WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rattus norvegicus AABR00000000.6 (AABR06) 825 143 14 187 394 19 10 58
Rattus norvegicus AABR00000000.7 (AABR07) 576 143 10 172 197 20 5 29
Rattus norvegicus AAHX00000000.1 (AAHX01) 604 153 12 172 221 20 7 19
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rattus norvegicus V74 igkv AABR06020258.1 3758 MRCDIQMTQSPPVLSASVGDRVTLSCKASQNINKNLDWYQQKHGEAPKLLIYYTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V75 igkv AABR06020263.1 3898 GKCDIQMTQSPASLSASLEEIVTITCQPSQGIGNYLSWYQQKLGKSPQLLIHSATSLEDGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQISSTP
Rattus norvegicus V82 igkv AABR06022369.1 29006 ADGDIVMTQSPTSMSISVGDRVTMNCKASQNVGSNVDWYQQKTGQSPKLLIYKASNRYTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQSNSYP
Rattus norvegicus V83 igkv AABR06022371.1 9070 STWNIVLTQSPASLAVILGQKATISCTASESVNKFGINLMHWYQQKPGQLPKILIYNEFSRAPGIPARFSGDEAELNFTLTIEPVEADDVATYYCQQGLTFP
Rattus norvegicus V84 igkv AABR06022371.1 35104 ADGDTVMTQSPASMSTSVGERVTVNCKASQSVGTVVAWFQQKPGQSPKRLIYLATNRHTGVPDRFTGSGFGRDFTLTISNVEAEDLAVYYCLQYDSIP
Rattus norvegicus V85 igkv AABR06022372.1 3255 SNGQITLTQQAESLWISPGERVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASVRTDGVPTRFIGSGSGTEFTLSIEHVQPEDFAIYYCLQ
Rattus norvegicus V86 igkv AABR06022372.1 25493 STGDIVLTQSPALAVSLGQRATISCRASQSVSTSSYNLMHWYQQKPGEQPKLLIYDASNLASGIPVRFSGSGSGTDFTLTINPVQADDIATYYCQQSRELP
Rattus norvegicus V87 igkv AABR06022374.1 15141 VYGNTVMTQSPTSMFTSVGDRVTMSCKASQNVGINVGWYQQKTGQSPKRLIYWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHNSYP
Rattus norvegicus V88 igkv AABR06022375.1 7216 TCGDILINQSPASLTVSAGEKVTMSCKSSQSLLYSENNQDYLAWYQQKPGQFPKLLIYGASNRHTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCEQTYSYP
Rattus norvegicus V89 igkv AABR06022386.1 2611 TCGDIVMTQSPFSLAVSEGEMVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYYASTRQSGVPDRFIGSGSGTDFTLTISDVQAEDLADYYCLQHYSYP
Rattus norvegicus V90 igkv AABR06022389.1 8187 TCGDIVMTQSPSSLAVSAGDKVTMSCKSSQSLLSSEYQGNYLSWFQQKPGQSPKLLISLASTRETGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYSYP
Rattus norvegicus V91 igkv AABR06022390.1 24705 STGDTVLTQSPALAVSPGERVTISCRASESVSTGMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNDP
Rattus norvegicus V92 igkv AABR06022391.1 8627 ADGNIVMTQSPKSMSISVGDRVTMNCKASQNVYNNIAWYQQKPGQSPKLLIYYASNRYNGVPDRFTGSGYGTDFTLTINSVQAEDAAFYYCQRIYNSP
Rattus norvegicus V93 igkv AABR06022394.1 50653 TCGDIAITQSPSSVAVSVGETVTLSCKSSQSLLYSENNKDYLAWYQQKPGQTPKPLIYWATNRHTGVPDRFTGSGSGTDFTLIISSVQAEDLADYYCEQYFVYP
Rattus norvegicus V94 igkv AABR06022395.1 12200 VYGNTVMTQSPTSMFTSVGDRVTMSCKASQNVGINVGWYQQKTGQSPKRLIYWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHNSYP
Rattus norvegicus V95 igkv AABR06022402.1 12913 TCGDIVMTQTPSSQAVSAGEKVTMSCKSSQSLLYSENKKNYLAWYQQKPGQSPKLLISWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYDTP
Rattus norvegicus V96 igkv AABR06022404.1 3622 STGDTVLTQSPALAVSLGQRVTISCRASKSVSTYMHWYQQKSGQQPKLLIYSASNLESGVPSRFSGSGSGTDFTLTIDPVEADDIANYYCQQSNELP
Rattus norvegicus V97 igkv AABR06022406.1 13965 STGDIVLTQSPALAVSLGQRATISCRASESVRSSMHWYQQKSGQQPKLLIYGASNLASGVPARFSGSGSGTDFTFTIDPVEADDIATYYCQQSRNDP
Rattus norvegicus V98 igkv AABR06022420.1 5512 ANANVMMTQSPTSLAVSAGEMVSLSCKSSENLYSSTYKENYLAWYQKKSGQSPKLLIFYASHRASGVPDRFIGSGSGTDFTLTIRSMQAEDTADYYCARHYSSL
