WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Propithecus coquereli JZKE00000000.1 (JZKE01) 147 31 24 8 44 23 7 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Propithecus coquereli V7 trbv JZKE01005121.1 3943 LVETKVTQTPRHLVKRTGEKVLLKCSQDMDHERMFWYRQDPGLGLRLIYFSYDVDNDEKGDVSEGYSASRKKKEYFPLVLESASTNQTSVYLCASRY
Propithecus coquereli V73 trbv JZKE01068552.1 290 SMNAGVTQTPRFQILETGQNMTLRCVQDMNHNNMYWYRQDPGLGLRLIHYSVGAGTTANGEVPEGYSVSRSSTKNFPLTLGSATPSQTSVYFCASSD
Propithecus coquereli V77 trdv JZKE01073331.1 5474 SIVAQKVTQAQTARSTTVGQTVTLNCQYETSRIYYTINWYKQLPSKEMIFLLRQGSNSQNAKDGRYSVNFRKEAKSIDLTISDLRLEDLAKYFCALCE
Propithecus coquereli V158 trdv JZKE01143860.1 135117 KGMLCNEVTSSQIAASGSEVTLCCTYNVGFSNPDLLWYRIRPDYSFQFVFYKGATRSQGAAFTQGRFSVKHSQTQKTFYLVISPVRTQDSATYYCFSASV
Propithecus coquereli V248 trgv JZKE01214679.1 2480 HQISCNSEGRIKSIFRKTGSTVDISCDIKQSARYIHWYFFPEEMVPRRLLYYDTYYSSKELDSGTRADKYDASEITEQSFKLHLKRLEASDSGVYYCAVWV
Propithecus coquereli V249 trgv JZKE01214711.1 1420 SWISSNSEGRMMSITKKTGSYIIITCDIQQSTSQYIHWYLFQEGRTPQRILYYDLVSSKTVLESGFSLEKYHAYASRGKSSRFILQNLEESDSGVYYCATWS
Propithecus coquereli V250 trgv JZKE01214717.1 999 SQISSNLEGRMMSITRKTGLAVDITCDIQRSTNYIHWYLFQEGKVPRHLLYYDFLKSSMVVGSGIRTGKYDSYKVSDRSFKLLVKHLEASDSGVYYCASWF
Propithecus coquereli V251 trgv JZKE01214729.1 106 CQISCNSEGRIKSIFRKTGSTVDISCDIKQSTRYIHWYFFPEEMVPRRLLYYDTYYSSKELDSGTRADKYDASKITDQSFKLHLKRLEASDSGVYYCAVWV
Propithecus coquereli V252 trgv JZKE01214743.1 16198 HLEQPQLSSTKTLSKTARLECVVSEGTISAKSIYWYQERPDEVIQLLAYVLSNDTVRMAPGIASNKFEVDRLPEASTSTLTIHNVEKQDSAIYYCASWE
Propithecus coquereli V253 trgv JZKE01214744.1 7833 GLGKLEQPKISVSAATDKSAYIPCKVALQNFGSQGIYWYRQKPNQGLEFLKYAVSATSSRDRKSSKIEATKDSRTSTSTLTINFLEKGDEAIYYCAYWV
Propithecus coquereli V255 igkv JZKE01218258.1 171023 ARCDIQMTQSPSSLAASLGDTVTITCQASQGISNYLSWYQQKPGQSPKILIYGASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQSYNYP
Propithecus coquereli V256 igkv JZKE01218259.1 866 SSGEIVMTQTPLSLPVTLGEPASISCRSSQSLLHSNGNTYLSWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQTIQVP
Propithecus coquereli V257 igkv JZKE01218259.1 11430 SSGDIVMTQTPLSLSVTPGESASISCTASQNIQNTKGNTYLNWFLQKPGQPPKRLIYKISNRDSGVSDRFSGSGSGTDFTLEISRVEAEDVGVYYCMQASYY
Propithecus coquereli V258 igkv JZKE01218269.1 715 SSGEIVMTQTPLSLPVTPGEPASISCSSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYRVSNRLSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQFP
Propithecus coquereli V259 igkv JZKE01218271.1 2298 ACGDIVMTQSPGSLAASPGERVTINCKSSQSLLYNNNNYLAWYQQKPGQAPKVLISWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCAQYYNYP
Propithecus coquereli V298 ighv JZKE01244686.1 3633 VQCEVQLVESGGGLVQPGGSLTLSCVASGFTFSSYAMCWVRQAPGKGLEWVSAIGSGGGTYYADAVKGQFTISRDNSKNTLSLQMKSLQAEDTAMYYCAR
Propithecus coquereli V299 ighv JZKE01244690.1 29 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLDWVSVINWNGDYINYADAVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAR
Propithecus coquereli V300 ighv JZKE01244709.1 14 VQCEVQLVESGGGLVQPGGSLRLSCAVSGFTVSNYYMSWVRQAPGKGLEWVSYIYSDDGDTNYADAVKGRFTTSTDNGKNMLYLQMNSLRTEDTAVYYCAR
Propithecus coquereli V301 ighv JZKE01244710.1 1081 AQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSDYYMSWVRQAPGKGLEWVSRISNTGGSTWYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V302 ighv JZKE01244715.1 310 VRCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYAMHWVRQAPGKGLEWVSRINSGGSTSYADAVKGRFTISRDNSKNMLSLQMNSLRSEDTAVYYCTR
Propithecus coquereli V304 trbv JZKE01247537.1 10489 SVNAGITQTPRFQILETGQNMTLRCVQDMNHNNIYWYRQDPGLGLRLIHYSVGAGTTTNGEVPEGYSVSRSSTKNFPLTLGSATPSQTSVYFCASSD
Propithecus coquereli V309 iglv JZKE01249931.1 1314 SWVQSGLTQEASVSGSVGQKVTLSCMGNSNNVGTYGVGWYQQISRGAPKTVMIGNSRPSGIPNRFSGSRSGNTASLTISGLQPEDEADYYCSAWDDSLTA
Propithecus coquereli V310 iglv JZKE01249931.1 10414 SLSQPVLTQPPSLSASPGASARLTCTLSSGTVVGGYHISWYQQKPGSRPRYLLRYHSDSNKHQGSGIPSRFSGSKDASANAGILHISGLQPNDEADYYCLT
Propithecus coquereli V311 iglv JZKE01249932.1 5043 SLSQPVLTQPPSASASLGASAKLTCTLSSAHSGYTIAWYQQQPGKAPQYLMYVKSDGRHSKGDGIPDHFSGSSSGADRYLTISNIQPEDEADYICGADY
Propithecus coquereli V312 iglv JZKE01249932.1 7452 SLSQPVLTQPPSASASLGASAKLTCTLSSAHSGYTIAWYQQQPGKAPQYLMYVKSDGRHSKGDGIPDHFSGSSSGADRYLTISNIQPEDEADYICGADY
Propithecus coquereli V313 iglv JZKE01249933.1 3729 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYAIYWYQQKPGSPPRYLLSYYSDSDKHQGSGVPRRFSGSKDASANVGILHISGLQPEDEADYYCMV
Propithecus coquereli V314 iglv JZKE01249934.1 2423 SLANFVLTQPSSVSGSPGQKVTISCTRSSCNIGSYYVHWYQQRPGSAPTTVIYNDNQRPSGVPDRFSGSIDSSSTSASLIISGLQSEDEADYYCQS
Propithecus coquereli V315 iglv JZKE01249942.1 823 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSSYTIAWHQQQPGKAPRYLMWVNSAGSHSKGDGIPDRFSGSSSGADRYLTISNIQPEDEADYYCQTWDSGI
Propithecus coquereli V316 iglv JZKE01249944.1 1834 SLANVVLTQPSSVSGSPGQKVTISCTRSSGNIGDNYVHWYQQRPGSAPTTVIYADDKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYGSSA
Propithecus coquereli V317 iglv JZKE01249947.1 5359 SLSQPVLTQPPTASASLGASVTLACTPSSGHSGYAVDWHQQSPGKGSRFVMRVGSGGVVGSKGDGIPEGFSVSGSGLDRYLTIRNNQEDEADYHCGA
Propithecus coquereli V318 iglv JZKE01249954.1 2328 SVASLKLTQVPAVSVALGQTARISCQGDDHISNFVPTNWYQQKPGQAPVLVIYGNSNRPSGIPERFSGSKSGTTATLTISGAQAGDEADYYCQSLDMSGN
Propithecus coquereli V319 iglv JZKE01249955.1 304 SVASQLTQVPAASVALGQTARITCQEDGIRRFFTNWYQQKPGETPVLLIYDSSKQPSGIPERFSGSKSGTTATLTISGAQAGDEADYYCQSFDISSNY
Propithecus coquereli V320 iglv JZKE01249956.1 68 SMASQLTQEPSVSVALGQTARMTCQGDSLRSYYASWYQQKPGQAPVLVIYSNSNRPSGIPERFSGSKSGTTATLTISGAQAEDEADYYCGSYTGS
Propithecus coquereli V321 iglv JZKE01249956.1 5130 SGAQSALTQPSSVSGNPGQSVTISCAGTSSDVGKYNYVSWYQQHPGTAPKLLIYNVNTRTSGIPDRFSGSKSGNTASLTISGLLAEDEADYHCSSYRSGNA
Propithecus coquereli V322 iglv JZKE01249956.1 11138 SVSSFKLTQEPAVSVALGQTARISCQTDGILGSFVPTKWYQQKPGQAPVLVIYSNSNRPSGIPERFSGSTSRNTATLSISGAQAGDEADYYCQSSGISSNY
Propithecus coquereli V323 iglv JZKE01249957.1 3971 SVASQLTQVPAVSVALGQTARITCQGDSLSSYYPNWYQQKPGQAPVLVIYGNSNRPSGIPERFSSSDSGTTATLTISGAQAGDEADYYCGSYAGS
