WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Octodon degus AJSA00000000.1 (AJSA01) 355 123 44 78 54 24 16 16
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Octodon degus V138 trbv AJSA01059755.1 7056 VRAQTVHQWPATEVQPVGSTLSLECSVKGKSNPNLYWYRQVAGGSLLLLFYSINVGEVTSEAPQNFSASRPKDGQFILSSKKLLLSDSGFYLCAWS
Octodon degus V144 trgv AJSA01065479.1 694 GSQTSGLEGGMTSVTRKPGSYIIITCNIHKEENYIHWYLVQEGQAPRRLLYYDFFTSKTVDSEFNSGKYHVYEGTERSYKFVLRNVEESDSGVYYCAVWA
Octodon degus V145 trgv AJSA01065480.1 4051 GLGVNTMEQSQISVSTELKKRADIHCKVSANNFELDRIHWYLQKQGQALEHLVQVVSLATPAQGRNNRILARKISATRSSILTINYAEKEDEAIYYCAGLD
Octodon degus V146 trgv AJSA01065484.1 3902 GLGVNTMEQSQISVSTELKKSADIYCKVSANNFESDRIHWYLQKQGQALEHLVQVASSTTPAQGRNNRILARKISATRSSILTINYVTTQDEAIYYCAGWG
Octodon degus V147 trgv AJSA01065486.1 165 LLGHLEQNEISISRARETTHLSCNTSVVNFNSVPTHWYQLKLNQGFEYLFYVLAIPLQCGNKIEASKHSGSSMSTLKINYLEKEGEATYYCAYWE
Octodon degus V148 trgv AJSA01065486.1 5169 GLGLNTVEQSQISVSTGLTKRADIHCKVSTDSFASESIFWYRQKQGQALEHLVQVLSTENPAQGTISRVTASKMSATLSSILTIRRVEKEDEALYYCAGWA
Octodon degus V149 trgv AJSA01065486.1 16505 GLGLNAVEQSQISVSTDLNKRADIHCKVSTDDFESDYIHWYRQKQGQALEHLVLVVSTTNPGQGTISSVTASKILATLSSILTIRRVEKEDEALYYCAGWT
Octodon degus V150 trgv AJSA01065488.1 2129 GLGLNTVEQSQISVSTDLNKRADIHCKVSTDSFASDRIQWYRQKQGQALEHLVLVISTENPAQGTISRVTASKRLETLSSILTIRRIEKEDEALYYCAGWT
Octodon degus V151 trgv AJSA01065488.1 14925 GLGVKTMGQPQISVTTELKKRVDIRCKISPDDFEYDSIHWYWVKKDQALEHLVQIVSSTIPAQGRNNRVSVRKNFATLSSILTINYVEKEDEAIYYCAAWE
Octodon degus V152 trgv AJSA01065502.1 6757 GLGVTKLEQSQISVSTTVDKSADLRCKVWSIRFQTKPIHWYLQKPNQALEHLIQVTAIRTSARTKNKRVLAKKDSETLSSILTINNVEKEDEATYYCAGWD
Octodon degus V153 trgv AJSA01065515.1 5288 GSQTPSNMEGGMVSVTRNPGSHLTISCDLRAGRSYTHWYRFQEGQVPQRLLYYDFSSSKAVLDSGFKPGKYNAYQATEHSNKFVLRSVEEGDAGVYYCAVWT
Octodon degus V154 trgv AJSA01065515.1 18174 GSQTSSNMEGGMVSVTRNPGSHVTISCDLRAGRSYTHWYRFQEGQAPQLLLYYDVSSSKAVLDSGLRPGKFNAYQVSEFSNKLIVQNLEEGDAGVYYCAVWT
Octodon degus V155 trgv AJSA01065518.1 5265 RQTTHNREGGIVSVTKKRGSHLTITCDLRAGKSYVHWYRFQEGQAPQRLLYYGFSKTVLDSGLRPGKYNAYQAAEHINTFVVRSVEEGDAGVYYCAVWT
Octodon degus V156 trgv AJSA01065518.1 11596 GSQTSSNVEEGMTVMNRPRGSYVEITCTIHIKTNYIHWYRFQEGTVPRRLLYYDFSNSKAVLDSGLPKGKFDAYVGTAKNSKFVVRNVEASDSGVYYCAAWT
Octodon degus V157 trgv AJSA01065520.1 23542 ALGQLEQPEIVISRATDKSASMACKASIRGFGSKTIYWYRQKPNEGLKHLLYVSGSTNKVNFGGKKNKFEASKSSKTSTSALKINFLEKGDEAVYYCAYWTGG
Octodon degus V158 trgv AJSA01065520.1 27346 ALGQLEQPEVVISRATDKSASMACKASFSGFATTAIHWYRQKPNEGLEHLLYAWVSTSKASFGGKKNKFEASKNTKASTSTLKINFLEKGDEAVYYCAYWIGS
Octodon degus V159 trgv AJSA01065523.1 6206 GMGQLEQPEISISRARDESIQIPCKASISNFKNVDIHWYRQKLNQGFEHLMYVRTAYNQRPLGGVNKKLETSKNFDTSTSNLKINFLKKEDEATYYCTYWD
Octodon degus V307 trdv AJSA01121897.1 45379 ARTQVVQVNDSMYGFIGTDVVLHCSFANPMPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVQFLRPSFIDGTIRLSRLELEDEGVYICEF
Octodon degus V434 igkv AJSA01184213.1 53 SSGDVVMTQSPLSLSVTPGQQVSISCRSSQSLVYSNGNTYLDWFLQKPGQAPQLLIYQVSSRFSGVSDRFSGSGAATDFTLKISNMQAEDAGVYYCMQA
Octodon degus V435 igkv AJSA01184215.1 1332 VRSDIQMTQSPASLSASPGDTVTMRCRASQNIISELDWYQQKPGQAPRLLIYHVSNLHSGVPPRFSGSGSGTDFTLTISSLQPEDFATYYCRQDYSYPF
Octodon degus V436 igkv AJSA01184216.1 2837 SSGDVVLTQTPGFLSFSPGEPVSISCRASQSVAGTFSTYLHWYLQKPGQSPRLLSYEVTNRASGVPDRFSGSGSRTEFTLKISRVEAEDAGVYFCQQSWHDP
Octodon degus V437 igkv AJSA01184217.1 15098 VNCDIQMIQSPPSLSASLGNRITISCRASEDIQGFLSWYQQKPEDSPRLLIYAASSLASGVPPRFSGSGSGTDYTPSISDLQAQDSATYYCLQYYQSP
Octodon degus V438 igkv AJSA01184217.1 25096 GRGDIQLTQAPSVSASLGERVSITCRASQNIGTALHWYQQKTGQVPKLLIYYATSLQSGVPSRFSGSRSGTDFTLAISSLESEDAATYYCQHSYDWP
Octodon degus V439 igkv AJSA01184218.1 4261 VCCDIQMTQSPSSLSASLGDSVTIRCQASQGINSYLNWYQQKPGNAPSLLIYNTKNLHSGVPSRFSGSGSGTDYTLTISNLQPEDVATYYCM
Octodon degus V440 igkv AJSA01184221.1 6576 GRGDIQLTQAPSVSASLGERVTISCRASQGISSSLHWYQHKPGQAPKLLIRYATTVQSGVPSRFSGSGSGTEFTLTISSLESEDVATYFCQQSYSWP
Octodon degus V441 igkv AJSA01184223.1 4306 GRCDIQLTQAPSVSASLGERVTITCRASQGISNNLHWYQQKPGQAPKLLIYYATNLQSGVPSRFSGSGSGTDFTLTISSLQPEDAAAYYCQQYYSS
Octodon degus V442 igkv AJSA01184224.1 6532 GRGDIQLTQAPSVSASLGESVTITCRASQGISVSLHWFQQQPGQAPKLLIAYTNQLPSGVPSRFSGSGSGTDFTLTINGLESEDLATYYCLQTSRFP
Octodon degus V443 igkv AJSA01184224.1 10210 SVGNAVLTQSPGSLSVTPGESVSISCRSSKSLLQTDRFTYLSWFLQKPGRPPKRLMYVVSRRDPGSPDRFSGSGSETDFTLQISSVAVGDAGIYYCQQ
Octodon degus V444 igkv AJSA01184227.1 8641 SNGDIVLTQAPASVAASQGQKVTITCTASSSISSSYLHWYQQKPGASPKLLIYGTSNLASGVPARFSGSGSGTSYSLSISSVEAEDAATYYCQQGYNFP
Octodon degus V445 igkv AJSA01184240.1 17229 SNGDIVLTQSPTSLTVSQGEQVTITCTVSTDVSTSYLHWYQEKPRASPTLLVYSTYYLTSGVPARFSGSGSGTSYSLTISRVEAEDTVVYYCQQSNSY
Octodon degus V446 igkv AJSA01184244.1 314 ARCAVQVTQSPTSISAAVGDTVTITCTASQNIFYYMNWYQQKPGEAPKWLIYAADTLQPGVPSRFSGSGSMSGTHFTLTLSNVQPEDVATYFCLQYSRIGP
Octodon degus V447 igkv AJSA01184244.1 44153 ARCAVQVTQSPTSISAAVGDTVTITCTASQNIFYYMNWYQQKPGEAPKWLIYAADRLETGIPSRFSGSGTGTHFTLTISGVQPEDVATYFCLYYST
Octodon degus V448 igkv AJSA01184259.1 4375 VCGDIVLTQSPRTLAVSAGESATIRCKASQSLQSGSSNYLAWYQQKPGQSPRLLIYYASTRASGVPDRFSGSGSGTDFTLTINNVQAEDIANYYCQQHYSTP
Octodon degus V449 igkv AJSA01184260.1 4943 VCSDIVMTQSPRSLAVSPGESVTIHCTSSQSLLSSSNKKNYLAWYQQKPGQSPKLLIYYASTRASGVPDRFSGSGSGTDFTLTINSLQAEDVADYYCQQGFSSP
Octodon degus V450 igkv AJSA01184261.1 12209 VCSDIVLTQSPRSLAVSPGESTIIHCKASQSLLYSANNKNYLAWYQQKPGQSPRRLIYYASTRESGVPDRFSGSGSGTDFTLTINNLQAEDIADYYCQQGRSIP
Octodon degus V451 igkv AJSA01184264.1 9640 SWGDIVMTQSPLSLSISPGEPASISCTSSQSLLYSDGKTYLNWVVHKPGQAPRRMIYLVSKRDSWVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCWQGSYA
Octodon degus V452 igkv AJSA01184264.1 16125 SRGDVVLTQTPQVLSVTPGQSASISCRSSQNLVYSNGKTYLHWTVRKPGQAPQGLIYLVSNRNPGISDRISGGGSGTDFTLTIRRVEAEDTGVYYCLQN
Octodon degus V453 igkv AJSA01184264.1 20658 CKGDAVLTQTPLFPSISPGEPASTSCRSSQSLLNSAENTFLSWVVHKPDQSARGLIYLVSNRNPGISDRISGSGSGTDFTLTISRVEAADAGVYYCFQGTHDP
Octodon degus V454 igkv AJSA01184264.1 27709 STGDAVLTQSPLSLSVTPGESASIACRSSQSLVYSDGKTYLHWIVHKPGQAPQGLIYLVSNRNPGISDRISGSGSGTDFTLTISRVEADDAGVYYCFQGTHD
Octodon degus V455 igkv AJSA01184267.1 1143 SMGDVVLTQTPQVLSVSLGGTASFSCRSSQSLLYRDGNTHLHWVVHKPGQAPRDLIYLISNRIHGISDRISGSGSGTDFTLTISRVEAEDTGVYYCLQGTHHP
Octodon degus V456 igkv AJSA01184272.1 1092 SRGDVVLTQTPQVLSVSLGGTASFSCRSSQSLLYSDGNTYLHWMVHKPGQAPRGLIYLVSNQNPGISDRISGSGSGTDFTLTISRVEAEDAGVYYCWQNTHD
Octodon degus V457 igkv AJSA01184273.1 63 SRGDVVLTQTPQVLSVSLGGTASFSCRSSQSLLDSDGDSYLHWMVHKPGQAPRGLIYLVSTRIPGISDRISGSGSGTDFTLTISRVEAEDAGVYYCWQSTHD
Octodon degus V458 igkv AJSA01184277.1 7642 SRGDVVLTQTPQVLSISLGGTASFSCRSSQSLLHRTGNTYLYWIVHKPGQAPWGLIYLVSNRNPGISDRISGSGSGTDFTLTISRVEAEDAGLYYCLQGTHD