Rattus norvegicus V99 igkv AABR06022420.1 59245 TKGDVVLTQTPSTLSATIGQSVSISCRSSQSLLDSAGNTYLYWYLQRPGQSPQLLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V100 igkv AABR06022423.1 4893 TKGDVVLTQTPSILSATIGQSVSISCRSSQSLLDSDGNTYLYWFLQRPGQSPQRLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V101 igkv AABR06022427.1 19653 SKGDVVLTQSPATLSVTPGERISLSCRASESVDTYLHWYQQKPNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINGVELEDLSIYYCQQGNSLP
Rattus norvegicus V102 igkv AABR06022428.1 9260 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLDSDGDTYLNWLLQRPGQSPQLLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V103 igkv AABR06022435.1 14854 AQCDIHMTQNPVSLSAFIGDKVTITCWASQDISRYLGWYQQKQGQSPKFLMYYASNLLSVVPSRFSGSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V104 igkv AABR06022438.1 1336 GICDIQMTQSPASLSASLGETVTIECLASEDIYSNLAWYQQKPGKSPQLLIYDASSLQDGVPSRFSGSESGTQYSLEINSLQSEDAATYFCQQHHDYP
Rattus norvegicus V105 igkv AABR06022438.1 19799 GICDIQMTQSPASLSASLGETISIECRASEDIYSNLAWYQQKSGKSPQLLIYAANRLQDGVPSRFSGSGSGTQYSLKISGMQPEDEGDYFCLQGSKFP
Rattus norvegicus V106 igkv AABR06022456.1 33677 AICDIQMTQSPASLSASLGETVTIECRASEDIYNGLAWYQQKPGKSPQLLIYNANSLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQQYYDYP
Rattus norvegicus V107 igkv AABR06022459.1 6753 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRPGQPPQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQSTHAP
Rattus norvegicus V108 igkv AABR06022461.1 24867 SDVTGETTQSPASLSFSLGETATMTCRASDSVGSYLAWYQQKTGQVPRLLIHTASTRASGVPARFSGSGSGTDFTLTVSSLESEDVAIYYCQPYKNWS
Rattus norvegicus V109 igkv AABR06022462.1 2789 AQCDIHMTQNPVSLSAFIGDKVTITCRASQDISRYLGWYQQKQGQSPKFLMYYASNLLSGVPSRFSDSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V110 igkv AABR06022473.1 12074 SRGNIVLTQSPATLSVTPGESVSLSCRASQSISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSIYYCQQSYSSL
Rattus norvegicus V111 igkv AABR06022473.1 29084 AICDIRMTQSPASLSASLGETVNIECLASEDIYSDLAWYQQKPGKSPQLLIYNANSLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQYNNYP
Rattus norvegicus V112 igkv AABR06022478.1 34774 AICDIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKINSLESEDAATYFCLQDSEYP
Rattus norvegicus V113 igkv AABR06022478.1 108395 SRGDIVLTQSPTTLSVTPGETVSLSCRASHSIGTNLHWYQQKTNESPRLLIKYASQSISGIPSRFSASGSGTDFTLNINNVEFDDVSSYFCQQTQSWP
Rattus norvegicus V114 igkv AABR06022478.1 133577 ARCDIQMTQSPASLSASLGETVTIECLASEDIYDILAWYQQKPGKSPQLLIYDASSLHTGVPSRFSGSGSGTQYSLKINSLQPEDFASYYCQNGLSAP
Rattus norvegicus V115 igkv AABR06022484.1 6398 AICDIQMTQSPPSLSASLGETISIECLASEGIYSNLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQFSLKISSMQPEDEADYFCQQSYKFP
Rattus norvegicus V116 igkv AABR06022492.1 3650 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLHWLLQRPGQSLQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQGTHAP
Rattus norvegicus V117 igkv AABR06022492.1 36436 SDVTGETTQSPASLSFSLGETATMTCRASDSVGSYLAWYQQKTGQVPRLLIHTASTRASGVPARFSGSGSGTDFTLTVSSLESEDVAIYYCQPYKNWS
Rattus norvegicus V118 igkv AABR06022493.1 6823 SRGNIVLTQSPATLSVTPGESVSLSCRASQSISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSIYYCQQSYSSL
Rattus norvegicus V119 igkv AABR06022493.1 30443 AICDIRMTQSPASLSASLGETVNIECLASEDIYSDLAWYQQKPGKSPQLLIYNANSLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQYNNYP
Rattus norvegicus V120 igkv AABR06022494.1 31821 AICDIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKINSLESEDAATYFCLQDSEYP
Rattus norvegicus V121 igkv AABR06022497.1 1585 SRGDIVLTQSPATLFVTPGERISLSCRSSQNIGTNIHWYQEKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVEPEDFSVYYCQQSNSC
Rattus norvegicus V122 igkv AABR06022499.1 1612 AIRDIQMTQSPASLSASLGETVTIQCRASEDIYSGLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQYSLKISSMQTEDEGVYFCQQGLKYP
Rattus norvegicus V123 igkv AABR06022504.1 34233 TNGDVVLTQTPPTLLATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRTGQSPQPLIYLVSKLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQFTHYP
Rattus norvegicus V124 igkv AABR06022511.1 16782 AICDIQMTQSPHSLSASLGETVSIECLASEGISNYLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKISNMQPEDEGVYYCQQGYKYP
Rattus norvegicus V125 igkv AABR06022513.1 29803 IVSSGEIVLTQSPTTMAASPGEKVTLTCLASSSVNYMYWYQQKSSASPKLLIYYTSSLASGVPDRFSGSGSGTSYSLTISSMEAEDAAIYYCLQLTST
Rattus norvegicus V126 igkv AABR06022518.1 1831 IVSSGETVLTQSPTTTAASPGEKVTITCRASSSVSYMHWYQQKSGASPKLWIYDTSNRASGVPNCFSGSGSGTSYSLTISSMETEDAATYYCQQWSSN
Rattus norvegicus V127 igkv AABR06022519.1 9812 SSGEIVLTQSPTTMAASLGEKVTITCSASSSVNYMHWYQQKSGTSPKLLIYYTSSLASGVPDRFSGSGSGTTYLLRISTMETEDAATYYCQYWSSSQ
Rattus norvegicus V128 igkv AABR06022519.1 28372 SSGEIVLTQSPTTMAASPGEKVTLNCLASSSVSYMNWYQQKSGASPKLWIYGTSNLASGVPNRFSGSGSGTSYSLTISSMEAEDVATYYCLQLSSY
Rattus norvegicus V129 igkv AABR06022525.1 8636 IVSSGEIVLTQSPTTTAASPGEKVTITCLASSSVSNMYWYQQKSGASPKLLIYSTSSLASGVPDRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSN
Rattus norvegicus V130 igkv AABR06022532.1 5777 TVSSGEIVLTQSPTTMAASPGEKVTLTCHASSSVSYMHWYQQRSGASPKLWIYETSKLASGVPNRFSGSGSGTSYSLTINSMETEDAATYYCQQGSSY
Rattus norvegicus V131 igkv AABR06022534.1 12898 SSGEIVLTQSPITMAASPGEKVTITCRASSSVSYMYWYQQKSGASSKLWIYDTSKLASGVPDRFSGSGSGTSYSLTISSVETEDAATYYCQQWSST
Rattus norvegicus V132 igkv AABR06022537.1 7765 LVSSREIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQMSNASPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCST
Rattus norvegicus V133 igkv AABR06022539.1 6473 LVSSREIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQMSNASPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCST
Rattus norvegicus V134 igkv AABR06022545.1 8107 IVSNGEIVLIQSLTTMTASPGEKVTITCSGSSSVRYMYWYQQKSGASPKLCIYDTSNLASGVSDRFSGSGSGTSYYLTISTIEAEDAATYYCQQWSSNQ
Rattus norvegicus V135 igkv AABR06022545.1 23356 SSGEIILTQSPTIMAASLGEKITITCSASSSLSYMYWYQQKSGASPKLWVHRTSNLASGVPDRFSGSGSGTSYYLTISTMEAEDAATYFCHQWSSSQ
Rattus norvegicus V136 igkv AABR06022551.1 21363 SRGDIVLTQSPATLSVTPGESVSLSCRASQGISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSVYYCQQSYSLP
Rattus norvegicus V137 igkv AABR06022553.1 13152 AICDIQMTQSPASLSASLGETVSIECLASEGISNDLAWYQQKSGKSPQLLIYAASRLQDGVPSRFSGSGSGTRYSLKISGMQPEDEADYFCQQSYKYP
Rattus norvegicus V138 igkv AABR06022560.1 12581 TVSSGEIVLTQSPTTIAASPGEKVTITCRASSSVSYMYWYQQKSGASPKLWIYDTSKLASGVPNRFSGSGSGTSYSLTINTMETEDAATYYCQQWSST
Rattus norvegicus V139 igkv AABR06022565.1 30942 TVSSGEIVLTQSPTTMAASPGEKVTITCHASSSVSYMHWYQQKPGASPKPWIYATSTLASGVPDRFSGSGSGTSYSLTINNVEAEDAATYYCQQWNY
Rattus norvegicus V140 igkv AABR06022573.1 7882 IVSSGEIVLTQSPTTMAASPGEKVTITCRASSSVSYMHWFQQKSGTSPKPWIYDTSKLASGVPDRFSGSGSGTSYSLTISSMEAEDAATYYCLQRSSY
Rattus norvegicus V141 igkv AABR06022573.1 22886 IVFSGEIVLTQSPTTMAESPGEKVTITCSASSSVSYMHWYQQKTGTSHKLLIYKTYTLASGVPHHFHGTGSGTSYSLTIITMETKDVSTYYCKQWSSN
Rattus norvegicus V142 igkv AABR06022575.1 4931 SKGEIVLTQSPVSITASQGEKVTITCRASSSISSNYLHWYQQKAGSYPKLLIYRTSILASGFPDSFSGSGSDTSYTLTISCMQDEVAASYYCQQGSSS
Rattus norvegicus V143 igkv AABR06022580.1 45573 SRGDVVLVTQTPSSLPVSLGDQASISCKSSKSLVHNNGITYLAWFLQKPGQLPQSLIHTVSNRFSGVPDRFSGSGSVSDFTLKISRVEPEDLGVYYCLQYVHYP
