLSQFTLTQPSSMSGNPGQKVTISCKRSSGNIGSNYVSWYQQYPGSAPRNVIYDDNIRPSGVPDRFSGSIDSSSKAASLTISGLQPEEEADYYCFTG
Erinaceus europaeus V752 iglv AMDU01208291.1 6521 SWAEVVFTQPKSVSGNPGQKVTISCTRSSGNIADNYVYWFQQHPGKAPRMLIYKYDQRPSGIPDRFSGSKDISSNAGHLTISGLQPEDEADYYCLSGYDSY
Erinaceus europaeus V753 iglv AMDU01208292.1 357 SWSQFTMNQPHSVTGNPGQKVTISCTRSSGNIGSYYVHWYQQHPGSTPRNVIYEYDKRPSGVPDRFTGSKDSSSNTASLTISGLQPEDEADYYCQSYESSY
Erinaceus europaeus V754 iglv AMDU01208292.1 19740 TLSQFTLTQPSSMSGNPGQKVTISCKRSSGNIGSNYVSWYQQYPGSAPRNVIYEDNKRPSGVPDRFSGSIDSSSNAASLSISGLQPEDEADYYCQSYDSND
Erinaceus europaeus V755 iglv AMDU01208292.1 25701 ILSQFTLIQPSTMSGNPGQMVTISCKRSSGNIGSKYVHWYQQYPGSAPRNVIYNDNKRPSGVPDRFSGSIDSSSNAASLTISGLQPEDDADYYCQSYDSND
Erinaceus europaeus V756 iglv AMDU01208292.1 32068 TLSQFTLTQPSSMSGNPGQKVTISCKHSSGNIGSYYVHWYQQYPGNAPRNVIYNDNKRPSGVPDRFSGSIDSSSNAAFLSISGLQPEDEGDYYCQSYDSSD
Erinaceus europaeus V757 iglv AMDU01208293.1 873 TLSQFTLTQPSSVSGNPGEEVTIPCIHSSGNIEDNYVHWYQQYPGSAPRNVIYEDNKRPSGVPDRFSGSIDSSSNAASLSISGLQPEDEADYYCQSYDSND
Erinaceus europaeus V758 iglv AMDU01208295.1 421 TLSQFTLTQPSSVSGNPGQKVTISCKRSSGNIGNNYVHWYQQYPGSAPRNVIYNDNKRPSGVPDRFSGSIDSSSNAASLSISGLHPEDEADYYCQSSDSNY
Erinaceus europaeus V759 iglv AMDU01208297.1 3830 SWAQSVLTQPPSVSAATGQSVSITCTGSSTNIGDGYYVYWYQQFQGTAPTLLIYENSKRPSGVPDRFSGSRSGSLGTLTISRLQPGDEADYFCQSYDKSLSA
Erinaceus europaeus V760 iglv AMDU01208551.1 11788 SWTQSVLTQPSSVSRNLGQSITISCTGNSNNVGHSHEAKYVNWYQHLAGMAPKLLIYETTKRYSGVPDRFSGSRSGNTASLTITGLQSEDAADYYCFVGDVSLS
Erinaceus europaeus V778 iglv AMDU01225529.1 2195 SWSQSTLSQPPSVSRSLGQTVTISCDGSSNDIGYYSSGVSWYRKDPGTAPKLLIYGTTSRPSEIPSRFSGSKSGNTASLTISGLQSEDETEYYCCSYTSS
Erinaceus europaeus V855 trgv AMDU01020741.1 34331 TRLITQLRISIVKRKGNTAFLECQIKSNAFKNNMYIHWYRQKPDEPLQRILYISSNENVVHEHGVSEDRYEAKKGQADLPASLRIHRVNEEDAGLYYCACWD
Erinaceus europaeus V856 trgv AMDU01020748.1 16454 GLGQFRLEQPEISVSKERGKSALISCKMLTGDFSNKWIFWYQQKPDQNIEYIMYVYSVTTPNQLTVGGKNKYEARKNSRTSTSTLKINFLEKGDEATYYCASWVN
Erinaceus europaeus V857 trgv AMDU01020748.1 2936 SQAAITLEQPLAVLGRRGSSAILPCTVHTKVSYIHWYRHQEGRAPERLLVMAMLKSDVRWDSVLKADKVTAMESKDGSSCTLSVLRLEKNDEGRYYCAAWY
Erinaceus europaeus V858 trgv AMDU01020751.1 15305 SQLTFNLEGRKASITRQTGSSVVITCGVLAQTITYMHWYKYQEGEAPERLLYYDFSKSKFVVESGIISGKYHAYKFTENSCKFVIRNLDRNDIGVYFCAAWD
Erinaceus europaeus V859 trgv AMDU01020751.1 11467 SQAAVTLEQPLAVLGRRGSSAILPCTVHTKVSYIHWYRHQEGRAPERLLVMAMLKSDVRWDSVLKADKAVVNKAKDGSSCSLSVLRLGKQDEGRYYCAAWV
Erinaceus europaeus V863 trdv AMDU01021870.1 8531 ALLDIILEPNTKSLTVLVGEPTTFRCSITGGDLKNYQMSWYKKSEDNTLTPVYRLSHSSKDNSKTSFKGKIDTLKSQYVLDIPKTTIKDAGTYYCGSD
Erinaceus europaeus V864 trdv AMDU01021874.1 3307 SGSTNSITQSTSTVYKQAGDSVIMDCTVTVSYTYYMMYWYRQLSSGEMIHLINIHSENVDSRVGRYTLKFQKRNKHLQLTISNLTPKDTAVYFCAASN
Erinaceus europaeus V865 trav AMDU01021875.1 26871 GANDKNGAEQRLQYLSAREGESVTVNCSYTVGMTTLHWFRQNPGGSMVRLFILSLEMKEEGRLRVLINTEERLSTLHITASQPSDSATYLCAMK
Erinaceus europaeus V866 trav AMDU01021876.1 12628 LSGMMQVRQSPLTLSIQEGEGGTIYCNYSNTASDRLYWYRQDPGKGLESLFFLVSRGVVKKERQLSASLDTRASFSTLHFTSSLPGLSATYFCA
Erinaceus europaeus V867 trdv AMDU01021877.1 15666 SLMAQTVTQLQLEMSVRETETVALDCTYETSDSDYYLFWYKQLPSGKLIFVIRQESFKQEKAKENRFSVQFHKADKSFQLKISASQLKDSAMYFCAYRR
Erinaceus europaeus V868 trav AMDU01021877.1 7014 SLMAQTVTQPQPETSVQEAKTVTLNCTYDTSESSYYLSWYKQPPTGELILILRQESFKQENAEDNRFSVNFQKANKSFQLRILYSQLEDAAIYFCAYMR
Erinaceus europaeus V869 trav AMDU01021878.1 27594 VSGQQQLSQSPLSVSIEEGEGISLNCNSSSVLNLLLWYKQVAGKGPVLLFSLYKPRDSAMTTNGNLIAKLDEARKDSSLSISAAELEDSGTYFCAG
Erinaceus europaeus V870 trav AMDU01021878.1 15848 PGRANWIRPQKTQVWETERQIANLLCDYSISSTSFVDLYWYRQYPNQPLEFILYKGWGYSGKGEAPFAKARFYSQTTEKTTSLYIPRLEFADSALYYCALRV
Erinaceus europaeus V871 trav AMDU01021879.1 29522 TMSDAKTTQPGSLQSTEGETIFLHCEYSTISGAEYIYWYRQIHHRGPEYLIHGFKTNESNAVASLVITTDRKSSTLVLPQVTVRDSAVYYCIVRE
Erinaceus europaeus V872 trav AMDU01021879.1 21086 VMADAEVTQPSSVQSNEGDLVRLPCEHSTISTADYIHWYRQIPHNSPEYLIHSLRTNETRGRVSLIMAPDRKSSTLVLPQVTMRDSAVYYCTVRE
Erinaceus europaeus V873 trdv AMDU01021879.1 18998 FSMATKVTQIQTPITRKEGEAVTFHCSYEISWNSYSLYWYEQTPTGQMFFLIYQDYNKPNAKQGRYSVNFEKEKGSIRLTISPLKLKDSAKYFCALW
Erinaceus europaeus V874 trav AMDU01021879.1 13097 VTGDTKTTQPNSLQGTEGELVHLPCEHSTIGGNEYIFWYRQILHEGPEYLIHSLISNVTNAMTSLVITRDRKSSTLVLPQVTVRDSAVYYCIVRE
Erinaceus europaeus V875 trdv AMDU01021879.1 5074 FSLAQKVTQAPIRISGQERAAVTMECMYETQLDYYILYWYKQYPSGQMDFLLYQVNTEPNKRSGRYSVNFEKAEKYISLTISSLQLEDSAKYFCALR