Octodon degus V459 igkv AJSA01184279.1 1929 TTGDVVLTQTPLSLSVSPGEPASISCRSSQSLLYSDGKTYLSWVVQKPGQAPRCMIYQVSKRDSWVPDRFSGSGSGTDFTLTISRVEAEDAGVYYCWQGLYA
Octodon degus V460 igkv AJSA01184280.1 5965 STGDVVMTQNPLTLSISPGEPASISCRSSQSLLYSDGNTYLNWIVHKPGQAPRRMIYKVSQKYSWVPDRFSSSGSGTDFTLTISRVEAEDAAVYYCWQG
Octodon degus V461 igkv AJSA01184290.1 3538 VCSDIVLTQSPTSLAVSPGESATIHCKASQSLLYSSDKKNYLAWYQQKPGQSPRLLIYYASTRASGVPDRFSGSGSGKDFTLTISSLQADDVADYYCLQSYSSP
Octodon degus V547 ighv AJSA01218421.1 10971 VLSQGQLQETGPGLLRPSQTLSLTCSVSGYFISSGHSWTWIRQPQGKGMQWVGRIDRAGGTVYEPSLKSRVSISRDMPKNQFSLQPNSVTAEDTALYYCAR
Octodon degus V553 trav AJSA01223378.1 152 VRGLQVEQSPPAQILQEGANSTLSCKFSDTVTNVQWFRQDPGGCLVSLFYIPSGTKQSGRLKGTTVAKERHSSLSVSSSRPTDSATYFCATAHSDPQ
Octodon degus V554 trdv AJSA01223381.1 2289 PSMAQKVTQVQPPTARREGETVTLDCSYETSWSSYYIFWYQQLPSGKMIFLIRQGSSSTSGKSGRYSVRKAGSSMSLMITALQMEDSGKYFCALWE
Octodon degus V555 trdv AJSA01223385.1 2553 GNSSPAASVSTGDGGTVTLSCTYDTSEYNFGLFWYKQPCSGEMVFLIRQNSYDQQNATEGRYSVNFQKASKSIHLVISASQLEDSAMYFCALRE
Octodon degus V557 trav AJSA01223388.1 352 VRGQQVQQKPPARILQEGAQTSIWCNFSTAVQNIQWFRQDPGGCLVSLFYIPSGTKQSGRLKATTVAKECHSSLSISSSWPTDSATYFCAAAH
Octodon degus V558 trav AJSA01223393.1 3442 GSGAQSVAQPDLRVTVTEGDPLLLKCNYTYGATPYLFWYIQRPGQGLQLLLKYTSGSALVTDSRGFEAEFKKSESSFHLQKASARRSDAALYFCALG
Octodon degus V559 trav AJSA01223399.1 9494 VNGQQKEVGQSPESLRVPEGATASLNCTYRDSTSTYFCWYRQCPGRGPELLMSIYSNGDKEEGRFTAQLNTASRHLSLHITDTQHSDSATYLCAV
Octodon degus V560 trav AJSA01223400.1 362 RICGQSVTQMEGPVSIAEGALLTINCSYTASGYTVLFWYVQYPGEGPQFLLKAVKANEKERSKGFEATNDRATSSFHLEKAFVQVSDLGVYYCAVS
Octodon degus V561 trdv AJSA01223407.1 1552 PSVAQNVTQVQPPTSGREAEVATLDCKYEKQSVRDYLLWYKQLPSGEMTFLIWSAPGQTKNTERYSVKFPKASSMSFIISGLQIEDSAKYFCAICT
Octodon degus V562 trav AJSA01223410.1 2916 VRGAQVEQSPSALSLQEGKSPTLRCNFSTTTRSVQWFRQNPEGSLINLLYVAAGTKQSGRLEATLNYQERLSTLKITASELGDSGSYFCAGEAQCSR
Octodon degus V563 trav AJSA01223413.1 3641 VSGQQKEVEQSPESLRVPEGASTSLNCTYRNSASRTFRWYRQYPGKGPELLVSAYSIGDQEEGRFRAHLDKSSRHLSLHIRDAQSLDSATYLCAE
Octodon degus V564 trav AJSA01223414.1 201 DQQQVKQNPPSLTVQEGEISVLNCTYENSAFDYFPWYRQFPGKGPEFLVAIRETMNKKDAGRFTVYFSKGAKELSLLIRTMQPTDSAAYFCAA
Octodon degus V565 trav AJSA01223419.1 1742 TSFAQKVTQAQTVASVQETEAAILNCTYDTTYGNYALLWYKQTSSGEIIVLIRQGSYDQQNAKEGRYSLYLQKASKSVQLVISASQLADSALYFCALL
Octodon degus V566 trav AJSA01223419.1 6561 RTRGDSVTQIGGQVTLSERAVLTINCTYTASGYPTLFWYVQYPGEGPQLLLKAMTANEQGRNKGFEATYNKEASSFHLEKATVEEADSAVYFCAVG
Octodon degus V567 trav AJSA01223419.1 14542 VSGQQEEVEQSPESLGVLEGAIASLNCTYRDSTFRYFWWYRQYPGRGPKLLMSVYSSGDKEEGRFTTQLSTASRHFSLHIRGSQHSDSATYLCAA
Octodon degus V568 trav AJSA01223433.1 1932 IKAQIKVDQSPQVQITQEKRNFYLTCNYSTSVNSVQWFQQSPEGRLISLFYIASGVQQKGRLKATVNFKERYSQLDIRDSRPEDSASYFCAVQ
Octodon degus V569 trdv AJSA01223438.1 5616 SSMAQGITQSQPALTRQEGKAVKLDCSYDTTLSYHILFWYKRSPSGELIFLLSQESNAERNATQGRYSVSFQKAAKAIQLIISPAQPEDSATYFCCLRQ
Octodon degus V570 trav AJSA01223440.1 1106 STGQEKDVVQSVSILSVWERETAVINCSYTDTTFAYFPWYKKVEGRGPILLIDIRSIMDKKQERRFTVLLNKNAKHVSLQIAETQPGDSAVYFCAAG
Octodon degus V571 trdv AJSA01223445.1 2096 SSNAQHQPTDVLYTQEGESVTIDCKITDSFSYYTMYWYQQPSSGKMIYIIHLNSGGWSSRKGRYSVMFQKPVLKLTISALTLSDSAVYFCSVTN
Octodon degus V572 trav AJSA01223451.1 1834 PGTADSITSQETEVSGTEGKTVTLLCNYDASSTGSIVLYWFRQYPNQALEYILHRGWKNSIKGDASFATGRFYSRSTGNSIDLHIRDLTLADAALYYCAMR
Octodon degus V573 trav AJSA01223454.1 884 VGVAQKVTQSQQEISIQEAATATLDCTYDTTDSNYYLFWYKQLRRGQMIFIIRQEAYKQQNATEARFSVNFQKATKSFSLKISGSELADAAMYFCA
Octodon degus V574 trav AJSA01223465.1 966 GTRGNSVEQIGHIVVSEGASVTMDCNYTSKGYPTLFWYVQYPNKSLQFLQRETMENSRNFGSRNIKEKTSPIVKYSVQVSDSAVYYCLLGDTVAKM
Octodon degus V575 trav AJSA01223471.1 3041 SSNAQHQPTDVLYTRERESVTIDCKITVSFSSYVMHWYQQPSSGKMIYITHLYSSSTSSQKGRYSVVFQKPLLKLTISALTLSDSAVYFCTVAD
Octodon degus V578 ighv AJSA01225138.1 9488 VMSQITLKESVPGLVTPSETLRLTCSFSGFSLITYGMGVGWIRQSPGKDLEWLANVWWNDVKNYHLDLKNRLSISKDTSNNQVFLTMNSVDPADIATYYCARG
Octodon degus V579 ighv AJSA01225138.1 14946 VKAEEKLLEPGGGLVQSGGSLRPSCVASGFIFSVYWMSWFHQAPEKRLDLKKGGGSYDPDSMKGQFNISRDEKNTLYLQITTLKTEDTAAYYCG
Octodon degus V580 ighv AJSA01225140.1 12432 VHGQVQLVQSRAELKRPGASVKVSCKASGYSFTSYWISWVQQSPGQGLEWIGNIDPSDGYTNYAQKLQGRVTVTADTSSSTAYMELRSLKSEDTAVYYCA
Octodon degus V581 ighv AJSA01225140.1 21376 VLSQVKLQELGPGLVKPSQTLLLTCSISGDSVSSNNAAWNWVRQPLNKPFEWLGRTYYRSQWYKDYAPSFQGRLTITSDTSKNQFSLQLSSVSIEDTAVYYCAR
Octodon degus V582 ighv AJSA01225142.1 7649 VHLQVQLVQSGPELKRPGESVKVSCKGSGYTFTSYSIFWVKQVPGKGLHYMGWINTETAKPTYAEGFKGRFVLSLDASVSSTYLQISSLQAEDTAMYYCA
Octodon degus V583 ighv AJSA01225145.1 1741 VQAEAPLVATGGGLVQPGGSLRLSCEASDFTFSDSFVQWVRQAPGKGMEWIAEISGNDDSTSYIDSVKGRFTISRDSAKNTLHLQMTELKTEDTAVYYCIK
Octodon degus V584 ighv AJSA01225145.1 9024 ARGQVQLVQSGAELRRPESSVKVSCKASGYSFTGYWMHWVRQSPGQGLEWIGEINPHNGNTNYAQKFRGRATLTADKSSSTAYMELSSLKSEDTAMYYCA
Octodon degus V585 ighv AJSA01225151.1 11459 AQGQVQLVQFGDDLKRPVDSVKVSCMASGYTFTSNEIHWVQQCPGQGLEWIGYIYPGNGNTNYVQKFQGRATITADKSSSMAYMDLRSLKSEDIAVYYCAR
Octodon degus V586 ighv AJSA01225152.1 9795 VLSQVQLQESGPGLLKPSETLSLTCTVSGFSLTSYGVHWIRQFPGKGLEWIGVMRYNGGTAYNPALQSRVGITRDTSKSQVSLTLRSLRSEDTAMYYCAR
Octodon degus V587 ighv AJSA01225153.1 15606 VQVEVQLVESGAGLVQPGGSLRLSCAASGFTFSDYWKSWIRQAPGKGLEWVGEINKDGGSTSYADSVKGRFTISRDNAKNTLYLQMKTLKIEDTAVYFCAR
Octodon degus V588 ighv AJSA01225153.1 19966 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFNNYSMNWVRQAPGKGLEWLAYINWNGGSTSYADSVKGRFTISRDNAKNTLYLQMAKLKTEDTATYYCAK
Octodon degus V589 ighv AJSA01225155.1 20540 VMSQITLKESGPGILRPNETLRLTCSFSGFSLSTSSMGVDWIRQAPGKGLEWLANIWWNDNKYYSPALKSRLSISKDTSNNQVFLTMSSVDPADTATYYCAK
Octodon degus V590 ighv AJSA01225155.1 32900 SQGQVQLVHSGAELKKPGTSMKVSCKTSGYTFTSYDMHWVRQRPGQGLEWIGGIYPGNGNTNYAQKFQGRATLTADKSSSTAYMELSSLKSEDTAMYYCAR
Octodon degus V592 ighv AJSA01225159.1 18387 VLSQVQLQESGPDLLKPSDTLSLTCTVSGFSLTSYGVHWIRQVPGKGLEWIGVMGYSGSTAYNSALQSPVSITRETSKSQVSLTLRSLRSEDTAMYYCAK
Octodon degus V593 ighv AJSA01225163.1 12208 VHCEEQLVESGGGLVQPGGSLTLSCAASGFTFSNYWILWTRQAPGKGLEWIVSILYDGGNTYYADSVKGRFTISIDNAKNTLYLQMTTLKTEETAVYYCVR
Octodon degus V594 ighv AJSA01225164.1 6083 VQAEVQIEESGGGLVQPGGSLRLSCAASGFTFSDYWMSWISQALGKGLEWVGEINKDGGSTSYADSVKGRFTISRDNAKNMLYLQMNTLKIEDTAVYYCAR
Octodon degus V595 ighv AJSA01225164.1 10444 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFNNYSMNWVRQAPGKGLEWLAYINWNGGSTSYADSVKGRFTISRDNAKNTLYLQMAKLKTEDTATYYCAK
Octodon degus V596 ighv AJSA01225165.1 7930 VMSQITLKESGPGILRPSETLRLTCSFSGFSLSTYGMGVAWIRQFPGKGLEWLSNIWWDDGKYYSPALKSRLAISKDTSKVILTMSSVDPADTATYYCTKG
Octodon degus V597 ighv AJSA01225166.1 6956 ALGQVQLVQSGAELKKPGTSVKVSCKTSGYTFTSYDMHWVRQSPGQGLEWIGWIYPGYGNTAYAQKFQGRATLTADKSSSTAYIELSSLKSEDTAMYYCAR