Rattus norvegicus V144 igkv AABR06022583.1 4513 SSGAIVLNQSPSSIVASQGEKVTITCRASSSISSNYLHWYQQKPGAFPKLVIYSTSYRASGVPSRFSGSGSGTSYSFTISRVEAEDVATYYCQQGSSN
Rattus norvegicus V145 igkv AABR06022584.1 7050 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPRQLIHYTSTLVSGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLP
Rattus norvegicus V146 igkv AABR06022585.1 4389 ARCDIQMTQTPSSMPASLGERVTISCRASQGISNYLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQYDSSP
Rattus norvegicus V147 igkv AABR06022590.1 58861 SRGDVVLVTQTPSSLPVSLGDQASISCKSSKSLVHNNGITYLAWFLQKPGQLPQSLIHTVSNRFSGVPDRFSGSGSVSDFTLKISRVEPEDLGVYYCLQYVHYP
Rattus norvegicus V148 igkv AABR06022594.1 52018 ARCDIQLTQSPSTLPASLGERVTISCRASQSISNSLNWYQQKPDGTVKRLIYSTSTLESGVPSRFSGSGSGTDYSLSISSLESEDFAMYYCLQYATY
Rattus norvegicus V149 igkv AABR06022594.1 60426 STGDVVMTQTPVSLSVSLGNQASISCRSSQSLFHSDGNTYLSWYLQKPGQSPQLLIYLASNRFSGVSNRFSGSGSGTDFTLKISRVEPEDLGVYYCFQH
Rattus norvegicus V150 igkv AABR06022606.1 6645 SRGDVVMTQTPLSLPISLGDQASFSCRSSQSLLHSNGNTYLAWYLQKSGQSPQILIYRISNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQH
Rattus norvegicus V151 igkv AABR06022608.1 45001 SSGAIVLNQSPSSIVASQGEKVTITCRASSSISSNYLHWYQQKPGAFPKLVIYSTSYRASGVPSRFSGSGSGTSYSFTISRVEAEDVATYYCQQGSSN
Rattus norvegicus V152 igkv AABR06022609.1 11231 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPRQLIHYTSTLVSGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNSP
Rattus norvegicus V153 igkv AABR06022611.1 28038 ARCDIQMTQSPSSLPASLGERVTISCRASQGISNNLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQDASFP
Rattus norvegicus V154 igkv AABR06022613.1 12559 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNYLSWYQQKPGKSPQLLIHSATSLADGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQHYSAP
Rattus norvegicus V155 igkv AABR06022613.1 31629 GKCDIQMTQSPASLSASLDEIVTITCQASLDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKICKLQVEDTGIYYCLQHYSAP
Rattus norvegicus V156 igkv AABR06022617.1 18259 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKRLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDFATYFCLQHNSF
Rattus norvegicus V157 igkv AABR06022622.1 69 MRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V158 igkv AABR06022623.1 10273 MRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V159 igkv AABR06022623.1 39215 GKCDIQVTQSPASLSASPEEIVTITCQASQDIGSSLLWYQQKPGKSPQLLIYSATILADGVPSRFSGSRSGTQYSLKISRLQVEDIGTYYCLQVSSSP
Rattus norvegicus V160 igkv AABR06022628.1 14817 MRCDIQMTQSPSLLSASVGDRVTLSCKASQSIYNSLAWYQQKLGEAPKLLIYKTNSLQTGIPSSFSGSGSGTDYTLTISSLQPEDVATYFCQKYNSG
Rattus norvegicus V161 igkv AABR06022631.1 743 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCLQHSSR
Rattus norvegicus V197 trbv AABR06030623.1 152429 HTGPNVQQIPSHQVIDIGQTVILSCDPVSNHLYFYWYKQILGQQMEFLVSFFDGKIGEKSKLFKDEFLVDRQHGSYFTLKIQRTTLEDSAVYFCASSL
Rattus norvegicus V198 trbv AABR06030624.1 331 PLETAVFQTPKHRVAQVGSEVFFKCDQTLGHDTMYWYKQDSKQLLKVMFSYNNKQRILNETASSRFLPQSSDKAHLNLRIKSVEPGDSAVYLCASS
Rattus norvegicus V199 trbv AABR06030625.1 58507 PANSGVVQSPRHIIKEKGGRSILKCIPISGHRSVAWYQQTQGQELTFLIQKYEQMDRGKGNLPSRFSVQQFSDYHSEMNMSALELEDSAVYFCASS
Rattus norvegicus V200 trbv AABR06030625.1 62370 HMEAAVTQSPRNKVTLKGGKVTLSCKQNNNHNNMFWYRQDMGHGLRLIHYSYDVNSTEKGDVPNGYKVSRPSQGDFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V201 trbv AABR06030625.1 65970 SAHSGVVQSPRHIIKEKGGRSILKCIPISEHNNVAWYQQTHGQELKFLIRHYEKSEREKGNLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Rattus norvegicus V202 trbv AABR06030625.1 69575 HMEAAVTQSPRNKVTLKGGKVTLSCKQNNNHNNMFWYRQDMGHGLRLIHYSYDVNSTEKGDVPNGYKVSRPSQGDFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V203 trbv AABR06030625.1 78031 HMEAAVTQSPRNRVAVTGGEVTLSCRQTNNHDYMYWYRQNMGDELRLIHYSYDVNRTEKGDVSSGYKASRPSQEDFSLILESASLSQTAVYFCASSD