Propithecus coquereli V324 iglv JZKE01249957.1 9224 SGAQSALTQPSSVSGNPGQSVTISCAGTSSDIGKYNYVSWYQQHPGTAPKLLIYNVNTRASGIPDRFSGSKSGNTASLTISGLLAEDEADYHCSSYRSGNA
Propithecus coquereli V325 iglv JZKE01249957.1 15256 FVASDELTQPHSVSVSPGQTAKITCSGDSLAKKYASWLQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTITGAQVEDEADYYCQSRDSSGTH
Propithecus coquereli V326 iglv JZKE01249958.1 6053 SVASQLTQVPAASVALGQTARITCQEDGIRSFFTNWYQQKPGEAPVLLIYDSSKQPSGIPERFSGSKSGTTATLTISGAQAGDEADYYCQSFDISSNY
Propithecus coquereli V327 iglv JZKE01249959.1 450 SVASYELTQPPSVSVSPGQTARITCGGNNIGNKYAYWHQQKAGQAPVLIIYSDSNRPSGIPERFSGSNSGNTATLTISGTQAGDEADYYCQVWDGSN
Propithecus coquereli V339 ighv JZKE01255160.1 7110 VQCEVQLVESGGGLVQPGGSLTLSCAASGFSFSNYWMHWVRQAPGKGLEWVSSIGNDGSTSYADAVKGRFTISRDNDKNTLSLRMNSLRAEDTAVYYCARETV
Propithecus coquereli V388 trbv JZKE01294657.1 6966 AQAQTIHQWPAARVQPVGSPLSLECTVKGASSPALYWYRQATGGPLQLLFYSVGVGQIESQEPQNLSASRPQDGEFILSSKKLLLSNSGFYLCAWR
Propithecus coquereli V389 igkv JZKE01296733.1 5869 SSGDIVMTQTPLSLSVTPGESASISCTASQSILHTDGNTYLNWLLQKPGQPPKRLIYKISNRDSGVSDRFSGSGSGTDFTLEISRVEAEDVGVYYCMQASYY
Propithecus coquereli V471 trgv JZKE01050615.1 359 CQISCNSEGRIKSIFRKTGSTVDISCDIKQSARYIHWYFFPEEMVPRRLLYYDTSYSSKELDSGTRADKYDASEITEQSFKLHLKRLEASDSGVYYCAVWV
Propithecus coquereli V519 igkv JZKE01097724.1 1030 TTGNAALIQFPDLLFASLRDSVSINCRANQSISDYLNWYQQKPGQAPKLLIYDADNPYSGVSSRFTGLQSGTEFILTITNVQADDAATYYCQQD
Propithecus coquereli V520 igkv JZKE01097728.1 10232 ACGDIVMTQSLRSLAVSPGERVTIDCKSSQSLLSNNKNYLAWHQQKPGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQ
Propithecus coquereli V527 trav JZKE01107322.1 64604 AHAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSHLELEDEGVYICEF
Propithecus coquereli V587 trdv JZKE01143865.1 17434 VMPAVVLVSEDQAMTVLVGGSTTLRCSMEGGTIGNYYVNWYRKTQGNTLTFIYRESNIYGPGFQGRFQGGDDLHRNQAILKILKASESDEGFYYCACDL
Propithecus coquereli V588 trav JZKE01143868.1 27949 SSVAQTVTQSQPEMSVQEAGTVTLDCTYATSDSNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLEISDSQLEDAAMYFCAFM
Propithecus coquereli V589 trav JZKE01143869.1 12569 VSSEDKVIQSPSSLAVHEGDSATLTCNYEVSYFQSLQWYKQEKNAPTFLFTLTSSGIEKKSGRLSSILDNKELLSTLNITATQTRDSAIYFCAVE
Propithecus coquereli V590 trdv JZKE01143870.1 33280 SSMSQQVIQSQSAISKQEGETVKLECSYNTSVPYHILYWYKRPPSGEIIFLIFQHTDTDTNATQGQYSVSFQKAAKTIRLIISPSQLEDSATYFCCLRE
Propithecus coquereli V591 trav JZKE01143870.1 20364 IMGDAKTTQPNSMESTEEEPVYLPCNHSTISGSEYVYWYRQILLQGPEYVIHGLKSNVTNSMATLAISADRKSSTLILPRVTLGDTAVYYCIVR
Propithecus coquereli V592 trdv JZKE01143870.1 2174 SIVAQKVTQAQTARSTTVGQTVTLNCQYETSRIYYTINWYKQLPSKEMIFLLRQGSNSQNAKDGRYSVNFRKEAKSIDLTISDLRLEDLAKYFCALCE
Propithecus coquereli V593 trav JZKE01143871.1 26050 TIIAAKTTQPNSMDCAEGGAVNMPCNHSTISGNEYIHWYRQNPSQSPQYIINGLKNNVTNDMASLTITADRKSSTLTLPHVTLRDAGMYYCILRV
Propithecus coquereli V594 trav JZKE01143871.1 16333 RTGAQSVAQPDVHVTVSEGDPLKLRCTYSGGVVTSYLFWYIRYPGQSLQFLLKYTSGDTLVKGMKGFEAELRKNESSFHLKKHSARLSDSAQYFCAVS