Octodon degus V598 ighv AJSA01225167.1 4674 VHSQVQLVHSGPELKRPGESVKVSCKGSVYTFTNYAIHWVKQVPGKGLQWMGWINTNTAKPTYTEGFTGRFVFSLDASVSSAYLQINSLQAEDTAMYYCT
Octodon degus V599 ighv AJSA01225169.1 3542 ARGQVQLVQSGAELRRPESSVKVSCKASGYSFTDYWMHWVRQSPGQGLEWIGEIDPSNGNTYYAQKFQGRATVTADQSSSTAYMELKILKSEDTAMYYCV
Octodon degus V600 ighv AJSA01225169.1 17170 VQCEVQFVESGGGLVQPGGSLKLSCAASGFTFSDYWMTWIRQAQGKGLEWLGEINKDSNKINYADSVKGRYTISRDNAKSMLYLQMTNLKTEDTGLYYCGR
Octodon degus V601 ighv AJSA01225170.1 28963 VLSQVQLQESGPGLVKPSETLSLTCTVSGVSLTSNHFGWIRQAPGKGMEWMGNIYSGGGTDYNPALKSRLKIDRDISKSQVSLTLSSLKTEDTAVYYCAR
Octodon degus V602 ighv AJSA01225171.1 6828 AQGEVQLLQSGAELKRPGATVKVSCKGSGYTFTSSYMHWVKQRPGQGLEWIGRIDPENGNTKYAQKFQGRATLTADTSSSTAYMELNSLSSEDTAVYYCA
Octodon degus V603 ighv AJSA01225172.1 11494 VLSQVQLQESGPGLVKPSQTLSLTCTVSGLSLTSTSFAWIRQAPGKGLEWMGIIWSGGTTDYNSALKSRLSIGRDTSKNQVSLTLSSLKTEDTAVYYCAR
Octodon degus V604 ighv AJSA01225174.1 3606 VQAEVQLVESGGGLVRPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEITKDGGSTSYADSVKGRFTISRDNAKNTLYLQLNTLKTEDTATYYCGR
Octodon degus V605 ighv AJSA01225177.1 2972 VQAEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMHWIRQAPGKGLEWITSINPDGSSIYYAESVKGRFTTSRDNAKNTLYLQMTKLKTEDTAVYYCTR
Octodon degus V606 ighv AJSA01225177.1 28304 VKSQITLKESGPGILRPTETLRLTCSFSGFSLSTTNTGVSWIRQPPGKGLEWLANIWWNDSKNYSPALKSRLSISKDTSNNQVFLTMSSVDPADTATYYCAK
Octodon degus V608 ighv AJSA01225182.1 2932 VPSDLTLEQSGLNLLKTGETLSLTCTVTGGSVSSSYYWHWIHQPPGKFLQWMGYWEGSAYYNSAFQGRISITVDLAKNQFSLQLNSVTTEDTAMYYCAR
Octodon degus V609 ighv AJSA01225184.1 923 VQAEVQLVESGGGLVRPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINKDGGSTSYADSVKGRFTISRDNAKNTLYLQMNTLKTEDTATYYCGR
Octodon degus V610 ighv AJSA01225184.1 4810 TAGGVWGRLGAARRSLRLSCAASGFTFDDYNMHWVRQAPGKGLEWLAYISWSGDSTDYADSMKGRFTISRDNDKNMLYLQMTKLKPEDTAVYYCT
Octodon degus V611 ighv AJSA01225193.1 4613 VLSQITLKESGPGLVTPTETLRLTCSFSGFSLSTTNIGVGWIRQSPGKGLDWMAQIWWDDDKWYKPALKSRLSISKDTSNNQVFLTMSSMDPADTAMYYCARG
Octodon degus V612 ighv AJSA01225194.1 2776 AQGQVQLVQSGAELKRPGASVKISCKASGYSFTSYGMLWIRQSPEQGVEWIGYIYPGNGYTNYAQKFQGRATVTADKSSSTAYMELSSLKSEDTAVYYCAR
Octodon degus V613 ighv AJSA01225194.1 17548 TQGQVQLVQSGAELRTPGAAVKVSCKASGYTFTSYNMYWVRQIPGEGLEWIGYINPWNGNTNYAQKFQGKATLTADTSSSTAYMELSSLKSEDTAVYYCAR
Octodon degus V614 ighv AJSA01225196.1 2580 TLGEVQLLQSDAEVRRPGTSVKVSCRTSGYTFTDYYMYWVKQSPGQGLEWIGWIDPEDEESNYAQKFQGRATLTADTSSSTAYMELSNLSSEDTAVYYCV
Octodon degus V615 ighv AJSA01225196.1 7454 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSIDVSWIRQAPGKGLEWMGNIRSGGSKGYNSALKSRLSINRDASMKQASLTLSSLKTEDTAVYYCAI
Octodon degus V616 ighv AJSA01225197.1 28817 VQAEVRLVESGGGLVQPGEYLRLSCVAPGFTFSSYWMSWVRQIPGKGLDLIGEINERGGVIYYADSVMGQFTISRDNAKNTLYLQMTSLKTEDTVVYYCI
Octodon degus V617 ighv AJSA01225202.1 4752 VQAEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMYWIRQAPGKGLEWITSINPDGSSTYYAESVKGRFTISRDNAKNTLYLQMTKLKSEDTAVYYCTR
Octodon degus V618 ighv AJSA01225203.1 14162 AHGQVQLVQSGAELRIPGASVNVSCKASGYAFTSYYIHWVKQGSEGAGVDWKDHALQWSNRLCTDVPKQGDIHQRHLVLQAYMHLSSLTSEDMAVYYCA
Octodon degus V619 ighv AJSA01225203.1 28450 VLSDLTLEESGLNLLKPVETLSLTCTVTGGSVSSSYYWHWIRQPPGKVLQWLGYWVGSAYYNSAFQGRTSITVDLAKNQFSLQLNSVTTEDTAMYYCAR
Octodon degus V620 ighv AJSA01225203.1 36143 VLSQVQLQESGPGLVKPSETLSLTCTISGFSVTEYIAGWIRQAPGKGLEWMGIIWSGGNTNYNPALKSRLNIGRDTSKNQLSLTLSSLKTEDTAMYYCAR
Octodon degus V621 ighv AJSA01225207.1 4070 VLSDLTLQESGQNLLRPGGTLSLTCTVTGGSVTSSYRWNWIRQPPGKALQWMGYWTGSTSYNPTFQGRISITADTSKNQFSLQLNSVTTEDTAMYYCAR
Octodon degus V622 ighv AJSA01225207.1 35628 VHSQVQLVQSGPELKRPGESVKVSCKGSGYTFTDYAIHWVKQLPGKGLQWMGWINTNTAKPTHAEGFTGRFVFSLDASVSSAYLQINTLQTEDTAMYYCA
Octodon degus V623 ighv AJSA01225208.1 849 VHSQVQLVQSGPELKRPGESVKVSCKGSGYTFTDYAIHWVKQLPGKGLQWMGWINTNTAKPTHAEGFTGRFVFSLDASVSSAYLQINTLQTEDTAMYYCA
Octodon degus V624 ighv AJSA01225209.1 5025 AHGQVQLEQSGAELKRPGASVKLSCKVTGYTSTIAWISWVRQGSGQGLEWIGAVDLRDGEIRYAQKFQGRATITGDKSSSTSNMELRSLGSEDTAVYYCA
Octodon degus V625 ighv AJSA01225211.1 14889 VQAEAPLVATGGGLVQPGGSLRLSCEASDFTFSDSFVQWVRQAPGKWMEWIAEISGNDNNTSYIDSVKGRFTISRDNAKNTLHLQVTKLKTEDTAVYYCIK
Octodon degus V626 ighv AJSA01225212.1 15230 VLCQVQLQESGPGLLKPSETLSLTCAVSGFSLTSYSVQWLRQAPGKALDWLGGVWGDGSTYYKPDLKSRVSINRDTSKSQVSLTLSSLRSEDTAMYYCSR
Octodon degus V627 ighv AJSA01225212.1 33419 VLTQVQLQQLGPDLVRPSETLSLICEVSGFSLTSKHMYWIGQSPAMMLEWIGTISPSGGTNYNSAFQSQVSISRDIAKSQVSLTLSSLSPEDTAMYYCVG
Octodon degus V628 ighv AJSA01225213.1 5155 AHGQVQLVQSGAEQKRPGASVKVFCKVTGSTSTITWMHWARQGSGQGLEWIGAVDLRDGEIRYAQKFQGRTTFTGYKSSSTSYIELNSLRSEDTAVYYCA
Octodon degus V629 ighv AJSA01225213.1 22636 VHTQVQMVQSGPELKRPGESVKVSCKGSGYTFNYRGINWVKQVPGKGLQYMGWINTYTADPTYAEGFKGRFVFSMDTSVSSAYLQISSLQAEDTAMYYCA
Octodon degus V630 ighv AJSA01225213.1 34612 VHGDVQLLQSGAELKKPGASVKISCKASGYTFASSWMSWVRQRPGQGLEWIGMIYPSDGDDRYTQKFQGKATITADKSSSTAYMELRSLKSEDTAVYYCAR
Octodon degus V631 ighv AJSA01225214.1 36646 VLSQVTLKESGPGLLTPTETLRLTCSFSGFSLSTSGMGVSWICQPPGKSLEWLAHIWWNDNKYYSPALKSQLSIAKDTANNQVLLTMSSVDPANTATYYCVRIY
Octodon degus V632 ighv AJSA01225214.1 49397 VHSQVQLVQSGPELKKPGESVKVSCKSSGYTFTDHAISWVKQVPGKCLQYMGCINTNTAKPTYAEGFIGRFVFSLDASVSSAYLEVSTLKAEDTAVYYCA
Octodon degus V633 ighv AJSA01225217.1 3603 VLSRGQLQESGPGLMKPSQTLSLTCTVSGLYFASNRFGWIRQAPGKGLEWLGILWSDGSTDYNSALKSRLSISRDTSKSQVSLTLSSLKTEDTAMYYCAR
Octodon degus V634 ighv AJSA01225217.1 19812 VLCDPTLRESGLNLLKPGDTLSLTCTVTGDSFTSSYYWSWIRQPPGKALQWMGFWTGYTSYNPAFEGRISITPDTSKNQFSLQLNSVTTEDTAMYYCAR
Octodon degus V635 ighv AJSA01225217.1 26403 AHGQVQLVQSGAELRIPGASVNVSCKASGYAFTSYYIHWVKQCPGQGLEWIGRISTYSGQTDYAQKFQSRVTFTKDTLSSTAYIHLSSLTSEDMAVYYCA
Octodon degus V636 ighv AJSA01225218.1 6859 ARGQVQLVQSGTELKRPGTSVKVSCKASGYTFTSRYMHWVQQRPRQGLEWIGRIDPEDGETEYAQKFQGRATLTADTSSSTAYMELSRLNSEDTAVYYCA
Octodon degus V637 ighv AJSA01225218.1 21571 AHGEVQLVQSEAQLRRPGASVKVSCKASGYTFTSYWMQWVRQSPGQGLEWIGQIYPGGGNTNYAQKFQGRATFTTDTSSSTAYMELSSLKSEDTAVYYCA
Octodon degus V638 ighv AJSA01225219.1 868 VQAEERLLESGGGLVLPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLDWVGRINENSGTINYAGSVIGRFTISQDNVKSTLYLQMANVKTEDTAVYYCAR
Octodon degus V639 ighv AJSA01225221.1 8344 VLSDLTLQESGPSLVNPGGTLSLTCTVTGGSVTSSNYWHWIRQPPGKALQWMGYWSGSTGYNPAFQSRISITANTAKNQFSLQLNSVTTEDTAIYYCA
Octodon degus V640 ighv AJSA01225222.1 15096 VLSQVQLQNTGPDLVKPSEILSFTCVVSGFSLTSYHMHWIRQASGKAPEWIGCIWGGGGTNYNSAFQSRVSIGKDTSKNQVSLTLSSLIFEDTGVYYCARE
Octodon degus V662 trav AJSA01235472.1 13828 VAGQSVEQPTELMTMEGVSVQVNCTFQTSGFNGLYWYQQHDGGAPVFVSYIVLDGLQNRSRFSTFLHRSDGYSYLLLRELQTEDSASYLCAAR
Octodon degus V673 trav AJSA01244755.1 9709 RNCGYSVTQTEGPVVLTERDHLTLNCTYQTVYSRPVLTWYVQYMDKAPQFLLRNAKENQQTESQGFQASFVKSHSSFHLKKPSLQLSDSAVYYCALW