Erinaceus europaeus V876 trav AMDU01021879.1 459 MVSDAKATQSNSLQSPEGEPAHLPCEHSTISSNEFIYWYQQMHHKGPEYLIHGLKSNVTNSMASLIITTDRKSSTLILPHVTIRDSAVYYCTVME
Erinaceus europaeus V877 trav AMDU01021880.1 5164 VRTQEVEQSPQSWNIGEGEDVTIYCNSSKTLYSLHWYRQKHGEGPIFLIMLQKGGDKKKQGNIAATVNDKMQQSSLHIKASQSSHSGTYFCGVE
Erinaceus europaeus V878 trav AMDU01021882.1 11749 TEVQMKVDQRPGVLILQEGQTSSLTCNSSYMASVQWFQQKSGGPLESLFFLASGTQQKGRLKCTANVREYWSHLDIRDAQPGDSATYYCAMQ
Erinaceus europaeus V879 trdv AMDU01021883.1 36767 FIVAESITQAQSAISRQEGLPVTFDCQYETSWSLYSIFWYKQLASGEMIFLISQHSSQQSSYKGRYSLNFQKEQKTVSLTILPLKLGDSSKYFCALG
Erinaceus europaeus V880 trdv AMDU01021883.1 31716 SSVAQSVTQAKSAMSWQEGKEVTLHCQYETRMRTFYIFWYKQLANRELIFLISLRSTAQNANNGRYFINWLKTRKTSQFIISPVELQDSGRYFCALWE
Erinaceus europaeus V881 trav AMDU01021883.1 17768 MNGQQVYQIPQFQLVKEGMNFTVYCNSSSTFNSLHWYKQSPSGNPVFLMMLVSSGEVKKKARWTGQFGKDRKDGFLHITATQPADVGTYFCVQ
Erinaceus europaeus V882 trav AMDU01021883.1 5386 GAEAQSVTQPDGLITVSEETSVEMKCNFSYTGTPYLYWYVQHPNQELQLLLRYFSGNTQVQGISGFEAEFKKDENTFHLKKSPVHQSDSARYFCALS
Erinaceus europaeus V883 trdv AMDU01021885.1 7285 SSVAQSVTQSPWTLSRQEGTEVTLDCRYETSWSSYYIYWYKQLASGEMIFLIRQHSYEQDAIKGHYTVKLQIAAKTIRFTIFPLKLEDSAKYFCALCD
Erinaceus europaeus V884 trav AMDU01021887.1 1054 KSDRQQVKQSPSLWRVREGETAILNCTYENTAFDFFPWYKQYPGKGLTFLKGILSTKTKEEEGKFIVFLNKGEKLFSLHIKDAQPGDSATYFCAAR
Erinaceus europaeus V885 trav AMDU01021889.1 8155 GAGAQSVTQPDRHVPVSEGTLMELRCNYSSSVPPALFWYMQKPTKGLQLLLKYVSGSNLVKGISGFEAEFKKSETSFHLKKHSAHLSDSALYFCAVS
Erinaceus europaeus V886 trav AMDU01021889.1 5910 VKGVQVEQRPPTWSLQEGASSTTLWCNFSTSVSNVQWFRQNPEGRLVSLFYIPSGTKEDGRLTATTVAKERHSTLTITSPQITDSAIYFCAVD
Erinaceus europaeus V887 trav AMDU01021890.1 10407 LNGEDQVVQSPQTMSIQEGNSLSLNCLYKVSGFRALQWYRQDPGRGPTLLFILYSVEEKRQKERLKATLSKEGSSLNITDPRPEDSATYLCAVE
Erinaceus europaeus V888 trav AMDU01021890.1 4453 VSSKQEVNQNPDALDVHEGNNTVLNCTYTDSGIYSLQWFRHDPGKGLISLFFLQSSQAEKDSGRIRVTLDKSSRQSSLYIAAAQSSDSTTYLCAV
Erinaceus europaeus V889 trav AMDU01021894.1 890 SSMTQTVTQTQPTVSILEKDDVTLDCTYETSSYSYYLFWYKQPPSGEMMILIRQESFSEQNATKDRYSLNFQKTARSISLTITASQLGDSAVYFCALSD
Erinaceus europaeus V890 trav AMDU01021895.1 1005 TKGDSVTQTEGTVTLSENKPLVLNCSYQTSYSSPFLFWYVQYLHKAPKLLLKSSTESDRTESQGFHASLVKSDKTFHLQKPSAQTSDSAVYYCAMR
Erinaceus europaeus V891 trav AMDU01021902.1 18290 GGAEAQSVTQLDGHITVSERASMELRCNYSYGVTPYLFWYVQYPRGGLQLLLKYLSGDPLVKGIRGFEAEFKKSETSFHLKKSSAQLSDQALYFCAIR
Erinaceus europaeus V892 trav AMDU01021902.1 14860 GAGAQSVTQSDGQIRVSEGASLELRCNYSYSVTPSLFWYVQHPKGGLQLLLKYFSGDPLVKGIRGFEAEFKKSETSFHLKKSSAQLSDRALYFCAIS
Erinaceus europaeus V893 trav AMDU01021902.1 6452 GRAQKVTQPEAHISVTEAAPVQVKCNYSYSGSPELFWYVQYPKQGLQLLMKHFSRESVKGFTAELNKGETYFHLKKVAVQKEDSAMYYCALR
Erinaceus europaeus V894 trav AMDU01021902.1 3036 LSSQQEEQNLQTLTVQEGQDALVNCSYKGSITYLKWYRQDSGRGLTMLVSILSNEKKKTYGRLEVTLDISSQKSSLLITTSQGADAATYFCAVD
Erinaceus europaeus V895 trav AMDU01021903.1 1542 TSGQQRGVEQSPGPLGVQEGATVSLQCTYSDRASQYFAWYRQCSGKGPELLVYFYSREDEVEGRFTAKINKTSQSISLLIKDTQPRDSATYLCAV
Erinaceus europaeus V896 trdv AMDU01021905.1 4625 ISVAQKVTQALPTTSAQEKEDVVLNCTYDISNNIDSYSVFWYKQPSSQEMIFLIRQDSYSQENATEGRYTVDFQKASKSINLVISASQLEDSVLYFCALR
Erinaceus europaeus V897 trav AMDU01021907.1 4546 GVRGMKVEQSPSHLSLQEGDSPTLRCNFSTTARSVQWFRQNPGGGLTSLFYTAAELKQAGRLSARLNSKELSSSLHIEASQLEDAATYLCAVE
Erinaceus europaeus V898 trav AMDU01021907.1 2689 LSLAENVKQHSSVLNIQEGDDAVINCSYSDSASYYFLWYKQEPGRGPQLIIDIRSNSNRNEAGRLTVLLNKETKDLSLCIAATQPGDSAVYFCAA
Erinaceus europaeus V899 trav AMDU01021908.1 1252 VSGQQLSQSPPSVSIKEGVSISVNCNSSSTVTQLLWYKQVAGKGPVLLFSLYKPGDSATTTNGNLIAKLGEARKDSSLSISAAELEDSGTYFCAG
Erinaceus europaeus V900 trav AMDU01021909.1 3269 MMNDAKTTQQSSLQSTEGERVHLPCEHSTIGGNEYIYWYRQMHHKGPEYLIRGLKTNGSNDMVFLAITTDRKSSTLILPQVAMRDSAVYYCMVAD
Erinaceus europaeus V901 trav AMDU01021915.1 5347 TMCDAKTTQPSTMQNIEGETVFLHCEHSTISGAEYIYWYRQILHKGPEYLIHSLRTNETKGRVSLIMAPDRKSSTLVLPQVTVRDSAVYYCILR
Erinaceus europaeus V902 trav AMDU01021920.1 17773 GVGAQSVTQPDSHITVSEGALLKLRCNYSSSVSPYLFWYVQYPKGGLQLLLKYLSGDPLVKGIRGFEAEFKKSETSFHLKKSSAQLSDRALYFCAIS
Erinaceus europaeus V903 trav AMDU01021921.1 33407 GAGAQSVTQPDGHITVSEGDSLELKCNYSSSYSVSLFWYVQYPRGGLQLLLKYLSGDLLVKGIRGFEAEFKKSETSFHLKKSSAQLSDQALYFCAIS
Erinaceus europaeus V904 trav AMDU01021921.1 30639 VSCQQEEEKFQTLIVQEGEDALVNCSYKGTITYLQWYRQDSGKGLSMLVLIRSNEKKKPSGRLEVTLDTSGQESSLLIRASHAADAATYFCAVD