Propithecus coquereli V595 trdv JZKE01143872.1 11971 STVAQKVTQAQTARSMTVGRTVSLNCRYETSWNYYYIFWYKQLPSKEMIFLLYQYSGNQNAKDGRYSVNFRKEVKSIDLTISALRLEDSAKYYCALAE
Propithecus coquereli V596 trav JZKE01143872.1 849 LNGQEVKQIPQFLHIQEGEDFSTYCNSTSTLNTVQWYKQRPGGSPVLLMILVKSGEVKKEKRLTAQFGETRKDSSLHITAAQTADVGTYFCAV
Propithecus coquereli V597 trdv JZKE01143873.1 10885 STVAQKVTQYQATTSMTEGQAVTLNCQYETSSTTYFICWYKQLPSKEMIFLLRQGSTSQNAKDGRYSVNFRKEAKSINLTISALRLEDSAKYFCALWD
Propithecus coquereli V598 trdv JZKE01143873.1 2777 SVAQKVTQSQSARSTTEGRAVTLNCRYETSWSYYYIFWYKQLPSKEMIFLLRQDSDGGNANNGRYSVSFRKEVKSIDLTISALRLEDSAKYYCALAE
Propithecus coquereli V599 trdv JZKE01143874.1 1378 STVAQKVTQAQTATTRTVGQAVTLNCQYEASWSSYYIYWYKQLPSNEMIFLLRQYSGDQNAKNGRYSINFQKEAKSIDLTISALRLEDSAKYFCALWD
Propithecus coquereli V600 trdv JZKE01143880.1 2829 SNVAQKVTQAQTATSMTVGQAVTLNCQYETSWSAFSILWYKQLPSKEMIFLLRQVSGSSNAKNGRYSVNFQREANSIDLIISPLRVEDSAKYFCALWE
Propithecus coquereli V601 trav JZKE01143882.1 1133 VRGIKVEQSPPDLSLREGASSMLWCNFSAASSTVQWFRQNLGGRLINLFYIPSGTKQIGRLTATTVTKERHSSLYISSSQITDAAIYFCAVEP
Propithecus coquereli V602 trav JZKE01143889.1 2177 SSISQKVTQAHAAISMLERKAVTLDCVYEAIAFSYYLFWYKQPPNGEMILLIDQESFNEQNATKGRYCLNFQKSAGSISLTITALRLGDSAMYFCALRE
Propithecus coquereli V603 trav JZKE01143890.1 3772 RSNGDSVTQTEGTVTLPEGAPVILNCTYETTYSVSYLFWYVQYLNQSPQLLLKSSTENQRGENRGFQANLVKSDKSFHLEKSSLRMSDSAVYYCALS
Propithecus coquereli V604 trav JZKE01143891.1 13353 GTNGDSVTQTEGPVTLPEGEALTLNCTYQSSYAAFLFWYVQFQNKEPVLLLKSSSETQEMDSRGFQANNVKSDSSFHLKKPSVQLSDSAVYYCAMR
Propithecus coquereli V605 trav JZKE01143891.1 6349 PSMAQKVTQAQPEISVVEKESVTLDCVYETRDPTYYLFWYKQPPSGEMIFLIRQDSFNEKNETKDRYFLNLQKSTSSISLTITASQLMDSAVYFCALRE
Propithecus coquereli V606 trav JZKE01143893.1 6772 GARAQRVTQPEECLSVFKGAPVQLKCNYSYSGSPVLFWYVQYPKQGLQVLLKHISGESVKGFTAVLNKGEATFHLEKTSVQEEDSAMYYCALS
Propithecus coquereli V607 trav JZKE01143893.1 2784 VNSQQGEENPQALSIQEGENATINCSYKSSISNLQWYRQDSGRGLTLLILIRANKREEHHGRLTVTLNTSIKSSSLIITASCAADSATYFCATD
Propithecus coquereli V608 trav JZKE01143895.1 22370 GVRGLLVQQSPSVLSLQEGTSSTLRCNFSTTVTSMQWFRQHPGGGLISLFFMASGTKQNGRLNSTMNSKELYSTLHITASQLEDSGTYLCAAQE
Propithecus coquereli V609 trav JZKE01143895.1 16012 VSGGENVGLHPPTLNVQEGDTSVINCTYSNSASNYFPWYKQELGKGPQFIIDIRSNMDNKQEQRFTVLLNKTAKHLSLHIAGTQAGDSAVYFCAES
Propithecus coquereli V610 trav JZKE01143895.1 12673 AGIAQKVTQSQPAMSVQEKEAVTLDCTYDTSTSVTSYTLFWYKQPSSGEMILLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQVGDSAIYFCALSE
Propithecus coquereli V611 trav JZKE01143895.1 5816 VRSQQKEVEQTPESLSVSEGATASLNCTYSNTASQYFTWYRQYSGKGPELLVSIYSNGDKEEERFTVHLNMASRYVSLLIRDSQPSDSATYLCAV
Propithecus coquereli V612 trav JZKE01143895.1 1315 GTGAQTVTQPDLHVTVTEGASLELRCNYSVSFTPSLWWYVQYPNQGLQLLLKYVSGSTLVKGIQGFEAEFRKNESSFHLRKTFAHLSDSAQYFCAVS
Propithecus coquereli V613 trav JZKE01143896.1 18636 VRGGENMGLHPPNLSVQEGDTSVINCTYSNSNSDYFCWYKQEPGKGPQFIMDIRSNKDKKQEGRFTILLNKMAKHLSLHIAGTQAGDSAAYLCAES