Octodon degus V675 trdv AJSA01244758.1 10523 SCVAQKVTQVQRATSRLEGETAALDCAYETSVGLYYIFWYKQLPSGEMSFLIRQVSTDRNAESGRYSVHFRQAAKSVSLIILALRTGDSATYFCALSD
Octodon degus V676 trav AJSA01244766.1 7255 VSSQQKEVEQSPESLRVSEGASASLNCTYRDSTSKYFFWYRQCPGRGPELLVSMYSNGDKEEGRFTARLSTSSRHFSLDISGSQHSDSATYLCAV
Octodon degus V677 trav AJSA01245393.1 2804 VRGAQVEQSPSALSLQKVTSPTLRCSFSTTMTSVQWFQQNPEGSLINLFYMAPGTKQSGRLEATINSKDRLSMLKITASELGDSGSYFCAGESQCSQ
Octodon degus V679 trav AJSA01246081.1 2883 VRGQQVQQSPPAQIIQEGAQTSLWCNFSTAVQNVQWFRQDPGGHLISLFYIPSGTKQNGRLKAMTVAKERHSSLSISSSQPTDSATYFCAAAHSAPQ
Octodon degus V680 trdv AJSA01246086.1 3881 PSVALKVTQVQPPTSGREGEVATLDCEYETERGTDYLFWYKQLPSGELTFLIQSASGQTKRTGRYSFSFAKANSMSFSFSGLQMEDSAKYFCAIRA
Octodon degus V681 trdv AJSA01246227.1 16338 SSVAQTVTQVQRATSRREGETAALDCAYETSGALYSIFWYKQLPSGEMAFLIRQVSTDRNAESGRYSVSFRRAAKSVSLIISALQTGDSATYFCALSD
Octodon degus V682 trav AJSA01246232.1 371 VSGLQKEVEQSPESLRVPEGATASLNCTYRNGAFYYFWWYRQYLGRGPLFLMFAFSNGEKKEGRFRMQLNKARQFVSLDISGSQHSDSAAYLCAV
Octodon degus V683 trav AJSA01246368.1 4287 VSSQQGGEVPWALRIQEGVNAALSCSYTASISNVQWYRQNAGGGPVRLILIRSNEKEKHSGRLRATLDTATKSSSLLLTAAGAADSAAYFCATE
Octodon degus V684 trav AJSA01246369.1 1815 TSRAQKVVQAQTEIFVMEKKTVTMDCVYETRVPSYSFLWYKQLPCGAVTFLIGQDSHSEHSAAQGRLSLSFQKAPSSVQLTITPSQPEDLAVYFCAASE
Octodon degus V685 trav AJSA01246374.1 385 VSSQQKEVEQSPESLCVPEGATASLNCTYRDSASMYFWWYQQYPGRGPEVLMSLYSSGDQEEGRFRAHLDRVSRHLSLHIRDAWSLDSATYLCTA
Octodon degus V686 trav AJSA01246581.1 351 VSSQQKEVEQSPESLHVPEGATASLNCTYRNSAFDYFCWYRQYPGKGPLFLMCTFSNGEKKEGRFRIQLNTASQFVSLDISGSQHSDSATYLCSA
Octodon degus V687 trdv AJSA01247040.1 4511 PSVARKVTQVQPATSGREGEVATLDCEYETERGTDYLFWYKQLPSGELMFLIQSASGQTKRTGRYSISFLKADSMSFIISGLQKEDSATYFCAIPT
Octodon degus V688 trav AJSA01247041.1 5729 VRGAQVEQSPSALSLQQGTSPTLRCNFSTTTKSVQWFQQNPEGSLINLLYMVTGTKQSGRLEATLNSKERLSTLKITASELGDSGSYFCAGEAQCSR
Octodon degus V690 trav AJSA01247412.1 1455 WSHGDSVTQTEGLVVLSERAPLSLNCTYETAYSAPFLFWYVQYLNTAPQLLLRSATENQQTESQGFQATLVKSLGSFHLKKPPLQLSDSAMYYCAVE
Octodon degus V691 iglv AJSA01248129.1 1409 SVASYVLTQPSSVSVTPGQTARMTCEGNNIGGKNVHWYQQKSSQPPVLVIYNDNNRPSGIPDRFSGANSGNTATLTISSAQAEDEADYYCQVWDSGN
Octodon degus V692 trav AJSA01248682.1 1924 SSIAQKVTQAPPPVSVQEMEAVTLSCTYDTSEPSYTLFWYKQPCSGEMVFLIRQTSYDQQNATEGRYSVNFQKASKSIHLVISASQLEDSAVYFCTLSE
Octodon degus V695 trav AJSA01250199.1 362 VSGQQKEVEQSPESLHVPEGATASLNCTYRDSAFLYFYWYRQCPGEGLVLLVYTYSNDEKKEGRFRMQLNTASQFVSLDISGSQNSDSATYLCTVN
Octodon degus V696 igkv AJSA01250491.1 2673 ARCDIQLTQPPAVSASLSERVTITCRASQSISSSLHWYQQKPGEAPKLLIYGATTVQSGVPSRFSGSRSGTDFTLTISGVQAEDAGTYYCQQGYNYF
Octodon degus V698 trdv AJSA01252655.1 284 SSVAQTVTQVQRATSRPEGETATLDCAYETSQTVYSISWYKQVPSGEMAFLIRQVSTDRNAESGRYSVSFRRAAKSVSLLISALQTGDSATYFCVLVEG
Octodon degus V700 iglv AJSA01258694.1 71 LCGLPVLTQNPLASASLGASIKLTCTLSSEHSSYYIEWYQQRPGRSPQYVMHLKSDGSSSKGDGISDRFSGSSAGADRYLTISNLHSDDEAQYYCGV
Octodon degus V796 iglv AJSA01049397.1 10645 YSTQPVLHQPSSAASSLGTSVRLTCTLSSDHNIGFYSIFWYQQKPGQPPRFLLRYFSYSDKHQGPKVPPRFSGSKDLFSNQGYLSISELQPEDEAVYYCALG
Octodon degus V819 trbv AJSA01059763.1 22171 FSDDEVTQIPRHLVTWKGQKAKMTCAPKKGHSYVYWYQQKKSEELKFMVRFQNEDNIEETDEFKARFSAACPKNSNCQLETKSSDLEDSALYFCASSQ
Octodon degus V820 trbv AJSA01059763.1 16793 FSEDEVTQTPRQLVIWKGQKAMISCVPKTGHNVVYWYQQKKSEELKYLMHFQSSTVLDQTDEFKDRFSAACPKDSPCRLETKSSDLQDSALYLCASSR
Octodon degus V821 trbv AJSA01059763.1 7645 SMASGITQTPRNRITQTGTNTVLKCSQTKGHDRMFWYRQDPGQGLRLIYYSIDINDFTKGDISDGYNVSRKEQASFSLSIEAATPSQTGLYFCASSD
Octodon degus V822 trbv AJSA01059764.1 2376 LSEDEVTQTPRHLVTWKGQRANMTCVPKKGHNAVYWYQQKKNEELKLLIYFQNKQAIDPKDQSQDRFLAACLEDSPCELETKSSDLQDSALYLCASSQ
Octodon degus V824 trbv AJSA01059768.1 7972 GSGLGALVLQHPSRAICKSGSSVKIECHYVDLQATTVFWYHQLPKQSFVLMATSTMSSTASYEQGFIPDKFPISHPNQTYSTLTVTNAHPDDSSSYFCGGS
Octodon degus V825 trbv AJSA01059768.1 478 FGLGVLVLQHPSRAICKSGSSVKIECRYVDLQANVVFWYRQHPKQSFEHMATSNVDSKGTYEQGFTEIKFPISHPNLTYSTLTVTNAHPEDSSSYFCGAS
Octodon degus V826 trbv AJSA01059769.1 2378 GSGLGALVLQHPSRVICKSGSSVKIECRYRDFQAISVIWYRQSLKQGFTRMVISSQGSDDATYEDDFTKAKFPITHPNGTYSSLTLTTAHPEDSSSYFCGAS
Octodon degus V827 trbv AJSA01059770.1 2784 GSGLGALVFQHPSRAICKSGSSGKIECRYVDLQATTVFWYHQLPKQSFVLMAISARGSTALYEQGFTQDKFPISHPNQTYSTLTVTNAHPEDSSSYFCGAS
Octodon degus V828 trbv AJSA01059771.1 1289 TVDGGITQTPKFLFIQKGQSVTLDCEQNLNHDTMYWYRQDPGQGPRLIYFSLMANDIQTGDISEGYTVSRKEKESFLLTMNSAQKNQTAVYLCASSL
Octodon degus V829 trbv AJSA01059773.1 3611 TVDGGITQTPKFLFIQKGQSVTLECEQNLNHNTMYWYRQDPGQGPRLIYFSIGVDDIQTGDITEGYTVSRKKKNSFLLTMNSAQKNQAAVYLCASSQ
Octodon degus V830 trbv AJSA01059776.1 30127 HLEAGITQNPTHKVAKTKEKLTLKCHQTNNHDRMYWYRQDPGHGLRLIYYSYAVKGFDKGEVPDGYNVSRENTEDFLLTLESATLSQSSVYFCASSY
Octodon degus V831 trbv AJSA01059776.1 25482 HLEAGVTQSPRHKVVKTKEKVTLKCHQTNNHDYMYWYRQDPGHGLRLIHYSYGVKGLEKGDVPDGYNVSRENNEDFPLTLESATLSQSSVYFCASSY
Octodon degus V832 trbv AJSA01059777.1 7799 HLEAGITQSPRHKVAKTKEKVTLKCHQTDNHDYMYWYRQDPGHGLRLIHYSLRAEHHEKGEVPDGYNVSRENTEDFLLTLESATVSQSSVYFCASSY
Octodon degus V833 trbv AJSA01059779.1 18898 HLEAGITQSPRHKVVKTKEKVTLKCQQNDKHEYMFWYRHDPGHGLRLIYYSLDVNSFDKGEVPDGYKVSRENTEDFLLTLESATLSQSSVYFCASRV
Octodon degus V834 trbv AJSA01059779.1 14304 RLEAEITQSPRHKLVRTKEKVTLKCHQTNNHDRMYWYRQDPGHGLRLIHYSYGVNYLEKGEVPDGYTVSRENTGEFPLTLESATLSQSSVYFCASSD
Octodon degus V835 trbv AJSA01059779.1 9478 YMEAGVTQSPRHKVAKTKEKVTLKCHQTDNHNSMYWYQQDPGHGLRLIFYSFAVKNLDKGEVADGYKVSRENTEDFPLTLESATLSQSSVYFCVSSY
Octodon degus V836 trbv AJSA01059779.1 4741 HLEAGITQSPRHKVTKTKEKLTLKCHQNDNHDYMYWYRQDLGHGLRLIHYSLRAEHHEKGEVPDGYNVSRENIEDFPLTLESATLSQSSVYFCANSY
Octodon degus V837 trbv AJSA01059780.1 7806 HLEAGITQSPRNKVVKIKEKVTLKCQQTDNHDYMYWYRQDPGHGLRLIHYSIGAKSLEKGEVPDGYNVSRENTEDFPLTLESATLSQSSVYFCASSY
Octodon degus V838 trbv AJSA01059782.1 19986 PVLTEVIQTPRHRIKTKGQKMTLRCSPESGHQSVAWYQQAVGQGLQFLFENYNELQRAKGNVSNRFSAQFQDSLSKLNISTLELEDSAMYFCASR
Octodon degus V839 trbv AJSA01059782.1 16340 SVDAGVLQTPKHLIQVKGRQATLRCSPMSDHLAVYWYQQNLDQGLQFLFSYYNGHEREKGKSVERFSGEQFSNSSSELTLGALQLGDSARYLCASSE
Octodon degus V840 trbv AJSA01059782.1 12465 PGNAGLTQTPTAQVLKAGQRMTLSCAQDLKHDSMYWYRQDLGLGLRLVYYSFDVNLTEKGEVPDGYTVSRSSSENFPLTLESASPSQTAVYFCASSY
Octodon degus V842 trbv AJSA01059783.1 5239 HMEPGVRQSPSHKVTEMGQNVTFRCDPISGQQYIYWYRQTAENGIEFMVYLYDKDPMEKADFFKDRFSAEVPKGSYSILKIWPVQLGDSAVYLCASSQ
Octodon degus V843 trbv AJSA01059785.1 964 HTEPEIIQIPSHQVTRMGEMVIMSCDPTSDNLYFYWYRQILGQGMEFLVCFYMGRILEKSEMFKDDYSVDKPDGSYFTLKINLTKLEDSAVYFCGSSL
Octodon degus V925 igkv AJSA01091847.1 2884 VRCDIQMTQTPSSLSASPGDSVTIRCRASRNIGTELDWYQQKPGRAPTLLIYQVSNLHSGVPSRFSGSGSGTDFSLTINSLQPEDFATYYCQQDYGTP