Erinaceus europaeus V905 trav AMDU01021921.1 16926 TNGDSVTQTEGTVTLSENNPLVLNCTYQTTYATPVLFWYVQYLSKGPQLLLKSSTDNQRVELQGFNARLLKGDSTFHLWNPSVRTSDSAVYYCALG
Erinaceus europaeus V906 trav AMDU01021924.1 13674 QVHGDSVTQMGGQLTVSEKASLTVNCTYSASGYPALFWYIQYPGEGLQLLLKAQTDKAKGTNKGFEATYDKETSSFHLKKVSVQESDSAVYYCAMS
Erinaceus europaeus V907 trav AMDU01021924.1 6253 TSGQQRGVEQSPGPLGVLERATVSLQCTYSDRASQYFAWYRQCSGKGPELLVYFYSREDEVEGRFTAKINKTSQSISLLIKDTQPGDSATYLCAV
Erinaceus europaeus V908 trav AMDU01021924.1 364 GAGAQSVTQPDGHITVSEGDSLELKCNYSSSYSVSLFWYVQYPRGGLQLLLKYLSGDLLVKGIRGFEAEFKKSETSFHLKKSSAQLSDQALYFCAIS
Erinaceus europaeus V909 trdv AMDU01021926.1 2117 YSIAQTVTQDQPEMLMQKGNVTLHCTYDTSSTSYSLLWYKQPSSGEMILLIRQDSYNQANVTEGRYTVDFQKASKSINLVISASQLEDSALYFCALR
Erinaceus europaeus V910 trav AMDU01021927.1 6293 GAGAQLVTQPSGPITVSEGASLELRCNYSYGATPYLFWYIQYPNQGLQLLLKYVLKETLVKGIKGFEAEFKKDETTFHLKKQSAHWSDSAWYFCALS
Erinaceus europaeus V911 trav AMDU01021932.1 23817 ADGQSVEQPSELMALEGSFVQVNCTYQTSGFNGLAWYRQHKGGAPVFLTFNVLDGLDTRGHFPSFLSRSDAYSYLLLQGLQMKDSASYFCAVR
Erinaceus europaeus V1127 trbv AMDU01081721.1 24146 VRAQSIHQWPPTQVQPVGSPLSLECTLKGTSNPNLYWYRQPIGGVLQLLFYSLGVNQTESEAPQHFSASRPQDGQFILASQKLLLSDSGAYFCAWS
Erinaceus europaeus V1363 ighv AMDU01158246.1 6248 VLSELKLQESGPGLVRPSETLSLTCSVSGESISSYYWNWIRQPTGKGLEWIGRIYGGDSSTNYSPTMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V1364 ighv AMDU01158250.1 5670 VLAQVTLLESGPTLVKPTQTLTLTCSFSGFSLTTTNMGVGWVRQLSEKTLEWLTHIWWDDDKHFNPSLKNRLTISKDTSKNQVTLTMTSMGPEDTAKYYCAKI
Erinaceus europaeus V1365 ighv AMDU01158256.1 12717 VLSELKLQESGPGLVRPSETLSLTCSVSGESISSYNAWNWIRQPTGKGLEWIGNIYGNSGNTYYSPSMKNLATISKDTPKNQFSLKLSSVTSEDTAMYYCAK
Erinaceus europaeus V1366 ighv AMDU01158268.1 17030 LVRPSKTLSLTCSVSRESISNYGWNWVCQPTGKGLEWTEYIGSSTNYSPFMKNQATISKNTSKNQLSLKLSSVTAEDTTMYYCAKDK
Erinaceus europaeus V1367 ighv AMDU01158284.1 5808 VLSEVKLQESGPGLVRPAQTLSLTCAVSGESISSSNGWNWIRQPAGKGLEWIGYIYGGGSSTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAIYYCAR
Erinaceus europaeus V1400 ighv AMDU01166441.1 3555 VLSELKLQESGPGLVRPSQTLSLTCTVSGESISSSYYWSWIRQATGKGLEWIGNIHGSNGNTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V1401 ighv AMDU01166442.1 16729 VLSELKLQESGPGLLRPSETLSLSCSVSGAPISSDNGWHWIRQPTGKGLEWIGRIYGSNGNTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V1522 iglv AMDU01208517.1 1668 SWAQSVLTQPPSVSGNLRETVTISCLGGSNNIGKGYGVHWYQQLPGSAPKLLIYGNSNRPSGVPDRFSGTKSGSSGTLTISALQSEDEADYFCQSYDSSISA
Erinaceus europaeus V1523 iglv AMDU01208521.1 7316 SLSQSMVTQPPSLSASPGSTARLTCTLSSDINVGSKDIYWYQQKEGGPPSYLLPYYSDSSKHQGSGVPSCFSGSKDTSKNAGLLLISGLQADDEADYYCNI
Erinaceus europaeus V1524 iglv AMDU01208522.1 561 SLSQSMVTQLPSLSASLASTARLTCTLSSVINVGSKHIYWYQQKDGSSPRYLLHYYSDSNMHQGSGVPSRFSGSKDTSKNAGLLLISGLQADDEADYHCSI
Erinaceus europaeus V1525 iglv AMDU01208525.1 6925 SLSQSMVTQPPTLSASLGSTARLTCTLSSDISVGSKHIYWYQQKDGNPPRYLLRYYSDSDKHQGSGVSSRFSGSKDTSKNAGLLLISGLQAEDEADYYCSI
Erinaceus europaeus V1526 iglv AMDU01208538.1 829 SLSQPMVTQPPSLSAFPGLTVRLTCTLSSDINVGDKYINWLQQKEGSPPRYLLTYKADSDKYQGSGVPNRFSGSKDTSKNAGLLLISGLQADDEADYYCSI
Erinaceus europaeus V1527 iglv AMDU01208540.1 7872 SLAQSVLSQPPSVSGTPGQRVTTTCNGNSNNIGNSYGASWYQQLPGTEPKCLIYGNSNRPDRFTGSRSGNTASLTITGLQPEDEAEYHCHTYDYSLY
Erinaceus europaeus V1528 iglv AMDU01208540.1 1963 SWAQSRLTQEASVSGSVGQKVTLSCAGSSNSVGASNVGWYQQISGAAPKTVMITSTRPSGIPDRFSGIKSGSTAYLTISSIQPEDEADYYCSAWDYSISS
Erinaceus europaeus V1529 iglv AMDU01208542.1 4033 SLSQPVLTQPPTFSASPGSTARLTCTLSSDIIVSNYRIYWYQQKPGSPPRFLLSFYTDSSKEQGSGVPSYFSGSKDSSANAGLLLISGVQAEDEADYYCTL
Erinaceus europaeus V1530 iglv AMDU01208545.1 25991 SWAQSVVTQPSSVSRNLGQSLTISCTGNSNNIGHSNNGKYVEWYQQFPGMAPRILIYQTTKRYSGVPDRFSGSRSGNTASLTITGLQSEDEADYYCFVHDVSLS
Erinaceus europaeus V1531 iglv AMDU01208547.1 2874 SWSQSVVTQPSSVSRNLGQSITISCTGNSNNIGHSTAGKYVEWYQQFPGMAPRILIYQTTKRYSGVPDRFPGSKSGNTASLTITGLQSEDEADYYCFVGDVSLS
Erinaceus europaeus V1532 iglv AMDU01208555.1 4006 CGDSASSVSRNLGQSITISCTGNSNNIGHSNEGKYVDWYQQFPGMVPKLLIYETTKRYSGVPDRFSGSKSGNTASLTITGLQSEDEADYYCCVGDASLSA
Erinaceus europaeus V1533 iglv AMDU01208559.1 13970 SWAQSVVTQPSSMSGNLGQRITISCTGNSNNIGHSDNGKYIIWYQHLSGRTPRPLIYGTTKRPSGVPDRFSGSKSRNTASLIITTLQSEDEADYYCFVWDNNVG