Propithecus coquereli V614 trav JZKE01143896.1 11552 SGIAQKVTQVQPAMLVQEKEAVTLDCTYDTSDSRYTLFWYKQPSSGEMLLLIRQDSYNQQNATEGRYSLNFQKANKSIKLVISASQVGDSAIYFCALME
Propithecus coquereli V615 trav JZKE01143896.1 4253 VRSQQKEVEQTPESLSVSEGATASLNCTYSNTASQYFAWYRQYSGKGPELPVSIYSTGDKEEEGRFTVQLNKGSRYVSLLIRDSQPSDSATYLCAV
Propithecus coquereli V616 trav JZKE01143897.1 4935 GVRGLQVQQSPSVLSLQEGTSPTLRCNFSATVKSMQWFQQHPGGGLISLFFMASGTKQNGRLNSTMNSKELYSTLHITASQLEDSGTYLCAAQE
Propithecus coquereli V617 trav JZKE01143902.1 1075 VRSQQKEVEQTPESLSVSEGATASLNCTYSNTASQYFAWYRQYSGKGPELLVFIYSTGDKEEGRFTVQLNKASRYVSLLIRDSQPSDSATYLCAV
Propithecus coquereli V618 trav JZKE01143903.1 1157 RTHGDSVTQMEGQVTLSEEAFLTINCTYTATGYPALFWYVQYPGEGPQLLLKATKANDKGINKGFEATYKRETTSFHLEKASVHESDSAVYYCALS
Propithecus coquereli V619 trav JZKE01143910.1 52497 VSGKNQVEQGPQSLIIPEGENCTLQCNYTVSPFNNLRWYKQETGRGPVSLIIMNYSKSKESNGRYTATLDASAKQSSLHITASQLSDSASYICVAS
Propithecus coquereli V620 trav JZKE01143910.1 32147 GTGAQTVTQPDLHVTVTQGAFLELRCNYSVSFTPFLWWYVQYPNQGLQLLLKYVSGNTLVKGIQGFEAEFRKNESSFHLRKTFAHLSDSAQYFCAVS
Propithecus coquereli V621 trav JZKE01143910.1 26927 DARAQSVTQPDGHITISEGDSLELRCKYSYGATPTLFWYVQYPGQGLQPLLRYYSGNTLVQGIKGFEAEVRKNESSFTLRKPSVPWSDAAVYFCALS
Propithecus coquereli V622 trav JZKE01143910.1 17519 GVRGLQVQQSPSVLSLQEGTSPTLRCNFSTTVYSMQWFRQNPGGGLISLFFIISGTKQNGRLNSTMSSKERYSTLHITVSQLEDSGTYLCAAQE
Propithecus coquereli V623 trav JZKE01143910.1 9358 VSGGENVGLHPPTLNVQEGDTSVINCTYSDSASIYFPWYKQELGKGPQFITDIRSNMDNKQEQRFTVLLNKTAKHLSLHIAGTQAGDSAVYFCAES
Propithecus coquereli V624 trav JZKE01143910.1 1560 AGVAQKVTQSQPAMLVQEKEAVTLDCTYDTSDSSYGLFWYKQPSSGEMLLLIRQDSYNQQNATEGRYSLNFQKARKSIHLVISALQLGDSAIYFCALSE
Propithecus coquereli V625 trav JZKE01143913.1 1252 RTYGNTVTQGEGQVTLSEGAFLTINCTYTSTGYPTLFWYVQYPGEGPQLFLKATQANDKAINKGFEATYKRETTSFHLEKASVHESDSAMYYCVLS
Propithecus coquereli V626 trav JZKE01143915.1 15316 EVRGLQVQQSPSVLSLQEGTSPTLRCNFSATVYNMQWFRQNPGGGLISLFFMTSGTKQNGRLNSTMNSKELYSTLHITASQLEDSGTYLCAVQE
Propithecus coquereli V627 trav JZKE01143915.1 8428 VSRGENVEQRPSTLHVQEGDTSVINCTYSDSASSYFPWYKQELGKGPQLFIDIRSNLDKKQDQRITLLLNRMTKHLSLHIAATQPGDSAVYFCVAS
Propithecus coquereli V628 trav JZKE01143915.1 1526 SSITQKVTQDQPAMLVQEKEAVTLDCTYDTSTSVNNFALFWYKQPSSGEMLLLIRQDSYNQQNATEGRYSLNFQKAKKSIHLLISASQLEDSAMYFCALKK
Propithecus coquereli V629 trav JZKE01143916.1 55902 GLRAQSVTQPEDQVTVSEGNPLTVKCTYSYSGSPYLFWYVQYPNEGLQFLLKYIRGDNLVKGSHGFEAEFNKSQTSFHLKKASACGSDSALYFCAVS
Propithecus coquereli V630 trav JZKE01143916.1 46233 TLSLAKTTQPIAMESYEGQEVNIPCSHTDIATNDYIFWYQQFPNQGPRFIIQGYKTNVTNEVAFLFIPADRKSSTLSLPRVALSDTAVYYCILA
Propithecus coquereli V631 trav JZKE01143916.1 38589 GTRAQSVTQPDGHITVSEGDPLELRCNYSSSVPPSLFWYVQYPNQGLQLLLKYTSGNSLVTGIKSFKAEFNRSETSFQLKKASAHLSDSAQYFCAVS
Propithecus coquereli V632 trav JZKE01143916.1 31389 ISRGEKVEQSPFLSVQEGDSSVINCTYTESTSTYFYWYKQGPGEGPQLLMTILSSMDKKQEQRLSVLLNKREKHLSLHISDTQPGDSAVYFCAVS