Octodon degus V926 igkv AJSA01091848.1 9331 GRCDIQLMQSPGVSASLGERVTITCRASQGIRSYLHWYQQKPGQPPKCLIYGATNVPSGVSSRFSDSGSGTDFTLTISSLEFEDAATYHCQQSYDQP
Octodon degus V927 igkv AJSA01091849.1 25094 VCCDIQMTQSPSSLSASLGDSVTIRCQASQGVRGYLNWFQQKPGKAPILLIYNSNNLHSGVPSRFSGSGSGTDYTLTISSLQPEDLATYYCM
Octodon degus V928 igkv AJSA01091849.1 11337 SSGDIVMTQSPLSLSVTPGQPASISCRSSQSLLSSNGNTYLYWFLQKPGQAPKLLIYRVSNRFSGVSDRFSGSGAATDFTLKISSMQAEDAGVYYCMQSIQLP
Octodon degus V929 igkv AJSA01091849.1 1107 GRCDIQLTQSTAVLASLGERVTITCRASQGTSKSLHWCQQRPGQAPKLLIYGSTTVQSGVPSRFNGSGSGTDFTLAISSLEPEDATTYYCQQSYNRP
Octodon degus V930 igkv AJSA01091850.1 5528 GRCDIQLTQSPFVLASLGERLTITCRASQGISKSLHWYQQRAGQAPKLLIGYATTVQSGVPARFGGSGSGTDFTLAISSLEPEDAATYYCQQGYNRP
Octodon degus V931 igkv AJSA01091851.1 4374 TRGDVVMTQSPPSLSITPGQPASISCRSSQSLLGSDGNTYLRWFLQKPGQAPKLLIYRVSNRFSGVSDRFSGSGAGTDFTLKISSVQAEDAGVYYCMQA
Octodon degus V932 igkv AJSA01091853.1 4222 GRGDIQLTQVPLVSSSLGERVTISCRASQGISSSLHWYQQKQGQAPKLLIRYATTVQSGVPSRFSGSGSGTDFTLTISSLEAEDFAKYYCQQSNSWP
Octodon degus V933 igkv AJSA01091858.1 2454 VCCDIQMTQSPGSLAVSPGDRVTITCKASQNINSYLNWYQQTPGKVPKLLIYGASNLQTGVPSKFSGSGSGADYTLTISSLQPEDAGTYYCQQSYDYP
Octodon degus V934 igkv AJSA01091860.1 5871 VRCDIQMTQSPPSLAGSLGDSVSITCRASQNINSYLSWYQQAPGKAPKLLIYGASNLQSGVPSRFSGSGSGTDYTLTISSLQPEDVATYYCQQDKNWP
Octodon degus V935 igkv AJSA01091860.1 1433 VYCDIQMTQSPGSLAVSPGDRVTDTCRASQSVYNNLHWYQQIPGDAPRLLIYATSKLQLGVPPRFSGSGSEADYTLTISSLQPEDVGTYYCQQGYRTP
Octodon degus V936 igkv AJSA01091861.1 25772 ARCAIVMTQSPPTLSASLQGSMTINCRASQSVNKYVAWYQQKPGQAPQSLIYCATNLQPGVSSRCSGRGSGQDYTLTISSLQPEDAATYYCQ
Octodon degus V937 igkv AJSA01091861.1 12072 SLAETVLTQSPALLSAAVGDQATITCRASTDIDNDMHWYQQKPGESPKLLIKYTTDLISGVPSRFSGSGYGTDFTLTINDLKREDAAYYFCQHDDNLP
Octodon degus V938 igkv AJSA01091864.1 4165 VQGDIQITQSPSSLSKSPGDAVTITCQASKNIYSDLAWYQQKPGRAPRLLIYYATSLQTGVPARFSGGGSGTDYTLTIGSLEPEDAATYYCQQHRELP
Octodon degus V939 igkv AJSA01091865.1 8145 TRCDIQMTQSPPSLSATPGDRVTITCRASENIYSYLNWYQQKPGEAPRLLIYDASTLQSGVPARFSGSGSGQEYTLTISSLQPEDAATYYCQKRYQYP
Octodon degus V940 igkv AJSA01091865.1 4338 IRCDIQMTQSPPSLSASPGDRVTITCRASEDIYGGLSWYQQKPGEAPKLLIYAASILQDGVPARFSGTRSRLDFTLTISSLQPEDIATYYCQQIVSF
Octodon degus V941 igkv AJSA01091867.1 14153 TRCAIQMTQSPPSLSAPPGDRVTITCRASEDIYSILNWYQQKPGQAPRLLIYAASNLQSGVPARFSGSGSGQEYTLTISSLQPEDVATYYCQCGYSSP
Octodon degus V942 igkv AJSA01091867.1 5707 TRCAIQMFQSPPSLPASPGDRVTITCRASENIYSGLSWYQQKPGQAPRLLIYDASTLQTGVPARFSGSGSGQEYTLTISSLQPEDIAAYYCLQYSSYP
Octodon degus V943 igkv AJSA01091871.1 3740 TRCAIQMTQSPPSLSASPGDRVTITCRASEDIYNALNWYQQKPGQAPRFLIYATSTLQSGIPARFSGRGSGQEYTLTISSLQPEDTAAYYCQQYTS
Octodon degus V944 igkv AJSA01091872.1 734 TRCAIQMTQSPPSLSASPGDRVTITCRASEDIYNALNWYQQKPGQAPRLLIYAASNLQSGVPARFSGSGSGREYTLTISSLQPEDAAAYYCQQYTSSP
Octodon degus V945 igkv AJSA01091874.1 6151 TRCDIQMSQSPPSLSASPGDRVTITCRASEDIYSNLNWYQQKPGQAPRLLIYAASNLQSGVPARFSGSGSGTDYTLMISGMQKEDVGTYYCLQGWSAP
Octodon degus V946 igkv AJSA01091876.1 493 STADIVMTQSPLSLSVTPGQPASISCRSSENILHIYGNTYLDWYLQKPGQSPQLLIYEGFNRASGVSDRFSGSRSRTDFTLTISRVEAEDVGVYYCMQGLQLP
Octodon degus V947 igkv AJSA01091882.1 15508 SRCAIQMTQSPPWLSASPGDRVTITCRASEDIYNALNWYQQKPGEAPRLLIYATSKLQSGIPARFSGSDSGQEYTLTISSLQPEDVAIYYCQYGYSSP
Octodon degus V948 igkv AJSA01091884.1 3703 TRCDIQMSQSPPSLSASPGDRVTITCRASGNIYSGLNWYQQKPGQAPRLLIYYASTLHDGVPARFSGSGSDQEYTLTISSLQPEDVAAYYCLQYSSYP
Octodon degus V949 igkv AJSA01091886.1 1228 TRCAIQMFQSPPSLSASPGDRVTITCRASEDIYSGLSWYQQKPGQAPRLLIYDASNLQSGVPARFSGSGSGREYTLTISSLQPEDVAAYYCQQYSSYP
Octodon degus V950 igkv AJSA01091890.1 2703 CGGAAVLTHTPPSLPISPGAQASISCRSNESLLHSDRNTCLHWYLQKPGQAPRLLIYKVSNRYTGVPDRFSGSGSRTDFTLTISRVEAEDAGVYYCGHGTKAP
Octodon degus V951 igkv AJSA01091891.1 12171 STGQTQLTQSPASLTLSSGETATLSCRASQSVSSYLAWYQQKAGQAPRLLISGASTRATGIPTRFSGSGSGTDFTLTISSLEPADVATYYCYQYSNWF
Octodon degus V952 igkv AJSA01091893.1 2637 ARCDIQLTQPPAVSASLSERVTITCRASQSISSSLHWYQQKPGEAPKLLIYGATTVQSGVPSRFSGSGSGTDFTLAISGVQAEDAGTYYCLQSWSTP
Octodon degus V953 igkv AJSA01091899.1 36080 ARCDIPMTQTPSSLPASVGDMVSITCRASKDTGIALHWYQQKPGKTSKLLIYAAAELESSVPSRFSGSGSGTDFTLAIRSVEPEDAGTYYCLQT
Octodon degus V954 igkv AJSA01091899.1 18755 ARCDVQLTQSPAASAALAERVTITCRASENIGSNLHWYQQKPGQAPKLLIYGATTVQSGVSSRFSGSGSGTDFTLAISGVQAEDAGTYYCLQSWSNL
Octodon degus V955 igkv AJSA01091899.1 12326 ARCDIQVTQSPSSLSASSGDRVTIRCRANEYVSNWVSWHQQKPGQAPKPLIYRATALQSGVPSRFSGSGSETDFTLTISGIQAEDVGTYYCVQS
Octodon degus V956 igkv AJSA01091899.1 4858 ARCDIQVTQSPSSLSASPGDRVTVRCRASEYVSDWVSWHQQKPGQAPKPLIYAATSLQSGVPSRFSGSGSGTDFTLTISGVQAEDAGTYYCVQS
Octodon degus V957 igkv AJSA01091901.1 3478 TSGNVVLTQTPASLNVTLGERASIICRASEYVSDYLTWYQKKPGQIPRILIYDADDQFPGVSDRFTGTQDDTKFIFEIKKVEHGDAGTYYCQQS
Octodon degus V958 igkv AJSA01091903.1 5629 SGDITLAQTPASLSASPGQTVSISCQASADVHGEMSWVRVKLGQKLEPLISHVTTLAPGVPARFSSRGSGTSYVFSISPVEPGDSGEYYCMHDYYWP
Octodon degus V1018 iglv AJSA01121356.1 6931 SVASYVLTQPSSMSVTLGQTARLTCGGSNIGSKSVYWYQQKPVQAPMLVIYGDSNRASGIPDRFSGANSGNTATLTIAGAQAEDEADYYCQVWDSSSS
Octodon degus V1019 iglv AJSA01121356.1 2391 LCGLPVLTQNPLASASLGASIKLTCTLSSEHSSFTIEWFQQMPGRSPQYIMQLKSDGSSSKGDGISDRFSGSSAGADRYLTLSDLRSEDEAQYYCGVSH
Octodon degus V1020 iglv AJSA01121360.1 626 LCGLPVLTQNPLASASLGASIKLTCTLSSEHSSYTIEWYQQRPGRSPQYLMDVKSDGSSSKGDGISDRFSGSSAGADRYLTISDLHSEDEAQYYCGVSH
Octodon degus V1021 iglv AJSA01121361.1 1567 SVASYVLTQPSSMSVTLGQTARLTCGGSSIGSKSVYWYQQKPVQAPVLVIYGDSNRASGIPDRFSGANSGNTATLTIAGAQAEDEADYYCQVWDSGI
Octodon degus V1022 iglv AJSA01121368.1 3830 LCGLPVLTQNPLASASLGASIKLTCTLSSEHSSFTIEWYQQRPGRSPQYVMDVDSDGIFSKGDGISDRFSGSSAGADRYLTISNLYSEDEAQYYCG
Octodon degus V1023 iglv AJSA01121375.1 4836 SVASYVLTQPSSMSVTLGQTARLTCGGNSIGSKSVHWYQQKPVQAPVLVIYRDSNRASGIPDRFSGANSGNTATLTISSAQAEDEADYYCQVWDSSSD
Octodon degus V1024 iglv AJSA01121377.1 2298 AMASYVLTQPPSVSVALGETATITCSGEALPKRYAYWFQQQQPGQTPVRIIYKDKERPSGISERFSGSSSGTTATLTISSAQAEDEADYYCLSWNINGTE
Octodon degus V1025 iglv AJSA01121379.1 2468 QASYVLTQPPSVSVAPGETVTITCSGEALPKRYAYWFQQQQPGQPPVRIIYKNSERPSGISERFSGSKSGTTATLTINSAQTEDEADYYCLSADSSGSY
Octodon degus V1026 iglv AJSA01121380.1 13949 SMASYTLTQPPSVSVTSRETAEITCSGENLEDKYASWCQQKPGQAPLLLIYADSNWPSGIPDRFSGSNSGNVAILTITGTQDGDEAFYYCAAVD
Octodon degus V1027 iglv AJSA01121383.1 6054 AMASYVLTQPPSVSVAPGETATITCSGEALPKKYADWFQQKPGQTPVLIMYDDSERPSGISERFSGSSSGTTATLTISSAQAEDEADYYCFSADSSGSY
Octodon degus V1028 iglv AJSA01121385.1 2601 SVASYVLTQPSSVSVTPGQTARMTCEGNDIGSKYVQWFQQKSSQAPVLVIYEDSKRPSGIPDRFSGANSGNTATLTISGAQAEDEADYYCEVWVSSEK
Octodon degus V1029 iglv AJSA01121389.1 988 SVASYVLTQPSSVSVTLGQTGRITCEGNNIGSTYVHWYQQKASQAPALVIYQDNNRPSGIPDRFSGASSGNTATLTIAGAQAEDEADYYCQVWGGSTG
Octodon degus V1030 iglv AJSA01121390.1 1722 SVASYMLTQPSSVSVTLGQTARMTCEENNIGSKYVQWHQQMSSQAPVLVIYSDNNRPSGIPDRFSGANSGNTATLTISSAQAEDEADYYCEVWDSSEK