Erinaceus europaeus V1553 ighv AMDU01216941.1 4919 VLSELKLQESGPGLVRPSQTLSLTCAVSGESISSNYYWSWIRQPTGKGLEWIGYIYGGSSSTYYSPSMKNRATISKDTSTNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V1554 ighv AMDU01216944.1 30823 VLSEFMLQESGPGLVRPSGTLSLTCSVSGESISSSYDWSWIRQPTGKGLEWIGYIYGGGSSTNYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V1560 iglv AMDU01219567.1 5563 SCAQSVLTQPSSVSVNVGQKTTVSCKGSSMNIGDSYYGKYIDWCQQLSGKTPKPLIYEVTKQSFGVPDRLSGSKSGNTAFLTITVLQPQDEGDYYCLVGDSNL
Erinaceus europaeus V1562 iglv AMDU01221483.1 4893 THSQTVTQEPSLSVSPGGTVKLTCGLNSGSVTSSNYPSWYQQIPGQAPKLLMYYTNSRPSGVPDRFSGSISGNKAALTITGAQIDDEADYYCNLYMGSGV
Erinaceus europaeus V0 iglv AANN01573745.1 721 SLSQPVLTQPPTFSASPGSTARLTCTLSSDIIVSNYRIYWYQQKPGSPPRFLLSFYTDSSKEQGSGVPSYFSGSKDSSANAGLLLISGVQAEDEADYYCTL
Erinaceus europaeus V1 iglv AANN01573748.1 1756 SWAQSRLTQEASVSGSVGQKVTLSCAGSSNSVGASNVGWYQQISGAAPKTVMITSTRPSGIPDRFSGIKSGSTAYLTISSIQPEDEADYYCSAWDYSISS
Erinaceus europaeus V2 iglv AANN01573983.1 832 SLSQSMVTQPPSLSASPGSTARLTCTLSSDINVGSKDIYWYQQKEGGPPSYLLPYYSDSSKHQGSGVPSCFSGSKDTSKNAGLLLISGLQADDEADYYCNI
Erinaceus europaeus V3 iglv AANN01573985.1 3332 SWAQSVLTQPPSVSGSLHERVTISCLGGSNNIGNGYDVHWYQQLPGSAPKLLIYGNSNRPSGVPDRFSGTKSGSSGTLTISALQSEDEADYFCHSYDSSISA
Erinaceus europaeus V4 iglv AANN01573989.1 1500 SWAQSQLTPSVSGSVGQKVTLTCTGSRSNVGIYGAGWYQQIPGASPKTVMMHTTQPSGISDRFSGSRSGNTASLTISSLQPEDEADYYCSAYDV
Erinaceus europaeus V5 ighv AANN01574315.1 626 VLAQVTLLESGPTLVKPTQTLTLTCSFSGFSLTTTNMGVGWVRQLSEKTLEWLTHIWWDNDKHFNPSLKNRLTISKDTSKNQVTLTMTSMGPEDTAKYYCAKI
Erinaceus europaeus V6 trdv AANN01576298.1 4608 ALLDIILEPNTKSLTVLVGEPTTFRCSITGGDLKNYQMSWYKKSEDNTLTPVYRLSHSSKDNSKTSFKGKIDTLKSQYVLDIPKTTIKDAGTYYCGSD
Erinaceus europaeus V7 trbv AANN01589396.1 1117 PTNASVTQNPPHLIRRSGQEATLRCNPEEGHIYVYWYQQLSEGSLKFMAYFRRETPLDESGMPSKRFSAEFPKEGPSTLKIEPTELEDSAAYLCASSL
Erinaceus europaeus V8 iglv AANN01602858.1 1801 SWAEVVFTQPKSVSGNPGQKVTISCTRSSGNIADNYVYWFQQHPGKAPRMLIYKYDQRPSGIPDRFSGSKDISSNAGHLTISGLQPEDEADYYCLSGYDSY
Erinaceus europaeus V9 iglv AANN01602859.1 866 SWSQFTMNQPHSVTGNPGQKVTISCTRSSGNIGSYYVHWYQQHPGSTPRNVIYEYDKRPSGVPDRFTGSKDSSSNTASLTISGLQPEDEADYYCQSYESSY
Erinaceus europaeus V10 iglv AANN01602863.1 706 TLSQFTLTQPSSVSGNPGEEVTIPCIHSSGNIEDNYVHWYQQYPGSAPRNVIYEDNKRPSGVPDRFSGSIDSSSNAASLIISALQSEDEADYYCQSYDSNY
Erinaceus europaeus V11 iglv AANN01602865.1 636 TLSQFTLTQPSSMSGNPGQKVTISCKHSSGNIGSYYVHWYQQYPGNAPRNVIYNDNKRPSGVPDRFSGSIDSSSNAAFLSISGLQPEDEGDYYCQSYDSSD
Erinaceus europaeus V12 trbv AANN01670333.1 656 PVESEVIQTPKHLVKAPSQAVTLRCSYESGHNYVYWYQQKQGQGPQFMVQYYNGQLNEKGILPALFSVQQKSKNHHSELTVSSLKLEDSALYLCASSI
Erinaceus europaeus V13 trbv AANN01670333.1 4103 LVETSVMQSPKFQILKTGQETELECGQKMNHNYMYWYRQDPGQGLRLIHFSVGAGVTDKGEVPEGYRVSRPDTESFPLTLESAAPSQTSVYFCASSL
Erinaceus europaeus V14 trbv AANN01670333.1 7117 QVESEVTQTPKHLIKARRQQVTLNCSYESGHIYVFWYQQILNQGPQLLFLYGDGKEMNKGNASARFSVQQQSNDHRSELTVSSLEPEDSALYLCASSM
Erinaceus europaeus V15 iglv AANN01685067.1 2555 SLSQSMVTQPPSLSASPGSTARLTCTLSSGFNVGSYSIFWYQQKDGRPPRYLLSYYSDSDKHQGSGVPSRFSGSKDTSKNAGLLLISGLQADDEADYYCNI
Erinaceus europaeus V16 ighv AANN01692749.1 1201 VLSELKLQESGPGLVRPSETLSLTCSVSGESISSYYWNWIRQPTGKGLEWIGRIYGGDSSTNYSPTMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V17 ighv AANN01696052.1 2091 VHSQVQLTQSGAEVRNPGTSVKLSCKASGYTFTRYYMHWVLQAPGKGLEWMGRINPKTSNTNYAQKFQSRATMTADTSSNTAYMQLSSLSFENTAVYYCAR
Erinaceus europaeus V18 trdv AANN01699452.1 472 YSIAQTVTQDQPEMLMQKGNVTLHCTYDTSSTSYSLLWYKQPSSGEMILLIRQDSYNQANVTEGRYTVDFQKASKSINLVISASQLEDSALYFCALR
Erinaceus europaeus V19 iglv AANN01710925.1 1074 THSQTVTQEPSLSVSPGGTVKLTCGLNSGSVTSSNYPSWYQQIPGQAPKMLMYYTNKRPSGVPDRFSGSISGNKAALTITGAQIDDEADYYCNLYMGSDV
Erinaceus europaeus V20 iglv AANN01720836.1 1321 FVTSSNLIQPSSLSVALGQTAKLTCQGLSNSAQWYQQKPGQAPVQVMYGSSNRPSGIPDRFSGSRSGSTATLTISGAQADDEADYYCQQWDTGAQ
Erinaceus europaeus V21 igkv AANN01726494.1 537 ARCDIQMTQSPSIHPASPGGRVSISCQASEGISNYLHWYQQKSGEPPKLIVEYASKTISGVPSRFSGSGSGTDFTLTISNLEPEDIATYYCQQGNSYP
Erinaceus europaeus V22 ighv AANN01730109.1 6136 VLSELKLQESGPGLLRPSETLSLSCSVSGAPISSDNGWHWIRQPTGKGLEWIGRIYGSNGNTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V23 trav AANN01760368.1 226 TEVQMKVDQRPGVLILQEGQTSSLTCNSSYMASVQWFQQKSGGPLESLFFLASGTQQKGRLKCTANVREYWSHLDIRDAQPGDSATYYCAMQ
Erinaceus europaeus V24 trav AANN01812967.1 1394 VMADAEVTQPSSVQSNEGDLVRLPCEHSTISTTDYIHWYRQIPHNSPEYLIHSLRTNETRGRVSLIMAPDRKSSTLVLPQVTMRDSAVYYCTVRE
Erinaceus europaeus V25 trav AANN01812969.1 4469 PGRANWIRPQKTQVWETERQIANLLCDYSISSTSFVDLYWYRQYPNQPLEFILYKGWGYSGKGEAPFAKARFYSQTTEKTTSLYIPRLEFADSALYYCALRV