Rattus norvegicus V204 trbv AABR06030627.1 3314 LSETGVTQSPRYAIIQESQTVSFWCDPVSGHERLYWYQQHRAQGPRLLVYFQNEVDIDKSQLPKDRFFAVRTEGVNSTLKIQSAKQSDSATYLCASSL
Rattus norvegicus V205 trbv AABR06030627.1 8365 NADAGVTQTPRHEVAEKGQTIILTCEPVSGHNDLFWYRQTKIKGLELLSYFLNKSPMEDAGALKDRFTAEIQDSSISTLKIQPTEPQDSAVYLCASSL
Rattus norvegicus V206 trbv AABR06030627.1 19652 PTNAGVIQTPRHKVTGKGQEVTLRCEPISGHSAVFWYRQSTVKGLELLIYFNNQAPIDDSGMPKERFSAQMPNQRLSTLKIQTTQPQDSAVYLCASSL
Rattus norvegicus V207 trbv AABR06030627.1 28168 FVDTMVMQNPRYKVARVGKPVNLICSQTMDHDSMFWYQQKPNQGPKLLLYYYDSNLNRETDTSDNFQSSRHNTSFCSLNITSAGLGDSAMYLCASSR
Rattus norvegicus V208 trbv AABR06030627.1 41276 TTHGGAITQTPKFLIGHEGQELTLKCKQNFNHDSMFWYRQDPGKGLRLIYYSITESDLQKGDLSEGYDASRKEKASFSLTVKSAQKRQMAVYLCASSI
Rattus norvegicus V210 trbv AABR06030627.1 61481 SMDSGVIQSPRHLVKGKEQKARMQCTPIKEHSYVYWYYKKLGEDLKFLVYFQNTDIMDKTDMIKKIISAECFTNKTCTIEIKSSKLTDSAVYYCASSQ
Rattus norvegicus V211 trbv AABR06030627.1 77552 SLDCQVIQTPQHLLRGKGQKAKMTCIAEKGHTFVYWYQQKQNKELKFLIYFQRQEPRDSIDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Rattus norvegicus V212 trbv AABR06030627.1 80862 SFDAAVIQTPRHLIKMKGQQVEMNCNPEKDHPAVFWYQQKQSKELKFLIYFQNQRPVDQIDMVKERFSAEWPSNSLCSLKISTSEVEDSALYLCSSSQ
Rattus norvegicus V213 trbv AABR06030627.1 83018 SFVAEVTQTPRYLIKEKGQRVNMSCSPEKAHTAFYWYQQNQKKELTFLINFRKVDIIDQTDLVKKRFSAQCVPDLHCTLEIPSSEEGDSALYFCASSL
Rattus norvegicus V215 trbv AABR06030674.1 1866 LVDMNVTQMPRNLIKRVGKNVLLECVQDMKHERMYWYRQDPDLGLRLIYLSYDVDSNSEGDIHKGYKVSRKKRENFSLILESAKTNHTSVYFCASSL
Rattus norvegicus V216 trbv AABR06030674.1 7335 SVFSVFLYQKPNRDICQSGTSLKIQCVVDSQVALMFWYQQFQGQNLMLMATANEGSEATYESGFSREKFPISRPNLTFSTLTVNNARPEDSSVYFCSSG
Rattus norvegicus V217 igkv AABR06031307.1 1511 ARCDIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRPMIYYATNLANGVPSRFSGSRSGSDYSLTISSLESEDMADYHCLQYKQYP
Rattus norvegicus V218 igkv AABR06031308.1 898 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLLGTSGKTFLNWILQRPGQSPKRLIYQVSKLYSEVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQG
Rattus norvegicus V219 igkv AABR06031310.1 6298 ARCDIQMTQAPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMADYYCVQSKESP
Rattus norvegicus V220 igkv AABR06031313.1 12057 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V221 igkv AABR06031314.1 149 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V222 igkv AABR06031315.1 1891 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V223 igkv AABR06031317.1 37930 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDYSLTINSLESEDMAIYYCLQHNEYP
Rattus norvegicus V224 igkv AABR06031317.1 52403 ARCDIQMTQSPSSMSVSLGDRVTITCRASQDIGNYLSWYQQKPEKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLESEDTGIYFCLQHKQYP
Rattus norvegicus V225 igkv AABR06031319.1 36410 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V226 igkv AABR06031430.1 2551 ADGNTVMTQSPTSMFISVGDRVTMNCKASQNVGTNVDWYQQKTGQSPKLLIYGASNRYTGVPDRFTGSGSGTDFTLTISNMQAEDLAVYYCLQYNYNP
Rattus norvegicus V227 igkv AABR06031432.1 940 STGDIVLTQSPALAVSLGQRATISCRASQSVSISRYNLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTINPVQADDIATYYCQQSRESP
Rattus norvegicus V230 igkv AABR06031540.1 25143 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V232 igkv AABR06031550.1 2272 ARGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGRSPKRLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCAQT
Rattus norvegicus V233 igkv AABR06031554.1 29478 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V234 igkv AABR06031555.1 42776 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V235 igkv AABR06031559.1 24443 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V236 igkv AABR06031559.1 52381 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V237 igkv AABR06031560.1 7986 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V238 igkv AABR06031561.1 1473 ARCDIQMTQSPSSMSVSLGDTVTITCRASQDVGIYVNWFQQKPGKSPRHMIYRATNLADGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQYDEYP
Rattus norvegicus V239 igkv AABR06031561.1 28116 THSDIVMTQTPLSLSVAIGQSASISCKSSQSLKYSDGKTYLNWVFQSPGQSPKRLIYQVSKLDSGVPDRFSGTGSETDFTLKISRVEAEDLGVYYCCQVHIL
Rattus norvegicus V240 igkv AABR06031561.1 68035 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V241 igkv AABR06031571.1 3140 TRGDVVMTHTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGQSPKLLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCVQATHFP
Rattus norvegicus V242 igkv AABR06031581.1 6363 ARCDVHMTQSPSSMSASLGDKVTPTCWASQNISRYLSWLQQQPRKSPKVLIYGATILEDWVPSKFSGSGSRADYSFTISNLVSEDFGTYYCLQYLHF
Rattus norvegicus V243 igkv AABR06031583.1 2526 ARCDIQVTQSPSSLLASLGERVTITCQTSQSISNNLNWYQQKPGQAPMLLIYYATSLQTGMPSRFSGQYSGRSFTLTITSLEPEDIANYFCLQHYSA
Rattus norvegicus V244 igkv AABR06031596.1 20379 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V245 igkv AABR06031596.1 49098 SRSDVVLTQTLVAQPVRLGDQASISCRSSQSLVLTDGHTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGSDFTLKISRVEPEDLGVYYCFEG
Rattus norvegicus V246 igkv AABR06031598.1 38841 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V247 igkv AABR06031599.1 32088 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V248 igkv AABR06031605.1 3115 IQCDVQMTQSPYNLAASPGESVSINCKASKSISKYLAWYQQKPGKANKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRSLEPEDFGLYYCQQHNEY
Rattus norvegicus V249 igkv AABR06031607.1 32402 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V250 igkv AABR06031609.1 21925 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V251 igkv AABR06031609.1 43427 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHRSRIS
Rattus norvegicus V252 igkv AABR06031627.1 1522 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V253 igkv AABR06031627.1 12288 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V254 igkv AABR06031627.1 37478 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V255 igkv AABR06031627.1 83214 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDYSLTINSLESEDMAIYYCLQHNEYP
Rattus norvegicus V256 igkv AABR06031634.1 6163 MRCDIQMTQSPSFLSASVGDRVTLSCKASQNINKYLAWYQQKLGEAPKLLIYNANSLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSW
Rattus norvegicus V257 igkv AABR06031675.1 20379 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V258 igkv AABR06031675.1 49098 SRSDVVLTQTLVAQPVRLGDQASISCRSSQSLVLTDGHTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGSDFTLKISRVEPEDLGVYYCFEG
Rattus norvegicus V259 igkv AABR06031764.1 4015 SRGDVVMTQTPVSLPVSLGSQVSITCRSSHSLVYSDGNTYLSWYLQKPGQDPQPLIYKVSNRFSGVPDRFSGSRSGSYFTLKISRGEPEDLGVYYCGQR
Rattus norvegicus V260 igkv AABR06031768.1 3382 AQCDVQMTQSPSYLAASPGESVSISCKASKSISNYLAWYQQKPGEANKLLIYSGSTLQSGTPSRFSGSGSGTDFTLTIRNLEPEDFAVYYCQQYYEK