Octodon degus V1031 iglv AJSA01121395.1 554 SWGQSALTQPPSASGSLGQKITITCTGTSNDIGQYNYVSWYKQLPGITPKLLIYAVNNRPSSAPDRFSGSKSGNTASLSISGLQAEDEAEYYCCSYRND
Octodon degus V1033 iglv AJSA01121399.1 6289 SMASFILTQPPSVSVAPGQTAKITCSGAKLSEAYANWYQQKPRQAPVMIIYGDSDRPTGISDRFSGSSSESTATLTISGAGPEDEADYYCQSYDSSDT
Octodon degus V1034 iglv AJSA01121406.1 14600 SWAQSALTQSPSVSGTLGQKATITCTGTSNDIGKYNYVSWYQQLPGTSPKLLIYDVSSRPSGVPDRFSGSKSGNTASLSISGLQAEDEADYYCCSYAGS
Octodon degus V1035 iglv AJSA01121406.1 6289 SWAQSSLTQRPSVSGSPGERVTISCDGTSSNIGSYSGISWYQKHPGALHKLLIYDTSSRPSGVPDRFSGSKSGNTASLSISGLRPEDEADYYCCSYAGS
Octodon degus V1036 iglv AJSA01121427.1 1138 AESQAVVTQESLLSISPGVTVTLTCATSTGAVTTNHYARWVQQKHKLQGLIGNTNLRVPGIPARFSGSLLGDKAALTITGAQPEDEATYYCALWYSNH
Octodon degus V1037 iglv AJSA01121428.1 1496 AGSQAVVTQEPSLSTTPGGTVTLTCGSSTGAVTTEHYPAWFQQKPYQTPQGLIGSTSSRTPGVPARFSGSLLRDKAALTITGAQAEDEATYYCLL
Octodon degus V1038 iglv AJSA01121432.1 21720 AESQAMPTQESSLYTSPGGTVTLTCGSSTGAVTTTNYATWIQQIPYQTPKALICNSDSLYAGIPARFSGSLLGDKAALTITGAQPEDEATYYCVLW
Octodon degus V1039 iglv AJSA01121432.1 12805 AESQAVVTQESSLSISPGGTVTLTCGSSTGAVTTSNYAHWLQQKSCETPQGLISNTNIRYSGVPAQFSGSLLGDKAALTIKGAQSEDEATYYCTLWYSNH
Octodon degus V1040 iglv AJSA01121432.1 1599 AETQAVVTQEPSLSTIPGGTVTLTCGSSTGAVTSGHYPAWVQQKPYQTPQGLIGSTSSRVPGVPARISGSLLGAKAALTITGAQAEDEATYYCLLWYSNH
Octodon degus V1041 iglv AJSA01121438.1 24301 SLSQAVVTQEPSLSASPGASARLACTLRSDISVGGKNLYWYQQKPGSPPRFLLYYYSDSDKQLGSGFPNRFSGSKDKSANAGILHISGLQPEDEADYYCAI
Octodon degus V1042 iglv AJSA01121438.1 10860 SLSQAVLTQEPSLSASPGASARLPCTLRSGISVGGKRMVWFQQKLGSPPRFLLHYYSDSDKYQGSDIPSRFSGSKDSSANAGVLHISGLQPEDEADYYCAI
Octodon degus V1043 iglv AJSA01121439.1 860 SLSQAVVTQVPSLSASPGTSARLTCTLRSDISVGGKNLYWYQLKPGSPPSFILKYYSESSKQLGPGIPSRFSGSKDSSTNAGVLHISGLQPEDEADYYCMI
Octodon degus V1163 igkv AJSA01184226.1 5400 ARCDIRMTQSPYLSASLGEKVTITCQASQGISDYLNWYQQKSGNAPKRLIYRATNLDSGVPSRFSGSGSGTDFTFTISSLEPEDVATYYCMQYDELP
Octodon degus V1164 igkv AJSA01184228.1 574 TRCDIQMTQSPSVSASVGDTVTINCRASQGINVWLAWYQQKPGKVPKLLLYWATSLASGVPSKFRGTGSGTDFTLSISNLEPEDSATYYCVQYHQFP
Octodon degus V1165 igkv AJSA01184233.1 1427 ARCDIQMTQSPSSISASLGDRVTINCRVSQDISQWLTWFQQKLGKSPKPLIRYTTTLQPGVPSRFSGSGSGTEYTLTINSLQPEDVAIYYCMHYDKLP
Octodon degus V1166 igkv AJSA01184244.1 46903 SRCDIQMTQSPSAHSASVGDTVIISCKASQNVGSYLAWYQQKPGKEPKRLIYGASTLASGVPARFSGSRSGQDYTLTIRSLQPEDVATYYCQQTVSLP
Octodon degus V1168 igkv AJSA01184244.1 13779 SRCDIQMTQSPSSHSAPVGDTVTINCKASQNIGSVLAWYQQKPGKGPKLLIYAASIRHDGVPTRFSGSGSGQDYTLTISSLQPEDVATYYCQQGNSLP
Octodon degus V1170 igkv AJSA01184249.1 6692 STGNIVQTQSPAFLAVAPGQTATISCRASESVDLVSVGIIHWYQHKPGQPPKLLICTASKRASEVPERFSGSGSGPDFTLTIQSVEAEDAANYFCQQGKESP
Octodon degus V1171 igkv AJSA01184251.1 3150 VCGDTVMTQSPRNLAVSVGESATIRCKASQSLQSGGSNYLVWFQHKPGQSPRLLIYWALTRASGVPDWFSGSGSGTDFTLTINNLQAEDVADYYCLQYHSFP
Octodon degus V1172 igkv AJSA01184255.1 22381 VCSDIVMTQSPRTLAVSAGESATIHCKASQNLQPDSSNYLAWYQQKPGQSPRLLIYWASMRASGVPDRFSGSGSGTDFALTINNLQAEDVADYYCQQYDSFP
Octodon degus V1173 igkv AJSA01184255.1 10922 VCGDIVMTQSPKSLAVPAGESATIHCKASQSLQLSSYNYLAWYQQKPGQSLKLLIYLASTRASGVPERFSGSGSGTDFTLTINNLQAEDVADYYCQQGR
Octodon degus V1174 igkv AJSA01184256.1 656 VCSDIVMTQSPRTLAVSAGESATIHCKSSQSLLYNGYNYLAWYQQKPGQSPRLLIYWASTRASGVPDRFSGSGSGMDFILTITNLQAEDVADYYCQQHRSSP
Octodon degus V1175 igkv AJSA01184257.1 21088 VCSDIVLTQSPRTLAVSAGESATIHCKASQSLQSGSYNYLAWYQQKPGQSPRLLIYLASTRASGVPDRFSGSGSGTDFTLTINNVQAEDFADYYCQQDRSYP
Octodon degus V1176 igkv AJSA01184257.1 10957 VCGDIVVTQSPRSLTVSPGESATIRCKASQSLLDSDDNKNYLSWYQQKPGQSPRLLIYYASTRESGVPDRFSGSGSGTDFTLTIKNVQAEDVGDYYCQQVYDIP
Octodon degus V1177 igkv AJSA01184259.1 9585 CTGDIVMTQSPLSLSISPGEPASISCRSSESLLYSDGKTYVNWVVHKPGQAPQGMIYVLSNRNSWVPDRFSGSGSGTDFTLTISRVEAEDAGVYYCWQGKQL
Octodon degus V1178 igkv AJSA01184288.1 3058 SQGDVVMTQTPLSLSVSPGETASISCRSSESLLHADGKTYLNWIVHKPGQALRGMIYQVNKKYTGTPDRFSGSGSGTDFMFTISRVEAEDAGVYYCGQATKLP
Octodon degus V1204 ighv AJSA01203422.1 5154 VQAEVQLVESGRGLVQPGGSLRLSCTVSGFSGFSYIYMSWIRQPPGKGLEWISGISGDSSAINYADSVKGRFTISRDNSRNTLYLQMSNVRSEDTAVYYCAK
Octodon degus V1205 ighv AJSA01203425.1 1931 VQAEVQLVESGGGLVRPGGSLRLSCTASGFSGFSYNYMDWIRQAPGKGLEWISEISGDSSDINYADSVKGRFTISRDNSRNTLYLQMSNVRSEDTAVYYCAA
Octodon degus V1206 ighv AJSA01203430.1 3339 VQAEVQLVESGGGLVQPGGSLRLSCTASGFSGFSYIYMSWIRQPPGKGLEWISGISGDSSDINYADSVKGRFTISRDNSRNTLYLQMSNVRSEDTAVYYCAT
Octodon degus V1223 iglv AJSA01211371.1 944 SLSQAVVTQEPSLSTAPEASVRLTCTLRSDISIAGKQINWHQQKPGSPPRFVLYYYSDSVKQLDSGIPSRFSGSKDTSANAGVLLISGLQPEDEADYYCNI
Octodon degus V1224 iglv AJSA01211372.1 5583 SWAQAVLTQPPSVSGSPGGSVTISCAGSSTNIGDGYSVQWYQQLSGTAPKLIIYSNSNRPSGVSGRFSGSKSGSSASLTISGLQSEDEADYYCQSYDSSLSA
Octodon degus V1225 iglv AJSA01211384.1 12550 SWAQAMLTQPPSVSGSPGGSVTISCTGSSTNIGSGYDVHWYQQLSGTAPKLIIYDNSNRPSGVSDRFSGSKSGSSGSLTISGLQSEDEADYFCQSYDSSLSA
Octodon degus V1226 iglv AJSA01211384.1 2534 SFSQAVVTQEPSLSESPGASARLSCTLRSGISVGGTWINWYQQKPGSRPRYLLSYYSDSNKVQGSGIPSRFSGSKDNSANAGVLHISGLQPEDEADYYCNI
Octodon degus V1227 iglv AJSA01211387.1 14594 LESQLVLTQESALSTSPGGTVTLTCSANTGAITTNNYASWVQQMPYHTTKGLIYSTSSRYAGVPARFSGSLLGDKAALTITGARSEDEATYYCLIWYSNH
Octodon degus V1228 iglv AJSA01211392.1 11991 SLSQALVTQEPSLSASPGASARLPCTLRSGISVGGYSIYWYQQKPGSPPRFILRYYSDSNKELGSGIPSRFSGSKDTSGNAGVLHISGLQPEDEADYYCAI
Octodon degus V1229 iglv AJSA01211394.1 9167 SWAQAVLTQPPSVSGSPGGTVTISCTGSSNNIGNYYVSWYQQLSGMAPKLIIYGNSNRPSGVSGRFSGSKSGSSASLTVSGLQSEDEADYFCQSYDSSLS
Octodon degus V1230 iglv AJSA01211394.1 3659 SLSQALVTQEPSLSAAPGASARLPCTLRSGISVGSYYIFWYQQKPGSPPRFLLYYYSDSSKQLGPGMPSRFSGSKDTSVNAGVLHISGLQAEDEADYYCNI
Octodon degus V1231 iglv AJSA01211395.1 6999 SWAQAVLTQPPSVSGFPGETVTISCTGSSNNVGGYAVQWFQQLSGTAPKLIIYSNSNRPSGVSGRFSGSKSGNSASLTISGLQSEDEADYYCEAYDSSLSG
Octodon degus V1232 iglv AJSA01211395.1 1953 SLAQALVTQEPSLSAAPGASARLTCTLSSGISVGGYYICWYQQKPGSPPRFLLCYYSDSSKQLGPGIPSRFSGSKDTSVNAGVLHISGLQAEDEADYYCNI
Octodon degus V1233 iglv AJSA01211398.1 19310 AESQAIVTQESSLYISPGGTVTLTCDCSTGAVTTSNHVLWVQQKPFQTTRGLIGGANSRFSGIPARFSGSLLGNKAALTITGAQPEDEATYYCALWCSNH
Octodon degus V1234 iglv AJSA01211398.1 7227 SWAQTVLTQPPSVSRSPGETVTISCSGNSNNLGRHYVHWFQQLSGTAPKLIIYNNIDRPSGVSARFSGSKSGSSASLTISGLQSEDEADYYCQSYDSSLSA
Octodon degus V1235 iglv AJSA01211398.1 1398 SLAQVLVTQEPSLSAAPGASARLTCTLSSGISVGGYYIYWFQQKLGSPPRFFLYYKSDSDKYQGSGIPSRFSGSKDTSANAGVLHISGLQPEDEADYYCAI
Octodon degus V1236 iglv AJSA01211401.1 17089 SWAQAVLTQPPSVSGSPGQTVTISCTGSSTNIGGGYYVHWYQQLSGTVPKLIIYENSNRPSGVSDRFSGSKSGSSGSLTISGLQSEDEADYYCQSYDSSLN
Octodon degus V1237 iglv AJSA01211403.1 920 VESQAVVTQESSLYISPGGTVTLTCGSSTGAVTTSNYAHWVQKEPYQTLKGLIHNTNIRYTGVHARFSGSLLGDKAVLTITGAQPEDEATYYCALWYSNH