Erinaceus europaeus V26 iglv AANN01825119.1 3326 SWSQSVVTQPSSVSRNLGQSITISCTGNSNNIGHSTEGKYVCWYQQFPGMAPKLLIYETTKRYSGVPDRFSGSKSGNTASLTITGLQSEDEADYYCYGWDVSLS
Erinaceus europaeus V27 iglv AANN01828904.1 4812 YLSQSEVTLPPSLSAAPGSTARLTCTLNHDISVGNKNIYWYQQKSEIPPRYLLRYLSESNKHQSSGVPNRFSGSKDASANTGLLLISRLQPEDEADYHCAM
Erinaceus europaeus V28 iglv AANN01828905.1 9787 SWAQSVLTQPSSVSGTLGQSITISCIGNSNNIGKKYVQWYQQPSGTAPKLIIYKNSNRPSGIPERFSGSKSGTTGTLTITGLQLEDEADYYCLTYDSSFSA
Erinaceus europaeus V29 iglv AANN01828905.1 11832 SWAQSVLTQPSSVSGNLGGRVSISCAGNSNNIGGGNSVQWYQQLPGTAPKTIIYYNDKRPTGVPDRFSGSKSGSSGTLTISGLQSEDEADYYCQSYDDSLSS
Erinaceus europaeus V30 trbv AANN01834894.1 1265 SSVLGTLVSQHPSRVLCKSKASVVIQCTLVDFQSTTMFWYHQLPNQELTLIASSNTGSTASYEQGFSKEKFLISHPNVTFSSLTVLKVDPKDGSLYFCGAS
Erinaceus europaeus V31 trbv AANN01834895.1 5282 SGLGELVSQYPSRALCKSGVSVTIQCISVDFQSSIMFWYRQVPSQHLRLIASSNPGSSATYEQGFSKEKFHINHPNLTFSSLMVNNVDPEDSSLYFCSA
Erinaceus europaeus V32 iglv AANN01836307.1 4514 SWAQSALIKPFPMSGVQGQTVTISCAGTSSDIGSNNYVSWYQQDPDKHPKHLIYYVNKRPSGIPDRFSGSKSGNTVSLTITALQLEDKADYYCG
Erinaceus europaeus V33 iglv AANN01836307.1 8674 SWAQSALTQPSSVSGAQGQTVTISCAGTSNDIGSHNLVSWYQQEPDKRHKLLIYDVNKRLSGIPDRFSASKSGNTASLTISGLQPEDEANYICGSYRSSYN
Erinaceus europaeus V35 trav AANN01014680.1 1153 MMNDAKTTQQSSLQSTEGERVHLPCEHSTIGGNEYIYWYRQMHHKGPEYLIRGLKTNGSNDMVFLAITTDRKSSTLILPQVAMRDSAVYYCMVAD
Erinaceus europaeus V36 trav AANN01014978.1 715 VKGVQVEQRPPTWSLQEGASSTTLWCNFSTSVSNVQWFRQNPEGRLVSLFYIPSGTKEDGRLTATTVAKERHSTLTITSPQITDSAIYFCAVD
Erinaceus europaeus V37 trav AANN01032279.1 1000 VSGQQLSQSPPSVSIKEGVSISVNCNSSSTVTQLLWYKQVAGKGPVLLFSLYKPGDSATTTNGNLIAKLGEARKDSSLSISAAELEDSGTYFCAG
Erinaceus europaeus V38 iglv AANN01040361.1 1523 SVVHALLTQPSTVTSFLGQQVSLTCTGNGNNVGYEGAVWVQQYPGQVPKTVMDRNNKRPSGISERFSGSRSGSVGSLTISGIQSEDEADYYCTAWDKSLSA
Erinaceus europaeus V39 iglv AANN01068530.1 898 SLSQSMVTQLPSLSASLASTARLTCTLSSVINVGSKHIYWYQQKDGSSPRYLLHYYSDSNMHQGSGVPSRFSGSKDTSKNAGLLLISGLQADDEADYHCSI
Erinaceus europaeus V40 ighv AANN01069424.1 358 VLSELKLQESGPGLVRPSETLSLTCSVSGESISSYNAWNWIRQPTGKGLEWIGNIYGNSGNTYYSPSMKNLATISKDTPKNQFSLKLSSVTSEDTAMYYCAK
Erinaceus europaeus V41 iglv AANN01080368.1 588 SVVSYKLTQPSSMSANLGQTAQLTCGGNNIERKSVHWYQQKPSQSPVLTIYNDNSRPSGIPDRFSGSNSGNMATLTISKVRTEDEADYYCQVWDSNDK
Erinaceus europaeus V42 trav AANN01152734.1 1225 TNGDSVTQTEGTVTLSENNPLVLNCTYQTTYATPVLFWYVQYLSKGPQLLLKSSTDNQRVELQGFNARLLKGDSTFHLWNPSVRTSDSAVYYCALG
Erinaceus europaeus V43 iglv AANN01168579.1 2898 SLSQPMVTQPPSLSAFPGLTVRLTCTLSSDINVGNKYINWLQQKEGSPPRYLLTYKADSDKYQGSGVPNRFSGSKDTSKNAGLLLISGLQDDDEADYYCSI
Erinaceus europaeus V44 iglv AANN01170269.1 480 SWSQSVVTQPSSVSRNLGQSITISCTGNSNNIGHSTAGKYVEWYQQFPGMAPRILIYQTTKRYSGVPDRFPGSKSGNTASLTITGLQSEDEADYYCFVGDVSLS
Erinaceus europaeus V45 trdv AANN01184148.1 147 SGSTNSITQSTSTVYKQAGDSVIMDCTVTVSYTYYMMYWYRQLSSGEMIHLINIHSENVDSRVGRYTLKFQKRNKHLQFTISNLTPKDTAVYFCAASN
Erinaceus europaeus V46 trdv AANN01205319.1 1394 SSVAQSVTQAKSAMSWQEGKEVTLHCQYETRMRTFYIFWYKQLANGELIFLISLRSTAQNANNGRYFINWLKTRKTSQFIISPVELQDSGRYFCALWE
Erinaceus europaeus V47 trav AANN01205321.1 8709 MNGQQVYQIPQFQLVKEGMNFTVYCNSSSTFNSLHWYKQSPSGNPVFLMMLVSSGEVKKKARWTGQFGKDRKDGFLHITATQPADVGTYFCVQ
Erinaceus europaeus V48 trav AANN01205591.1 1742 VSCQQEEEKFQTLIVQEGEDALVNCSYKGTITYLQWYRQDSGKGLSMLVLIRSNEKKKPSGRLEVTLDTSGQESSLLIRASHAADAATYFCAVD
Erinaceus europaeus V49 iglv AANN01222449.1 3571 HVASSSLTQPSSMSVALGQTAKINCQGVNYYAHWYQQKPGQAPVNVIYGNSNRPSGIPNRFSGSKSGGTATLTISGVQAEDEADYYCQDANDHS
Erinaceus europaeus V50 iglv AANN01239462.1 3620 TLSQFTLTQPSSMSGNPGQKVTISCKRSSGNIGSNYVSWYQQYPGSAPRNVIYEDNKRPSGVPDRFSGSIDSSSNAASLSISGLQPEDEADYYCQSYDSND
Erinaceus europaeus V51 iglv AANN01251117.1 409 THSQTVTQEPSLSVSPGGTVKLTCGLDSGSVTTGYYPAWYQQIPGQTPKLLMYSTNNRPSGVPDRFSGSISGNKAALTITGAQLEDEADYYCNL
Erinaceus europaeus V52 trbv AANN01299529.1 2857 ASTDTGITQMPKYLVTVKGGKATLKCEKHLGHNAMYWYRQGAQKPPEFMFYYNYQVLLDNNTVPGHFLPACPYSSHLILQVDPMKPEDASVYLCASSR
Erinaceus europaeus V53 trbv AANN01309974.1 347 SASTEVIQSPRYLVKGKEQKAMMNCVPMKSHVHVYWYHQKLHGELKFLVYLQSEDIIDKTETYVEKFLAKCPKNLPCSLEIKSAEAEDSASYFCASSQ
Erinaceus europaeus V54 iglv AANN01324081.1 701 TLSQFTLTQPSSMSGNPGQKVTISCKRSSGNIGSNYVSWYQQYPGSAPRNVIYDDNIRPSGVPDRFSGSIDSSSKAASLTISGLQPEEEADYYCFTG
Erinaceus europaeus V55 trav AANN01327015.1 2763 GVGAQSVTQPDSHITVSEGALLKLRCNYSSSVSPYLFWYVQYPKGGLQLLLKYLSGDPLVKGIRGFEAEFKKSETSFHLKKSSAQLSDRALYFCAIS