Propithecus coquereli V633 trav JZKE01143916.1 29793 VNSQKIEQNPRALNIHEGETAAVTCNYTSYSPAFLQWYRQDPERGLVFLLLIRENEGEKQEGRLKVTFDTTHKQSSFYITDSQPADSATYLCAA
Propithecus coquereli V634 trav JZKE01143916.1 20946 DVSAQSVTQPDGHVTVSEGYSLELRCNYSYGGAFYLFWYVQFPGQGLQLLLRYLSGDTLVKGIKGFEAELRKSESSFNLRKPFVHWSDAAEYFCALS
Propithecus coquereli V635 trav JZKE01143916.1 10692 GSHGDSVTQTDGQMLLTEGDSLIVNCSYETRQYPALFWYVQYPGEGLQLLLKAAKANDKGINKGFEATYNRETTSFHLEKASVHVSDSAVYYCALS
Propithecus coquereli V636 trav JZKE01143916.1 5007 DARAQSVTQPDLSITVSEGASLELRCNYSYRGGNVYLFWYVQYPGQGLQLLLRYYSGNTLVQGMKGFEAEVRKNEFSFTLRKPSVHWSDAAEYFCALS
Propithecus coquereli V637 trav JZKE01143925.1 416 AAGQSIEQPSELTAVEGAFIQVNCTYRTSAFNGLSWYQQHDGRAPIFLSYSVLDGLEGRGHFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Propithecus coquereli V691 trbv JZKE01196378.1 1040 HTDAGITQNPRFRVTETGKQVTLRCHQTDKYDYMYWYRQDLGRGLRLIHYSYGVQRTDKGEFSEGYNVSRSDMEDFPLTLESATPSQTSVYFCAISD
Propithecus coquereli V752 ighv JZKE01235368.1 1795 VQCQVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMYWVRQAPGKGLEWVSSINYGGGSTYYADGVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Propithecus coquereli V759 iglv JZKE01238797.1 14482 SWAQSALTQPPSVSGAPGQTVTISCTGSSSNIGGGYYASWYQQLPGSAPKLLIYYDSDRPSGIPARFSGSKSGSSASLTITGLQAEDEADYYCAAW
Propithecus coquereli V760 iglv JZKE01238797.1 10244 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGDNYVSWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDSSA
Propithecus coquereli V761 iglv JZKE01238799.1 5020 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGSYYVHWYQQRPGSAPTTVIYNDNQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDSSA
Propithecus coquereli V762 iglv JZKE01238800.1 1172 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYAIYWYQQKPGSPPRYLLSYYSDSSKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCMA
Propithecus coquereli V763 iglv JZKE01238817.1 729 RWAEVVFTQPHSVSGSPGQKVIISCTRSSGNVGDNYVSWYQQRPGSAPTAVIYDDDQRPSGVPDRFSGSIDSSSNSASLIISGLQPDDDADYHCLSGYDNYY
Propithecus coquereli V773 ighv JZKE01255181.1 2309 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSDYYMHWVRQAPGKGLEWVSYISSSGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCVR
Propithecus coquereli V774 ighv JZKE01255182.1 5984 VQCEVQLVESGGGLVQPGGSLTFSCAASGFTFSSYNMHWVRQAPGKGLEWVSYISNTGGSTYYAEAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAG
Propithecus coquereli V807 ighv JZKE01278248.1 3152 VQCEVQLVESGGGLIQPGGSLTLSCAASGFTISSYYMDWVRQASGKGLEWVSAISSGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V808 ighv JZKE01278249.1 1625 IQCEVHLVESGGGLVQPGASLKLSCAASGFSFSSYGMNWVRQAPGKGLEWVSHIDYDAGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAMYYCAR
Propithecus coquereli V809 ighv JZKE01278253.1 1602 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVSYIYSDGGDTNHADAVKGRFTTSTDNGKNMLYLQMNSLRAEDTAVYYCAR