Octodon degus V1257 ighv AJSA01218294.1 2485 AKGEVQLVQSGAELRRPGTSVKVSCKASGYTFTDYYMNWVRQIPGQGLEWIGRIDPENGNTNYAQKFQGRATFTADTSSNTAYMQLSGLKSEDTAVYYCA
Octodon degus V1258 ighv AJSA01218306.1 1752 VMSQITLKESGPGILRPNETLRLTCSFSGFSLSTSGMGVGWIRQPPGKGLEWLAHIYWDDDKSYNQALKSRLSISKDTSNNQVLLTMSSVDPADTATYYCARR
Octodon degus V1259 ighv AJSA01218307.1 8407 AQGEVQLVQSGAELRRPGTSVKVSCKASGYTFIDYYMNWVRQIPGQGLEWIGSINPENGNTNYAQKFQGRTTFTADTSSNTAYMQLSGLKSEDSAVYYCA
Octodon degus V1260 ighv AJSA01218310.1 13266 AQGQVQLVQSGAELKKPGASVKVSCKASGYTFTSNYMSWVRQSPGQGLEWIGQIYPGNGNTNYAQKFQGKVTLTADKSSSTAYMELSSLKSEDTAVYYCAR
Octodon degus V1261 ighv AJSA01218317.1 3301 VRCGEQLVESGGGLVKPGGSLRLSCAASGFTFHDYDMYWIRQAPGNGLEWLGWISPSGGSTDYPDSVKGRFTISRDNAKNMLYLQMNSLKTEDTAMYYCAR
Octodon degus V1262 ighv AJSA01218320.1 3338 VLSDQTLQESGPHLLKPGETLSLTCIVTEGYIIASYAWTWIRHPPGKVLQWMGYWIGSSYYNKAFQGRITITIDVFLSQFSLQLKSLTEEDTAVYYCA
Octodon degus V1263 ighv AJSA01218328.1 4552 VLSDQTLQESGPHLLKTGETLSLTCTVTEGHITTSYAWTWIRHPSGKVLQWMGYWIGSSYYNKAFQGRMTIIVDAVQNQFSLQLKSLTEEDTAVYYCA
Octodon degus V1264 ighv AJSA01218330.1 6646 VQCEEQLVESGGGLVHPGGSLRLSCAASGFTFTNHWMNWIRQAPGKGLEWITSIDYGGSNTYYADSVKGRFTISRDNVKNTLYLQMTKLKTEDTAVYYCAR
Octodon degus V1265 ighv AJSA01218334.1 3927 VQCEEQLVESGGGLVQTDGSLTLSCAASGFTFSDYWMSWIRQVPGQGLEWIIDIRYDGATVYYADSVKDRFTISRDNSKNTVYLQITELKTEDTAMYYCARE
Octodon degus V1266 ighv AJSA01218335.1 3861 VLSLTLRESGRNLVKPGETLSLTCTVTGGSVTSSYAWSWIRQPPGKALQWMGYWAGSTEYSPAFQGRISITADTAKNQFSLQLKSVTTEDTAMYYCA
Octodon degus V1267 ighv AJSA01218341.1 530 VLLQVQLQESGAGLVKPSQTLSLICSVSGVSITSSGHWGNWIRQTQGKRLDWMGYISYNGGTSYSPALKSRISIFRDTANNQFSLQLNSVTEDDTAVYYCVD
Octodon degus V1268 ighv AJSA01218343.1 5419 AHGEVQLVQSGPELKMPGTSVKVTCKASGYTFTSYNINWVRQSPGQGLEWIGWVYPGNGNAGYDPKFQGRAVLTTDKSSSTAYMELRSLKSEDTAVYYCVR
Octodon degus V1269 ighv AJSA01218345.1 10480 AQGEVQLVQSGAELKKPGASVKVSCKASGYTFTSYFMYWVRQSPGQGLESIGWVNTATGGTAYAQKFQGRATITADTSSSTAYMELSSLKSEDLAVYYCVR
Octodon degus V1270 ighv AJSA01218348.1 4229 AHGEVQLVQSGAELKKPGTSVKVTCKASGYTFTSYLMHWVRQTPGQGLEWIGWVYPSDGDTSYAQKFQGRATLTADESSSMAYMELSSLKSEDTAVYYCAR
Octodon degus V1271 ighv AJSA01218351.1 4736 VLSQVQLQESGPGLVNPSETLSLTCTVSGFSLSSYGVQWTRQAPGKAMEWVGGIWSGGSIYYNPDLKSRVSISRDTYQSQVSLTLSSLRSEDTAVYYCAR
Octodon degus V1272 ighv AJSA01218357.1 8816 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSNFYMDWARQAPGKGLEWVARIRNKANSYTTDYAASVKGRFTISRDDSKSMVYLQMDTLRAEDTALYYCVR
Octodon degus V1273 ighv AJSA01218357.1 941 IQAEVQLMESGGGLVQPGGSLRLSCAASGFTFSNYYMDWARQAPGKGLQWVAHIRTKANGYTTEYAASVKGRFAISRDDSKSTVYLQMDTLRAEDTALYYCTG
Octodon degus V1274 ighv AJSA01218425.1 2461 VLSQVQLRESGPGLVKPSQTLSLTCSVSGFSIATSGYCWDWIRQRSGKGLMWMGRICWDGNTKYSPTFKSRVSITRDASKNEFFLELSAVTTEDTAVYYCE
Octodon degus V1275 ighv AJSA01218428.1 23758 VLSQVQLQETGPGLLRPSQTLSLTCSVSGYSISSGHSWTWIRQSQGKGLQWVGQIDSAGGTVYEPSLKSRVSISRDTPKNQFSLQLNSVTAEDMAVYYCAR
Octodon degus V1276 ighv AJSA01218433.1 1278 VQAEVQVVESGGGLVQPGGSLRLSCEGSGFTFSDYYITWVRQAPGKGLEWVGFIRNKANSHTTEYAASVKDRFTISRDDSKSTAYLQMTDLKTEETALYYCA
Octodon degus V1277 ighv AJSA01218438.1 5545 VLSQVQLQESGTGLVKPSQTLALTCTVSGFSITTSNYWWSWIRQPPGKSLEWMGHISYSGSTSYSQSLQSRISISRNTGNNQFSLQLNSVTTEDTATYYCAR
Octodon degus V1278 ighv AJSA01218447.1 5695 VQAEVQLLESRGGLVQPGGALRLSCAVSGFTFSDYHIEWVCQVPGKGLEWVGVIRNKANSHTTDYTVEGRFTISRDDSKSTAYLQMTQLKTEDTAVYYCA
Octodon degus V1279 ighv AJSA01218449.1 4506 VQAEVQLVESGGGLVQPGGALRLSCAASGFTFSNSWMHWIRQAPGKGLEWVGVIKKQADSYATEYATSVKGRFTISRDDPKSTLSLQMTQLKTEDTAVYYCAR
Octodon degus V1280 ighv AJSA01218453.1 8571 VQAEVQLVESGGGLVQPGGALRLSCAASGFTFSDYYMNWVRQAPGKGLEWVGVIRNKANSHTTEYAASVKGRFTISRDDSKSTLYLQMTQMKTEDTAVYYCAR
Octodon degus V1281 ighv AJSA01218458.1 4125 VLSQVQLQESGPGLVKPSQPLSLTCTVSGYSITSGYTWHWIRQPPGKSLEWMGYITYSGSTSYNPSLKSRISISRDTDKNQFSLQLNSVTTDDTATYYCAR
Octodon degus V1282 ighv AJSA01218468.1 2666 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMYWIRQAPGKGLEWVGVIRNKANSHTTEYATSVKGRFTISRDDSKSTLYLQMTQLKTEDTAVYYCAR
Octodon degus V1283 ighv AJSA01218473.1 6506 VQTEMQLVESEGSLVQPGGSLRLSCTAVGFTFSGYHMSWVCQAAGQGLEWVDFITNKASGHTTEYTTSVKGRVTMSRDDSKSTLRLQMNNVKTEDTAIYYCARH
Octodon degus V1284 ighv AJSA01218476.1 16954 VLSQVQLQESGPGLAKPSQPLSLTCTVSGFSITSSNTYWHWIRQPPGKIMEWMGYIGYSGSTGYNPSLQSRISISRNTAQNQFSLQLNSVSAEDTATYYCAS
Octodon degus V1285 ighv AJSA01218478.1 4768 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSHYMSWVRQAPGKGLDWVSAISSDGSSTYYAASVKGRFTVSRDNGKNALYLQMSSLRTEDTAVYYCAR
Octodon degus V1286 ighv AJSA01218486.1 2848 VQAEAQLVESGGGLVQPGGSLRLSCVGSGFNFGSAGMHWIRQASGKGLEWIAMIYYDSSKTNYADSVRGRFTISRDNAKSTSYLQMSSLRPEDTAVYYCAA
Octodon degus V1287 ighv AJSA01218487.1 3761 IIVPRCPVSGAAAGVRTWPDEALTTCSVSGFSITANAYGWNWIHQPPGKGPECMGYINYNGGTGSSPFLKSRISISRDTDMNQFSLQLSSPTADDTAMYYCAR
Octodon degus V1288 ighv AJSA01218490.1 32527 VQAEVLLVESGGGLVQPEGSMRLSCVASGFTFHNYGMHWIRQTPEKGLEWISAIGNGGNTYYADSVKGRFIISRDNGKKLVNLQMSSLRTEDTALYYCSR
Octodon degus V1289 ighv AJSA01218490.1 21661 VQAEVQLVESGGGLVKPGESLRLSCVASGFNFGSYGMHWIRQAPGKGLEWISAIGSTDTYYADSVKGRFTISRENSKNTLYLQMSSLKTEDTTLYYCTR
Octodon degus V1290 ighv AJSA01218490.1 11604 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYAWYWIRQRPGKSLEWMGYINSVGNTGYDPSVKNRISISRDTAKNQFFLQLSSLTAEDTAMYYCAR
Octodon degus V1291 ighv AJSA01218491.1 26184 VQAEVQLVESGGGLVQPGGSLRLSCVASGFNFGGYSMHWIRQAPGKGLEWITFIYYDGSDKQYADSVKGRFTISRDNNKNTLYLQMSSLRPEDTALYYCAK
Octodon degus V1292 ighv AJSA01218491.1 12033 VQAEVQLLETGGGLVQPGGSLRLSCVASGFNFGGYLMNWIRQAPGKGLEWIAYISSGSSYIYYPDSVKGRFTISRDNSQNTLYLQMNSLRAEDTAVYYCAR
Octodon degus V1293 ighv AJSA01218494.1 9410 VQADVQLLESGGGLVQPGGSLRLSCVASGFNFGGYSMDWIRQAPGKGLEWIAYISSGSSTIYYADSVKGRFTISRDNAKNTLYLQMNSLRTEDTAMYYCAR
Octodon degus V1294 ighv AJSA01218495.1 7916 VQAEVQLVESGGALVQPGGSLRLSCMASGFNFGSYGMHWIRQAPGKGLEWISLIYNDGSDKYYADSVKGRFTISRDNGKNMLYLQMSSLRPEDTALYYCAK
Octodon degus V1295 ighv AJSA01218498.1 3746 VQAEVQLLESGGGLVKPGGSLRLSCVASGFNFGGYGMHWIRQAPGKGLEWIAYISSSSGTIYYANSVKGRFTISRENSQNTLYLQMNSLRTEDTAVYYCAR
Octodon degus V1296 ighv AJSA01218501.1 8946 VQAEVQLVESGGSLVQPGGSLRLSCVASGFNFGGNDMNWIRQAPGKGLEWIAYISSSSGTIYYANSVKGRFTISRENSQNTLYLQMNSLRTEDTAVYYCAR
Octodon degus V1297 ighv AJSA01218502.1 1587 VQAEVQLVESRGGLVQPGGSLRLSCVASGFNFGGYTMDWVRQAPGKGLELISYISSNGGYLDYADSVKGRFMISRNNGQNTVYLQMNILRTDDTAVYYCA
Octodon degus V1298 ighv AJSA01218523.1 1191 VQAEVQLVESGGGLVQPGGSLRLSCVTSGFTLSSCVMSWIRQAPGRGLDWISDIDSSDANAYYADSVRGRFTISRDNSKNTLYLQMSSLRTEDTAVYYCA
Octodon degus V1299 ighv AJSA01218524.1 42770 VQAEVQLVESGGGLVRPGGSLRLSCVASGFTFSSSGMSWIRQVPGKGLDWVSAINSAGSSTYYADSVKGRFTISRDNSKNTLYLQMNNLRTEDTAVYYCA