Erinaceus europaeus V56 iglv AANN01345405.1 834 SCAQSVLTQPSSVSVNVGQKTTVSCKGSSMNIGDSYYGKYIDWCQQLSGKTPKPLIYEVTKQSFGVPDRLSGSKSGNTAFLTITVLQPQDEGDYYCLVGDSNL
Erinaceus europaeus V57 iglv AANN01346314.1 749 TLSQFTLTQPSSVSGNPGQKVTISCKRSSGNIGNYYVHWYQQYPGSAPRNVIYNDNKRPSGVPDRFSGSIDSSSNAASLSISGLHPEDEADYYCQSSDSNY
Erinaceus europaeus V58 iglv AANN01346317.1 1863 SWAQSVLTQPPSVSAATGQSVSITCTGSSTNIGDGYYVYWYQQFQGTAPTLLIYENSKRPSGVPDRFSGSRSGSLGTLTISRLQPGDEADYFCQSYDKV
Erinaceus europaeus V59 iglv AANN01408721.1 723 SVASSKVTQPSIMSVTLGQTARITCQGEPLKTKYGSWYQQKSGQAPVTVIYGKNNRSSEMPDRFSATAPDDKSILTISGAQLEDEADYYCAVWDETDK
Erinaceus europaeus V60 iglv AANN01415068.1 1568 SWTQSVVTQPSSVSRNLGQSITISCTGNSNNIGHSTEGKYVCWYQQFPGMAPKLLIYETTKRYSGVPDRFSGSRSGNTASLTITGLQSEDEADYYCFVGDVSLS
Erinaceus europaeus V61 iglv AANN01442391.1 1181 SWSQFTMNQPHSVTGNPGQKVTISCTRSSGNIGSYYVHWYQQHPGSTPRNVIYEYDKRPSGVPDRFTGSKDSSSNTASLTISGLQPEDEADYYCQSYESSY
Erinaceus europaeus V62 iglv AANN01455119.1 304 SASQKEVIQEPTLSTTPGGTVTLTCGFSIGDVTNLDSVIWIQQNYPQEPRGLLHGANSRAPGVPDRFSGSLFGNKAALTITGAQAEDEAEYYCVMYFSNQ
Erinaceus europaeus V63 iglv AANN01455120.1 2272 TNSQTVTQESKVSVSLGERVTLSCGLDSGPVTKDHYSNWYQQIPGQPPLRLIYWTDSRPSAVPDRFSGSISENKATLTITGGQLEDEADYYCALYMDSDT
Erinaceus europaeus V64 iglv AANN01455121.1 2299 THSQTVTQEPSLSVSPGGTVKLTCGLNSGSVTSSNYPSWYQQTPGQAPKLLMYNTNNRPSGVPDRFSGSISGNKAALTITGAQTDDEADYYCNLYMGSSV
Erinaceus europaeus V65 trdv AANN01474016.1 1667 SSVAQSVTQAKSAMSWQEGKEVTLHCQYETRMRTFYIFWYKQLANGELIFLISLRSTAQNANNGRYFINWLKTRKTSQFIISPVELQDSGRYFCALWE
Erinaceus europaeus V66 igkv AANN01496987.1 4714 AICDIQMTQASSIMPASLRGTISITCRASQGITNDVAWYQQKPGKAPKLLIYEASSLQTGVPSRFSGSGYGTDFTLTINNLEAEDSATYYCQQYNSYP
Erinaceus europaeus V67 ighv AANN01521112.1 186 VLSEVKLQESGPGLVRPAQTLSLTCAVSGESISSSNGWNWIRQPAGKGLEWIGYIYGGGSSTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAIYYCAR
Erinaceus europaeus V68 iglv AANN01532196.1 691 SLSQSMVTQPPSLSAPTGSTARLTCTLSSGLNVGSYSIFWYQQKDGRPPRYLLSYYSDSDKHQGSGVPSRFSGSKDTSKNAGLLLISGLQADDEADYYCNI
Erinaceus europaeus V69 trdv AANN01533268.1 274 FSMATKVTQIQTPITRKEGEAVTFHCSYEISWNSYSLYWYEQTPTGQMFFLIYQDYNKPNAKQGRYSVNFEKEKGSIRLTISPLKLKDSAKYFCALW
Erinaceus europaeus V70 trav AANN01533268.1 6175 VTGDTKTTQPNSLQGTEGELVHLPCEHSTIGGNEYIFWYRQILHEGPEYLIHSLISNVTNAMTSLVITRDRKSSTLVLPQVTVRDSAVYYCIVRE
Erinaceus europaeus V71 trdv AANN01533271.1 40 FSLAQKVTQAPIRISGQERAAVTMECMYETQLDYYILYWYKQYPSGQMDFLLYQVNTEPNKRSGRYSVNFEKAEKYISLTISSLQLEDSAKYFCALR
Erinaceus europaeus V72 trav AANN01533271.1 4652 MVSDAKATQSNSLQSPEGEPAHLPCEHSTISSNEFIYWYQQMHHKGPEYLIHGLKSNVTNSMASLIITTDRKSSTLILPHVTIRDSAVYYCTVME
Erinaceus europaeus V73 trav AANN01533272.1 8980 VSGQQQLSQSPLSVSIEEGEGISLNCNSSSVLNLLLWYKQVAGKGPVLLFSLYKPRDSAMTTNGNLIAKLDEARKDSSLSISAAELEDSGTYFCAG
Erinaceus europaeus V74 trdv AANN01533274.1 8450 SLMAQTVTQLQLEMSVRETETVALDCTYETSDSDYYLFWYKQLPSGKLIFVIRQESFKQEKAKENRFSVQFHKADKSFQLKISASQLKDSAMYFCAYRR
Erinaceus europaeus V75 trav AANN01533278.1 1300 LSGMMQVRQSPLTLSIQEGEGGTIYCNYSNTASDRLYWYRQDPGKGLESLFFLVSRGVVKERQLSASLDTRASFSTLHFTSSLPGLSATYFCA
Erinaceus europaeus V76 trbv AANN01535783.1 480 QGTHVTQNPRYQVVKTGDSVNLSCLQNQKHKVMYWYQQRLNQAPKLLLYYYDDQLNRERDTSEHFQSKRPNNSFCSLEIRSIDLGDAAVYLCASSR
Erinaceus europaeus V77 trbv AANN01535784.1 3217 SLCAEVVQTPGQLVKGKGQKASVSCVPIKGCDYVYWYQLIPGKEFKFLISFQNEDVLYEGEMSKERFVAECPTGRLEIQSTELQDSAVYFCASSE
Erinaceus europaeus V78 iglv AANN01545254.1 384 SVTSSELTQPSAVSVALGQTARITCQGEILREYYADWYQQKAGQAPVLIIYDNNKRNTGISDRFAVTYTEEKSILTTSGVQAEDEADYYCRLFDESYN
Erinaceus europaeus V79 ighv AANN01545376.1 4497 VHSQIQLTQSGAEVRKPGTSVKVSCKASGYTFTDYSMHWVRQAPGKGLEWMGWVYPKNGNTKYAQKFQGRATMTADTSSNTAYMQLSSLSFEDTAVYYCAR
Erinaceus europaeus V80 iglv AANN01564321.1 583 CGDSASSVSRNLGQSITISCTGNSNNIGHSNEGKYVDWYQQFPGMAPKLLIYETTKRYSGVPDRFSGSKSGNTASLTITGLQSEDEADYYCCVGDASLSA
Erinaceus europaeus V81 trgv AANN01573220.1 798 SQLTFNLEGRKASITRQTGSSVVITCGVLAQTITYMHWYKYQEGEAPERLLYYDFSKSKFVVESGIISGKYHAYKFTENSCKFVIRNLDRNDIGVYFCAAWD
Erinaceus europaeus V82 trbv AANN01579819.1 677 LLDAGVTQTPTYQILRTGLNVTLECTQDMNHDGMYWYRQDPGHGLRLLHYSVGAGITDKGEVPDGYRVSRPDTESFPLTLESAIPSQTSVYFCASSV
Erinaceus europaeus V83 trbv AANN01579821.1 1055 PVESEVIQTPKHLVKAPSQAVTLRCSYESGHNYVYWYQQKQGQGPQFMVQYYNGQLNEKGILPALFSVQQKSKNHHSELTVSSLKLEDSALYLCASSI
Erinaceus europaeus V84 trbv AANN01579822.1 3310 ASMDTGITQMPKYLVMVKAGKATLKCEQHLRHDAMYWYRQSAQKPPELMFHYYYQKLTDNNTIPGRFLPACPDSSHLNLQVDPVKPEDTSVYLCASSK