Propithecus coquereli V810 ighv JZKE01278255.1 2595 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMYWVRQAPGKGLEWVSSINSGGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Propithecus coquereli V811 ighv JZKE01278267.1 545 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWARQAPGKGLEWVSTINYDGSSTSYADAVKGRFTISRDNSKNTIYLQMNSLRAEDTAVYYCAK
Propithecus coquereli V812 ighv JZKE01278268.1 929 VQCEVQLVESGGGLVQPGGSLTLSCVASGFTFSSYYMHWVRQAPGKGLEWVSYINTAGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V813 ighv JZKE01278271.1 14424 VQCEVQLVESGGGLAQPGGSLTLSCAASGFTFSNYGMHWVRQAPGKGLEWVSAISSGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRTEDTAVYYCAK
Propithecus coquereli V814 ighv JZKE01278271.1 7070 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYDMSWVRQAPGKGLEWVAVIWADGSKQYYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTAMYYCAS
Propithecus coquereli V815 ighv JZKE01278273.1 1456 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYVMYWFRQAPGKGLEWVSRISSSGGSTSYADALKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Propithecus coquereli V816 ighv JZKE01278276.1 1158 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYGMNWVRQAPGKGLEWISHINYDAGSTYYADAVKGRFTISRDNSKNTLSLQMNSLKAEDTAVYYCAK
Propithecus coquereli V817 ighv JZKE01278277.1 5362 VQCEVQLVESGGGLVQPGGSLTLSCAVSGFTVSSYGMNWVRQAPGKGLEWVSYIYSDGGSTNYADAVKGRFTTSTDKSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V818 ighv JZKE01278282.1 3600 VLSEDHLVQWGEGVVVSSQKLSLTCAAYTYSVTRHSMSWVRLPQGKGLEWIGVIRANGNTNYNPNLQSRVSISRNTNKNQVFLELRSVTAEDAGTYYCAQ
Propithecus coquereli V819 ighv JZKE01278602.1 6174 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMSWVRQAPGKGLEWVSTISHTGGSTYYADALKGRFTISRDNSKNTLSLQMNSLRTEDTAVYYCAR
Propithecus coquereli V820 ighv JZKE01278602.1 1587 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYVMYWFRQSPGKGLEWVSRISSSGGSTSYADALKGRITISRDNSKNTLSLQMNSLRAEDTAVYYCAI
Propithecus coquereli V821 ighv JZKE01278605.1 8816 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSDYYMSWVRQAPGKGLEWVSRISSDGTSTYYADAVKGRFTISRDNSKNTLSLQMNSLQAEDTAVYYCAR
Propithecus coquereli V822 ighv JZKE01278607.1 4022 VQCEVQLVESGGGLVQPGGSLTLSCAASGFSFSSYWMHWVRQAPGKGLEWVSYINSAGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V823 ighv JZKE01278609.1 1822 VQCEVQLVESGGGLIQPGGSLTLSCAASGFSFSSYRMNWVRQAPGKGLEWISYISSGGGSTYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V824 ighv JZKE01278610.1 13601 VQCEVQLVESGGGLVQPGGSLTLSCAASGFSFSSYDMSWVRQAPGKGLEWVSYINYGGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRADDTAVYYCAS
Propithecus coquereli V825 ighv JZKE01278610.1 4850 VHCEVQLVESGGGLVQPGGSLTLSCAASGFTVSSYCMSWVRQAPGKGLEWVSYIYSDGGSRNYADAVKGRFTTSTDNGKNTLYLQMNSLRAEDTALYYCAR
Propithecus coquereli V826 ighv JZKE01278611.1 12078 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWVRQAPGKGLEWVLYIYSDDGDTSYADAVKGRFTISTDNGKNMLYLQMNSLRAEDTAVYYCAR