Octodon degus V1300 ighv AJSA01218524.1 29586 VQAEVQLVESGGGLVRPGGSLRLSCAASGFTFSDYAMSWIRQAPGKGLDWVSAIGNSGSTYYADSVKGRFTISRDNSKNTLYLQMNNLRTEDTAMYYCER
Octodon degus V1301 ighv AJSA01218524.1 16831 VQAEVQLVESGGGLVRPGASLRLSCAASGFTFSSYAMSWIRQAPGKGLDWVSAIRYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNNLRTEDTAVYYCA
Octodon degus V1302 ighv AJSA01218524.1 5200 VQAEVQLVESGGGLVRPGGSLRLSCAASGFTFSSHAMSWIRQAPGKGLDWVSTIIYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNNLRTEDTAMYYCAR
Octodon degus V1303 ighv AJSA01218525.1 1682 VQAEERLVESGGGLVQPGGSLRLSCVGSGFTFSSYVMYWIRQAPGKGLEWISYISERSININYADSVKGRFTISRDNDKNTVYLQMNNLKTEDTAVYYCTR
Octodon degus V1304 ighv AJSA01218528.1 1009 VQCEVTLVESGGGLVQSSRSLRLSCTASGFTFSSYGMHWIRQAPGKGLEWIARIYADSSKMYYADSIKDRFTISRDNAKNMLYLQMSSLKPEDTAMYYCAR
Octodon degus V1305 ighv AJSA01218530.1 7136 VQAEVQLVESGGGLVQPGGSRKLSCVASGFTFSSYVMHWIRQAPGKGLEWLSYISETGKNINYADSVKGRFTISRDNDKNTLYLQMSSLKAEDTATYYCAR
Octodon degus V1306 ighv AJSA01218535.1 2713 VQAEVQLVESGGSLVQPGGSLRLSCAASGFTFSNYYMHWVRQAPGKGLEWISGISSSGGSTYYAESVKGRFTISRDNSKNMLYLQMNNVRTEDTALYYCAK
Octodon degus V1307 ighv AJSA01218537.1 7312 VQCEVTLVESGGGLVQPSGSLTLSCIASGFTFSSYGMHWICQAPGKGLEWIAYLYIDGSIKYYADSVKGRFTISRDNGKNMLYLQMSSLRSEDTAMYYCT
Octodon degus V1308 ighv AJSA01218539.1 8813 VQGEVTLVESGGGLIQPSGSLTLSCAASGFTISSYGMNWIRQAPGKGMEWIAYMYTASTTYYADALKDRFTISRDNAKNMLYLQMSSLRPEDTAMYYCAR
Octodon degus V1309 ighv AJSA01218541.1 3162 VQAEVQLVESGGGLVQPGVSLRLSCVASGFTFSSYHMHWIRQASGKGLEWISSLSETGKYTYYADSVKGRFTISRDNGKNTAYLQMNSLKTEDTAVYYCTR
Octodon degus V1310 ighv AJSA01218543.1 16201 VQAEVQLVESGGRLVQPGGSLRLSCAASGFAFSSYYMSWVRQTPGKGLEWIAYISGSSNDINYAASVKGRFTISRDNSKNTLYLQVNNVRTEDTALYYCAK
Octodon degus V1311 ighv AJSA01218543.1 8038 IQSEVQLVESGGGLVQPGGSVRLSCAASGFTFSSSYMNWIRQPSGKGLELVSYISGDSSDIYYLDSMKGRFTISRDNSKNTLYLQMNNVRTEDTALYFCA
Octodon degus V1312 ighv AJSA01218543.1 1641 VQAEVQLVESGGGLVRPGGSLRLSCAASGFTFSNYYMHWIRQTPGKGLEWIAYISGSSNDINYAASVKGRFTISRDNSKNTLYLQVNNVRTEDTALYYCAK
Octodon degus V1313 ighv AJSA01218562.1 2428 ARAEVQLVESGGALMQPGGSLRLSCLASGFTFSSYEMNWIRQSPGKGLEWISYISSGSGSIYYADSVKGRFTVSRDNSKNTLYLQMNSLRTEDTAVYYCAR
Octodon degus V1322 trdv AJSA01223487.1 23057 KGTLCDEVTQSPPYQTVTIGSETMLLCTYSTGYSNPDLYWYREVAGQPLQFILYRDNSVSRDADFVQGRFSVKHSKTHKTFHLVISPVRTEDKATYYCALT
Octodon degus V1364 trav AJSA01243079.1 2033 ERNRGYSVTQTEGPVALTERDLLTLNCTYQTIYSRPVLTWYVQYMDKAPQFLLRNAKENQRTESRGFQASFGKSHSSFHLKKPSLQLSDSAVYYCALG
Octodon degus V1365 trdv AJSA01243084.1 1289 SSIAQKVTQAQPPVSVQETEAVTLSCTYDTSETTYALFWYKQPRSGEMVFLIRQTSYDQQNATEGRYSVNFQKASKSFHLVISASQLEDSAVYFCVLSE
Octodon degus V1366 trdv AJSA01243089.1 2878 PSVAQKVTQVQSAAARREGETVSLDCSFETSWSSYYIFWYQQLPSGKMIFLIRQGSSSASGKSGRYSIKKAASSMSLIISALQMEDSGKYFCALWE
Octodon degus V1367 trav AJSA01243093.1 1667 LSGQQKEVEQSPESFVVTEGSTASLNCTYRNRTFQYFHWYRQYPGKGPLYLLYTYFNVEQKKGRFRIQLNKASQLVSLDITGFQHSDSATYLCAA
Octodon degus V1368 trdv AJSA01243100.1 7347 SSVTQTVTQVQRGTSRLEGETAALDCLYERILSLYYIFWYKQLPSGEMAFLIMQVSTDRNAESGCYSVSFWRAAKSVSLIISVLQTGDSAMYFCALVE
Octodon degus V1369 trav AJSA01243103.1 2214 VSSQQGGGAPQALSVQEGDNATVNCSYTASALNLQWYRQNTGGSPVLLILIRSNEKEKHRGRLRATMDTATKSSSLLLTAARAEDAAAYFCATD
Octodon degus V1370 trav AJSA01243109.1 860 VRGAQVEQSPSALSLQEGTSPTLRCNFSTTMMSVQWFQQNPEGSLINLLYMAPGTKQSGRLEATLNYQERSSTLKITASELGDSGSYFCAGEAQCSR
Octodon degus V1372 trav AJSA01245595.1 11799 RNNGKLVTQTEGQITLSEGASLAMNCSYENTQYPSLYWYVQYPGEGPQLLFGVSMANDEGSNKGFEVTYGEETSSFHLEKAFVQVSDSAVYYCALR
Octodon degus V1373 trav AJSA01245595.1 2301 GRGEQVEQHPSTLRVREGDSCVLNCTYSDSGSSYFPWYRQEAGQGPQLVIDIRSNVARNQKHRLLVSINKAARLVSLRISAAQPRDSAVYFCAAG
Octodon degus V1374 trav AJSA01245599.1 1577 DAGAQSVTQPDSRVAVPERAPVQLRCTYSYGGALYLFWYLQPPGQGPRLLLRYYSGDPRVQGIRSFEAEHRKNESSFHLRKRSVQWSDTAEYFCALS
Octodon degus V1375 trav AJSA01245603.1 3198 LKGEDLVEQCPLTLGPQEGDTTSMSCMYPVSISEHLQWYRQEEGLGLQHLFSMYSTGDVKQKGRLSITLLKNGSSLSIVASQPEDSATYFCAV
Octodon degus V1376 trav AJSA01245605.1 2583 MSAGEQVEQHPSSLSILEGGRSVMSCTYTDSTFSYFYWYKQEPGMGPQLLIQIFSNTDKKQDGRFIVLLNKKDKHFSLNITAAHPGDSATYLCVA
Octodon degus V1377 trav AJSA01245606.1 5958 TGSLAKTTQPFSMDSYEGQGVNLSCTHPNIATNEYIFWYRQVHHQGPQFVIQGYKTNVANEVASLFIPNDRKSSTLRLPQAALEDSAVYYCIVGA
Octodon degus V1378 trav AJSA01245736.1 1611 VSGQQKEVEQSPESLRVPEGSTTSLNCTYRVSASQTFRWYRQYPGRGPELLVSAYSSGDKEERRFSAHLERSSRHLSLHIRDAQSLDSATYLCAV
Octodon degus V1379 trdv AJSA01245742.1 1372 PSVALKVTQVQPATSGTEGEVATCHCEYETERGTDYLFWYKQLPSGELTFLIQSASGQTKRTGRYSISFPKANSMSFIISGLQMEDSARYFCAIQA
Octodon degus V1381 trav AJSA01246384.1 7733 RNRGYSVTQTEGPVALTERDLLTLNCTYQTVYSRPVLTWYVQYMDKAPQFLLRNAKENQQTESRGFQASFVKSHSSFHLKKPSLQLSDSAVYYCALG
Octodon degus V1382 trav AJSA01246384.1 2112 VRGQQVQQSPPAQILQEGAQTSLWCNFSTAVQNIQWFCQDPGDCRVSLFYIPSGTKQSGRLKAMTVAKERHSSLSISSSRPTDSATYFCAAAH
Octodon degus V1383 trav AJSA01246388.1 4453 SSIAQKVTQAQPPVLVQEMEAVTLSCTYDTSEPSYTLFWYKQPRSGEMVFLIRQTSYDQQNATEGRYSMNFQKASKSVHLVISASQLEDSAVYFCALGE
Octodon degus V1384 trav AJSA01246635.1 8199 GSNGDLVTQTEGQVTLYERTSLTVNCSYKTTWYPTLFWYVQYAREGPQLLLKATKDKEKGSNKGFEATYDKDTSSFNLQKASMEEPDSAVYFCVLG
Octodon degus V1386 iglv AJSA01247125.1 10274 SWAQAVLTQPPSVSGSPGETVSLSCSGNSNNLGRYSASWYQQLSGTAPKLIIYRNSNRPSGISDRFSGSKSGNSASLTISGLQSEDEADYYCLSYDDSLSA
Octodon degus V1387 trav AJSA01247624.1 2658 VSGQQKEVEQNPESLHVPEGARASLNCTYRNRAFDYFCWYRHYPGKGPLFLMSTYSNGEKKEGRFRMQLNTASQFVSLDITGSQHSDSATYLCAAS
Octodon degus V1388 trav AJSA01247759.1 727 VSGQQKEVEQSPEPLSVPEGATASLNCTYRDSTSQTFRWYRQYPGRGPELLLSAYSSGDEEERRIKAHLNRSSRHLSLHISDAWSHDSATYLCAV
Octodon degus V1389 trav AJSA01248023.1 1286 VHLHVLEQHPSFLRVQEGALAILNCTTRERTLLNFHWFRQYPGQGLVSFTSILADRKEQMDKDFREQLGKKKLHSIQNIPGAQLGDSATYFCAL
Octodon degus V1390 igkv AJSA01248257.1 626 ARCDIQMTQSPSSISASAGDRVTINCRASQGISKYLAWYQQKTGKGPKLLIYYATSLASGVPSRFSGSGSGTEFTLTISGLEPDDVATYYCMQYDSTP
Octodon degus V1391 trav AJSA01249301.1 3368 RICGQSVTQMEGPVSIAEGALLTINCSYTASGYLSLFWYVQYPTEGPQLLLKAVKANEKGRSKGFEAINDRAASSFHLEKAIVQVSHWGLYYCAVS
Octodon degus V1392 trav AJSA01249302.1 1054 VRGAQVEQSPSALSLQEGTSPTLRCNFSTTTKSVQWFQQNPEGSLINLLYVAPGTKQSGRLEATLNYQERLSTLKITASELWDSGSYFCAGEAQCSR
Octodon degus V1394 trav AJSA01250347.1 901 VRGLQVEQSPPAQILQEGANSTLWCKFSEPVNTVQWFCQYPGGHLVSLFYIPSGTKQSGRLKAMTIAKERHSSLSISSSRPTDSATYFCAAAQK
Octodon degus V1396 trav AJSA01252259.1 1663 VTGKIPVQESPISLAVLEGEDIILQCDYTVTPFNNLRWYRQDAGRGPVSLTITSSPENKTLSGRYTATLDETAKHSALRFAAAHLGNSASYICAVG
Octodon degus V1397 trav AJSA01252586.1 1179 VSSQQGGGAPRALSVQEGVNATLSCSYTASIRNLQWYRQNAGGSPVRLILIRSNEKEKHRGRLRAMLHTATKDSSLLLTAALAAEAAAYFCATD
Octodon degus V1400 ighv AJSA01258162.1 755 VMSQITLKESGPGILRPTETLRLTCSFSGFSLSTSGIGVNWIRQPPGKGLEWLAEIWYNDNKYYSPALKSRLSISKDTSNNQVFLTMSSVDPADTATYYCARR