Erinaceus europaeus V85 trbv AANN01579822.1 897 ASMDTGITQMPKYLVMVKAGKATLKCEQHLGHDAMYWYRQSAQKPPELMFYYENRGLLDNNTIPGRFLPACPDSSHLNLQVDPVKPEDTSVYLCASSR
Erinaceus europaeus V86 trav AANN01623493.1 310 VSSKQEVNQNPDALDVHEGNNTVLNCTYTDSGIYSLQWFRHDPGKELISLFFLQSSQAEKDSGRIRVTLDKSSRQSSLYIAAAQSSDSTTYLCAV
Erinaceus europaeus V87 trgv AANN01675036.1 781 GLGQFRLEQPEISVSKERGKSALISCKMLTGDFSNKWIFWYQQKPDQNIEYIMYVYSVTTPNQLTVGGKNKYEARKNSRTSTSTLKINFLEKGDEATYYCASWVN
Erinaceus europaeus V88 iglv AANN01685366.1 991 PVVSSVLSQPSSMSVALGQTAKITCQPVYHHTNWYQQKSGKSPVEVIYVSTSRPSGIPDRFSGSVSGKTATLTISGIQAEDEADYHCLSFDSSGNY
Erinaceus europaeus V90 trbv AANN01690964.1 1934 LVKAGVTQTPKSVILRTELNVTLDCAQDMNHDRMYWYRQDAGHGLRLLHYSFGIDTTDKGDAPDGYSVSRSEMESFPLTVKSASLSQTSVYFCASSL
Erinaceus europaeus V91 iglv AANN01692626.1 15195 SLSQSMVTQPPTLSASLGSTARLTCTLSSDISVGSKHIYWYQQKDGNPPRYLLRYYSDSDKHQGSGVSSRFSGSKDTSKNAGLLLISGLQAEDEADYYCSI
Erinaceus europaeus V92 iglv AANN01692626.1 2046 SLSQSMVTQPPSLSASPASTARLTCTLSSDINVGSKHIYWYQQKDGSSPRYLLHYYSDSNMHQGSGVPSRFSGSKDTSKNAGLLLISGLQADDEADYHCSI
Erinaceus europaeus V93 trav AANN01697034.1 1128 TMSDAKTTQPGSLQSTEGETIFLHCEYSTISGAEYIYWYRQIHHRGPEYLIHGFKTNESNAVASLVITTDRKSSTLVLPQVTVRDSAVYYCIVRE
Erinaceus europaeus V94 ighv AANN01702871.1 3114 VQSQVQMTQSGVEVRKPGTSVKVSCKASGYMFTDYTMHWVRQAHGKGLEWMGWINPKNSNTKYAQKFQGRATMTADTSSNTAFMQLSSLSFEDTAVYYCAR
Erinaceus europaeus V95 trav AANN01719099.1 8570 LSLAENVKQHSSVLNIQEGDDAVINCSYSDSASYYFLWYKQEPGRGPQLIIDIRSNSNRNEAGRLTVLLNKETKDLSLCIAATQPGDSAVYFCAA
Erinaceus europaeus V96 trdv AANN01719099.1 4948 ISVAQKVTQALPTTSAQEKEDVVLNCTYDISNNIDSYSVFWYKQPSSQEMIFLIRQDSYSQENATEGRYTVDFQKASKSINLVISASQLEDSVLYFCALR
Erinaceus europaeus V97 trav AANN01737715.1 10124 GRAQKVTQPEAHISVTEAAPVQVKCNYSYSGSPELFWYVQYPKQGLQLLMKHFSRESVKGFTAELNKGETYFHLKKVAVQKEDSAMYYCALR
Erinaceus europaeus V98 trav AANN01737715.1 6714 LSNQQEQNLQTLTVQEGQDALVNCSYKGSITYLKWYRQDSGRGLTMLVSILSNEKKKTYGRLEVTLDISSQKSSLLITTSQGADAATYFCAVD
Erinaceus europaeus V99 trav AANN01737716.1 10622 TSGQQRGVEQSPGPLGVQERATVSLQCTYSDRASQYFAWYRQCSGKGPELLVYFYSREDEVEGRFTAKINKTSQSISLLIKDTQPRDSATYLCAV
Erinaceus europaeus V100 trav AANN01737716.1 6054 GAGAQSVTQSDGQIRVSEGASLELRCNYSYSATPSLFWYVQHPKGGLQLLLKYYSGDPLVKGIRGFEAEFKKSETSFHLKKSSAQLSDRALYFCAIS
Erinaceus europaeus V101 trav AANN01737718.1 6635 SSMTQTVTQTQPTVSILEKDDVTLDCTYETSSYSYYLFWYKQPPSGEMMILIRQESFSEQNATKDRYSLNFQKTARSISLTITASQLGDSAVYFCALSD
Erinaceus europaeus V102 trgv AANN01745485.1 956 RQRSPWSSLLRCWGAGGSSAILPCTVHTKVSYIHWYRHQEGRAPERLLVMAMLKSDVRWDSVLKADKAVVNKAKDGSSCSLSVLRLGKQDEGRYYCAAWV
Erinaceus europaeus V103 trbv AANN01791561.1 2040 MMSAGITQSPKIQILKAGQSVTLGCIQDTENDEMFWYRQDLDHGLRLIHYSVGTGFHGKGEVPEGYHVSRPNITNFPLTLESASPSQTSVYFCASSA
Erinaceus europaeus V104 iglv AANN01809113.1 1371 FCALPVLTQAPSASATLTSSVKLTCILSREHSTYWITWHQQEAEKPPRYLMKVNSDGSHSKGTGIPDRFSGSSSGADRYLSINNIQPEDEADYYCATYDNKYY
Erinaceus europaeus V105 trbv AANN01826377.1 1420 TGDSGVIQSPRHVIKSRGEMVILNCHPQSGHYTVYWYQQVLGQSLQFLVSYYEKMERDKGSIPDHFSAQQFGNYSSILNMTSLEPGDSALYLCASS
Erinaceus europaeus V106 trbv AANN01826378.1 5181 TGDSGVIQSPRHVIKSRREMVNLNCHPKSGHNTVYWYQQVLGQSLQFLVSYFAKEQGEKGSIPDHFSVQQFDNYSSVLNMKSLEPGDSALYLCASS
Erinaceus europaeus V107 trbv AANN01826379.1 7413 DSEVIQTPKYVVRARRQPVTLRCSYESGHLSVYWYQQTQGQGPQFLVEYYDGQERNKGKLPAYFKVEQVSKDHRSELTVSSLELEDSALYLCASSL
Erinaceus europaeus V108 trbv AANN01826379.1 5828 SVGPAVTQMPRYLVKAETQPVTLNCSYESGYLCAYWYQQTQGQGPQFLVHYYDGKDIDKGNVPNRFTFRQLKDHRSELTVSSLELEDSALYLCASSI
Erinaceus europaeus V109 ighv AANN01828001.1 3248 VLSELKLQESGPGLVRPSQTLSLTCTVSGESISSSYYWSWIRQATGKGLEWIGNIHGSNGNTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V110 trbv AANN01831091.1 989 PVGTGVTQTPEHLVRARRQPVTLRCFYESGHRSVYWYQQTQGQGPQFMVQYTDMEEMEKGKLPDRFSVQQFKNNHSSELTVSSLDLEDSALYLCASSI
Erinaceus europaeus V111 igkv AANN01000198.1 4204 SSGYIVMTQTPLSLSVVPGQSVTNSCRSSHNLLHQSGVSLLDWHLQKPGQQPQSLIHEASKRFTGVSDRFSGSGSGTEFTLTISRVATKDVGVYYCMQGLDLP
Erinaceus europaeus V112 ighv AANN01023149.1 330 VLSEVKLQESGPGLVRPAQTLSLTCAVSGESISSSNGWNWIRQPAGKGLEWIGYIYGGGSSTYYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAIYYCAR
Erinaceus europaeus V113 trbv AANN01036848.1 1434 SLGEDVAQTPGHLVKGKGQKVSIFCIPVKGHDYVYWYQQIPGKEFKFLISFQKDTVYYEGEIPKERFVAECSASSPCRLKIQSTELQDSAVYFCASSE