Propithecus coquereli V827 ighv JZKE01278611.1 5778 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYGMNWVRQTPGKGLEWISYINSAGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Propithecus coquereli V828 ighv JZKE01278614.1 2133 VQCEVQLVESGGGLVQPGGSLTLSCAVSGFTVSSYDMSWIRQASGKGLEWVSYISYGGSTYYADAVKGRFTISRDNGKNTLSLQMNSLRTEDTAVYYCAR
Propithecus coquereli V848 trbv JZKE01294658.1 2375 SVLAVLVSQTPSRVICQRGTSVTIQCHVDSQVSLMFWYRQLPGQNLMLMATANQGSEATYENRFTKDKFPISRPNLTFSNMTVSNVSPEDSSLYLCSAG
Propithecus coquereli V849 trbv JZKE01294660.1 3535 PVEAQVTQTPRNRITETGKNVTVTCSQNMNHEYMSWYRQDPGLGLKLIYYSAKVEFVTKGDAPDGYTASRREKPSFSLNVESTRTSQTALYLCASSL
Propithecus coquereli V850 trbv JZKE01294664.1 9002 SMDAGVTQTPRNRIAKTGQSILLECSQTEAHDRMYWYRQDPGLGLWLIYYSLGVNSTNEGEVSKGYSVSRKEHAKFSLSLETAVPNQTALYFCASSH
Propithecus coquereli V851 trbv JZKE01294666.1 1754 SVDTEVTQSPRYLVKGKEQKIKMDCVPKKGHIHVYWYRKKLEEELKFLVYLQNGDIIEKEEIFNDLFSAQCPKNSPCSLEIQSIESGDAALYFCASSQ
Propithecus coquereli V852 trbv JZKE01294668.1 54811 HTDAGITQNPRFRVTETGKQVTLRCHQTDKHDYMYWYRQDLGHGLRLIHYSIGAGNTEKGQFSDGYSVSRSNEQNFSLTLESATPSQTSVYFCASSD
Propithecus coquereli V853 trbv JZKE01294668.1 34803 HIAAGVTQFPSSEVVEKDQAVTLRCDPISGHESLFWYRRTVGKEMEFLIYFLKENIQDESGMPKDRFSAERTKGTHSTLKIQPAELEDSGVYFCASSL
Propithecus coquereli V854 trbv JZKE01294668.1 29185 HAGAMVMQNPRYQVTRVGKTVTLSCSQNMNHNTMYWYQQKLSQAPKLLFYYYEREFNNETDTSDNFQPSRPDTSSSSLDIRSPGLGDSAMYLCATSR
Propithecus coquereli V855 trbv JZKE01294668.1 22381 SSGEEVTQTPGHLLKGKGQKVKMYCVPIKGHRYVFWYQQILGKEFKFLFSFQDKEIFEETEMLKQRFSAECPQNLPCSLEIQTAELQDSAVYLCASSE
Propithecus coquereli V856 trbv JZKE01294668.1 20600 HAEPAVSQTPSYQVTQMGQGVILRCDPISGHIFLYWYQQNHRQEMKFLLSFHYQNIAAESAMPKERFSAERPNGTYSTLKIRPAEPGDSAVYLCASGS
Propithecus coquereli V857 trbv JZKE01294669.1 21578 HMGAGVSQSPRHKITMRGQNVTLRCDPISGYTFLFWYQQTLGQGPQLLIYFQDKDVVDKSKLTGDRISAERPEGSFSRLKIQPAEQGDSAVYLCASSL
Propithecus coquereli V858 trbv JZKE01294669.1 12924 PTEAGVTQTPRHLIKARGQQVTLRCSPVSGHNRVYWYQQALGQGLQFLIQYYNGEEGEKGNFPARFSGHQFSDYRSELNMSALELGDSALYLCASN
Propithecus coquereli V859 trbv JZKE01294669.1 2694 PGDAGVIQSPRHLIKGKQETTILKCYPLSGHDTVYWYQQAPGQGLQFLISYYEKMQREKGNIPQRFSGQQFADYHSELNLSSLEPGDSALYLCASSL
Propithecus coquereli V860 trbv JZKE01294672.1 3349 HTGAGVSQSPRHKVTERGQNVSLRCDPISGHVSLFWYRQTPGQGLQLLIYFQGADATDKSGLPSDRISAERPEGSFSTLKIQPAEQGDSAVYLCASSL
Propithecus coquereli V861 trbv JZKE01294688.1 5170 LAEAGVTQTPRHLIKARGQQVTLRCSPVSGHASVYWYQQALGQGPQFLIQYYDGEEGEKGNFPARFSGHQFSDYRSELNMSALELGDSALYLCDSS
Propithecus coquereli V862 trbv JZKE01294690.1 1365 PLDTAVFQTPKYLVSQMGNNVSLKCKQTLGHNTMYWYKQDSEKLLKIMFAYNNKELILNETVSNRFSPASPDKAHLNLHIESPEPDDSAVYLCASSY
Propithecus coquereli V863 trbv JZKE01294692.1 2101 PVDTGITQTPRHLVMGMTDKKSLKCEQNLGHDAMYWYKQSAKKPPELMFYYNYQELRENLTVSSRFSPECPDSSHLYLHLDALQPDDSAMYLCASSQ
Propithecus coquereli V864 trbv JZKE01294699.1 1749 PMDTAVFQTPKYLLTETGNNVSLKCEQTLGNDAMYWYKQDSEKLLKIMFTYNNKELILNETVSNRFSPGSPDKAHLNLHIESPEAGDSAVYLCASSY
Propithecus coquereli V865 trbv JZKE01294700.1 4067 HTEPGVIQTPTYQVIEKGQEVILRCDPISGHLYFYWYQQIWGQKVEFLVSFYNDNISEKSKIFKDRFSLERPRGSYLALKIQSTEPEDSATYLCASSP