Erinaceus europaeus V114 trbv AANN01074795.1 545 LLDAGVTQTPTYQILRTGLNVTLECTQDMNHDGMYWYRQDPGHGLRLLHYSVGAGITDKGEVPDGYRVSRPDTESFPLTLESAIPSQTSVYFCASSV
Erinaceus europaeus V115 trgv AANN01100017.1 5999 SQAAITLEQPLAVLGRRGSSAILPCTVHTKVSYIHWYRHQEGRAPERLLVMAMLKSDVRWDSVLKADKVTAMESKDGSSCTLSVLRLEKNDEGRYYCAAWY
Erinaceus europaeus V116 iglv AANN01178057.1 421 FVASFQLTQPSSSSLCLGQTARITCQGIINYHANWYQQKSGQVPVNIIYDISKRPSGVPDRFSGSLSGSTATLTISGAQAEDEADYYCQSFDSSGNL
Erinaceus europaeus V117 iglv AANN01189882.1 1287 SWTQSVLTQPSSVSRNLGQSITISCTGNSNNVGHSHEAKYVNWYQHLAGMAPKLLIYETTKRYSGVPDRFSGSRSGNTASLTITGLQSEDAADYYCFVGDVSLS
Erinaceus europaeus V118 iglv AANN01211524.1 485 SWAQSVVTQPSSMSGNLGQRITISCTGNSNNIGHSDNGKYIIWYQHLSGRTPRPLIYGTTKRPSGVPDRFSGSKSRNTASLIITTLQSEDEADYYCFVWDNNVG
Erinaceus europaeus V119 trav AANN01218983.1 1349 GAGAQLVTQPSGPITVSEGASLELRCNYSYGATPYLFWYIQYPNQGLQLLLKYVLKETLVKGIKGFEAEFKKDETTFHLKKQSAHWSDSAWYFCALS
Erinaceus europaeus V120 trbv AANN01222989.1 621 SVDPGVIQSPRHVIKGKGEKAILKCSPMSGHSSVSWYQQVLGQGPQFLVSYYEKMEQDKGAIPDRFSAQQLDNYSSEMNMTFLEPGDSALYLCASS
Erinaceus europaeus V121 ighv AANN01224354.1 6045 VLSEFMLQESGPGLVRPSGTLSLTCSVSGESISSSYDWSWIRQPTGKGLEWIGYIYGGGSSTNYSPSMKNRATISKDTSKNQFSLKLSSVTAEDTAMYYCAR
Erinaceus europaeus V122 trav AANN01231793.1 1255 GAGAQSVTQPDRHVPVSEGTLMELRCNYSSSVPPALFWYMQKPTKGLQLLLKYVSGSNLVKGISGFEAEFKKSETSFHLKKHSAHLSDSALYFCAVS
Erinaceus europaeus V123 trgv AANN01235529.1 2611 TRLITQLRISIVKRKGNTAFLECQIKSNAFKNNMYIHWYRQKPDEPLQRILYISSNENVVHEHGVSEDRYEAKKGQADLPASLRIHRVNEEDAGLYYCACWD
Erinaceus europaeus V124 trav AANN01271296.1 1938 QVRGDSVTQMGGQLTVSEKASLTVNCTYSALGYLVLFWYMQYPGEGLQLLLKAQTDKAKGTNKGFEATYDKETSSFHLKKVSVQESDSAVYYCAMS
Erinaceus europaeus V125 iglv AANN01284392.1 1124 SWAQSVLTQPPSVSGNLRETVTISCLGGSNNIGKGYGVHWYQQPPGSAPKLLIYGNSNRPSGVPDRFSGTKSGSSGTLTISSLQSEDEADYFCQSYDSSISA
Erinaceus europaeus V126 iglv AANN01284455.1 1364 SWAQSVVTQPSSVSGNLGQSITISCTGNSNNIGHSNEGKYVDWYQQFPGMAPKLLIYETTKRYSGVPDRFSGSKSGNTASLTITGLQSEDEAEYYCSVWDVSLS
Erinaceus europaeus V127 trav AANN01330496.1 1609 VSSKQEVNQNPDALDVHEGNNTVLNCTYTDSGIYSLQWFRHDPGKELISLFFLQSSQAEKDSGRIRVTLDKSSRQSSLYIAAAQSSDSTTYLCAV
Erinaceus europaeus V128 trav AANN01330498.1 3442 TKGDSVTQTEGTVTLSENKPLVLNCSYQTSYSSPFLFWYVQYLHKAPKLLLKSSTESDRTESHGFHASLVKSDKTFHLQKPSAQTSDSAVYYCAMR
Erinaceus europaeus V129 trav AANN01330501.1 2010 QVHGDSVTQMGGQLTISEKASLTVNCTYSASGYPALFWYIQYPGEGLQLLLKAQADKAKGTNKGFEATYDKETTSFHLKKVSVQESDSAVYYCAMS
Erinaceus europaeus V130 iglv AANN01353412.1 449 SCAQSVLTQPSSVSVNVGQKTTVSCKGSSMNIGDSYYGKYIDWCQQLSGKTPKPLIYEVTKQSFGVPDRLSGSKSGNTAFLTITVLQPQDEGDYYCLVGDSNL
Erinaceus europaeus V131 trav AANN01359560.1 4291 GAEAQSVTQPDGLITVSEETSVEMKCNFSYTGTPYLYWYVQHPNQELQLLLRYFSGNTQVQGISGFEAEFKKDENTFHLKKSPVHQSDSARYFCALS
Erinaceus europaeus V132 igkv AANN01403516.1 451 AICDIQMTQASSILPVSLQGTVSITCRASQDISKWLAWYQQKPGKAPKLLIYEASKLQTGVPSRFSGSGYGTDFTLTINNIEAEDVATYYCEQYNSYP
Erinaceus europaeus V133 iglv AANN01422448.1 872 SWAQSALTQPSSVSGAQGKTVTISCAGTSNDIGRYNDVSWYQQEPDRRPKLLIYDVSNRASGVPDRFSGSKSGNTASLTISGLQPEDEADYHCSSYAGS
Erinaceus europaeus V134 iglv AANN01422449.1 1092 SWAQADLTQPSSVSGAQGKTITISCAGTSSDIGNYNGVSWYQMEPDKHPKLLIYDVSNRASGIPDRFSGSKSGNTASLSISGLQPEDEADYHCSSYAGS
Erinaceus europaeus V135 trav AANN01428804.1 817 VSCQQEEEKFQTLIVQEGEDALVNCSYKGTITYLQWYRQDSGKGLSMLVLIRSNEKKKPSGRLEVTLDTSGQESSLLIRASHAADAATYFCAVD
Erinaceus europaeus V136 iglv AANN01470154.1 895 LLSQPVLSLSATPGSTVLLTCTMSSGFSVGTYGMYWYQQKSGGPPRSILYHFLSLKLGPGVPSRFSGSKDATVNAGILLISGLQPEDEADYYCMMDHDNE
Erinaceus europaeus V137 trav AANN01525286.1 6771 TSGQQRGVEQSPGPLGVLERATVSLQCTYSDRASQYFAWYRQCSGKGPELLVYFYSREDEVEGRFTAKINKTSQSISLLIKDTQPGDSATYLCAV
Erinaceus europaeus V138 trav AANN01525286.1 903 GAGAQSVTQPDGHITVSEGDSLELKCNYSSSYSVSLFWYVQYPRGGLQLLLKYLSGDLLVKGIRGFEAEFKKSETSFHLKKSSAQLSDQALYFCAIS
Erinaceus europaeus V139 trbv AANN01567601.1 1422 PVDSEVTQVPKYVVKLRRQPVTLRCSYESGHLSVFWYQQILGQGPEFLAEYFDGQVRDKKTLSVRFSVQQFKNNHSSELTSSSLELEDSALYLCASSL
Erinaceus europaeus V140 trbv AANN01567605.1 11257 LTNAGINQNPNILLLRKGQNMTLNCTQDLNHDAMFWYRQDPGQGLRLIHYSPVYGSTDKGDVPEGYSVSRSKKEIFSLTVESATPSQTSVYLCASSL
Erinaceus europaeus V141 trbv AANN01567605.1 5696 LVNGGLIQFPKSQILRRGQRMTLGCFQDMNHNVMLWYRQDLGQGMRLIHYSPGAFYTDKGEVLDGYNVSRPDTILFLLTLESAAPSQTSVYFCASSE
Erinaceus europaeus V142 trbv AANN01567605.1 750 SVDSGVIQTPKYMVKARRQSVNLECSYEPGHLYVYWYQQTQGQGPQFLVQYYDGQERNKEKLPDRFTVQQFKDSYHSKLTASSLELEDSALYLCASSL