Rattus norvegicus V261 igkv AABR06031771.1 28 ARCDIKMTQSPSSLSASLGERVTISCRASENINNILAWYQKKEDGSVKLLIYYTSNLQSGVPSRFSGSGSGKDYSLTISGLESEDIATYYCQQGYT
Rattus norvegicus V327 ighv AABR06046473.1 6133 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V328 ighv AABR06046479.1 3828 LLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAIYFCTR
Rattus norvegicus V329 ighv AABR06046482.1 468 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V330 ighv AABR06046483.1 4761 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V331 ighv AABR06046487.1 15261 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V332 ighv AABR06046491.1 21404 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V333 ighv AABR06046496.1 41408 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V334 ighv AABR06046496.1 47541 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V335 ighv AABR06046496.1 64720 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V336 ighv AABR06046502.1 25396 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYDMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V337 ighv AABR06046502.1 61930 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V338 ighv AABR06046502.1 69786 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V339 ighv AABR06046502.1 90345 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V340 ighv AABR06046502.1 98623 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V396 igkv AABR06059006.1 3363 ATGDIMMTQSPLSVAVTPGESASISCRSSKSLLHSNGITYLSWYLQRPEKSPQLLIYQISNLASGVSGRFSGSGSGTDFTLKISRVETEDVGIYYCVQFLEVP
Rattus norvegicus V451 igkv AABR06069504.1 3536 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V452 igkv AABR06069504.1 14882 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V453 igkv AABR06069504.1 40071 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V454 igkv AABR06069505.1 13090 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V455 iglv AABR06069517.1 22834 AISQAVVTQESALTTLPGGTVTLTCHSSTGAVTTSNYANWIQEKADHLFTGIVGDTSNRAPGAPARFSGSLLEGKAALTITGAQIEDEATYFCSLWYSNH
Rattus norvegicus V456 iglv AABR06069517.1 60883 SYGQFTLTQPKSVSGSLRSTITIPCERSSGDIGDSYVSWYQQHLGRPPINVIYADDQRPSEVSDRFSGSIDSSSNSASLTITNLQMDDEADYFCQSYDSNIDI
Rattus norvegicus V457 iglv AABR06069517.1 100791 SCAQAVLTQPNSVSTSLGSTVKLSCTLSSGNIENNYVHWYQQYEGRSPTTMIYNDDKRPDGVPDRFSGSIDSSSNSAFLTINNVEIEDEAIYFCHSYVSSI
Rattus norvegicus V458 iglv AABR06069517.1 124987 SCAQFVLTQPNSVSTNLGSTVKLSCKRSTGNIGSNYVNWYQQHEGRSPTTMIYRDDKRPDGVPDRFSGSIDRSSNSALLTINNVQTEDEADYFCQSYSSGI
Rattus norvegicus V459 iglv AABR06069519.1 19742 SCAQFVLTQSNSMSTSLGSTVKLSCKRSTGNIGSSYVYWYQQHEGRSPTTMIYDDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQIEDEAIYFCQSYSSGI
Rattus norvegicus V460 iglv AABR06069519.1 35718 IYEDSKRLIQPPSASVTLGNTVSITCSGDELPKKYAQWYQQKPDQSIVTVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCQSAYSDDNL
Rattus norvegicus V461 iglv AABR06069519.1 48501 YVTSYELIQPPSASVTLGNTVSLTCVGDELSKRYAQWYQQKPDKTIVSVIYKDSERPSGISDRFSGSSSGTTATLTIHGTLAEDEADYYCLSTYSDDNL
Rattus norvegicus V462 iglv AABR06069519.1 76965 SCAQVVLTQPKSVSTSLESTVKLSCKLNSGNIGSYYIHWYQQHEGRSPTTMIYRDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQTEDEAIYFCHSYDSSI
Rattus norvegicus V463 iglv AABR06069519.1 91494 SWAQVVLTQPNTVSTSLGITVKLSCKCSSGNIGSYSVHWYQQHEGRSPTTMIYKDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQTEDEAVYFCHSYDSNI
Rattus norvegicus V464 iglv AABR06069526.1 35051 SVTSYELIQPPSASVTLGNTVSLTCVGDELPKRYAYWYQQKPDQSIVRVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCHSTYSDDKL
Rattus norvegicus V465 iglv AABR06069526.1 80816 SVTSYELIQPPSASVTLGNTVSITCSGDELPKRYAYWYQQKPDKSIVRVIYKDSERPSGISDRFSGSSSGTTATLTIRDTQAEDEADYYCHSTYSDDKL
Rattus norvegicus V466 iglv AABR06069532.1 32875 SVTSYELIQPPSASVTLGNTVSLTCVGDELPKRYAYWYQQKPDQSIVRVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCHSTYSDDKL
Rattus norvegicus V467 iglv AABR06069532.1 78229 SVTSYELIQPPSASVTLGNTVSITCSGDELPKRYAYWYQQKPDKSIVRVIYKDSERPSGISDRFSGSSSGTTATLTIRDTQAEDEADYYCHSTYSDDKL
Rattus norvegicus V468 iglv AABR06069533.1 23684 SVTSYELIQPPSASVTLENTVSITCSGDELSNKYAHWYQQKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILTIRDAQAEDEADYYCLSTYSDDDL
Rattus norvegicus V530 trdv AABR06082296.1 214 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V531 trav AABR06082851.1 59200 ASGQGVEQPAKLMSVEGTFARVNCTYSTSGFNGLSWYQQHEGQAPVFLFYTVLDGLKDSGRFSTFLSRSDGYSYLLLTELQIKDSASYLCAVR
Rattus norvegicus V532 trav AABR06082861.1 1709 SWSLAKTTQPLSRDSYEGQAVNVSCSHTNIATSEYIYWYRQASHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPRVSLRDTAVYYCIVA
Rattus norvegicus V533 trav AABR06082865.1 107 VSRGEQVEQRPSHLSVLEGDSAAIVCTYTDSNNDYFFWYKQEFGAGLQLLMSVLSNVNRKEEQGLTVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V534 trav AABR06082868.1 7956 ESQGEQVKQHPSSLSVQEGATALINCSYTDSASVYFPWYKQEPGRRPQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLNITATEPGDSAVYFCTAS
Rattus norvegicus V535 trav AABR06082870.1 311 VSSQQKVQQSPESLIVSEGDTASLNCTFSDSASNSFWWYRQHSGKGPKALMSIFSSGDKQEGRFTAHLNIASLHVSLHIRDLGPSDSALYLCAV
Rattus norvegicus V536 trav AABR06082873.1 732 VSSQQKVQQSPESLIVSEGDTSSLNCTFSDSSSYSFWWYRQHSGEGPKVLMSIVSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYFCAVS
Rattus norvegicus V537 trav AABR06082873.1 5961 WTHGNSVTQTQGQVTLSEEEFLFINCTYSSTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYEKRTTSFHLQKASVQESDSAVYYCVLG
Rattus norvegicus V538 trav AABR06082874.1 1210 RTHGNSVTQTQGQVTLSEGKFLFINCTYSTTTYPTLFWYVQHPGEGPQLLLKVTTANNKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALG
Rattus norvegicus V539 trav AABR06082874.1 13391 VRSQEKVQQNPDILIVPEGATASFNCTSSDRNVDYFWWYRQHSGKAPKMLMSIVSNGVKEEGRFTAHFNKASLHVSLHINDSQPSDSAVYLCAVS
Rattus norvegicus V540 trav AABR06082876.1 2751 GVRGIQVEQNPEALSLHEGAGSGLRCNFSTTMNSVQWFRQNPRGSLINLFFLASGTKENGRLKSTFDSKERYSTLHISDAQLEDSGTYFCAAE
Rattus norvegicus V541 trav AABR06082882.1 4205 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSTSDYFWWFRQYSGKSPKALMSIFSNGDKQEGRFTVHLNKTSLHVSLHINDSQPTDSAVYLCAVS
Rattus norvegicus V542 trav AABR06082882.1 8322 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSASQYFWWYRQYSGKSPKALMSIFSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYLCAV
Rattus norvegicus V543 trav AABR06082888.1 233 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V544 trav AABR06082987.1 8160 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYLQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V545 trav AABR06083013.1 1508 VSRGEQVEQHLSHLSVWEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQYFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V546 trav AABR06083014.1 226 VSRGEQVEQRLSHLSVREGDSAFIICTYRDSLSSYFYWYKQEPRAGLQLLIMQVFWSTEIKEAQGIIVLLNKKDKRLSLNITSARIGDSATYFCAVSTQCSS
Rattus norvegicus V547 trav AABR06083017.1 1322 VSSQQKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELLSIFSTGEKEEGRFKIHVIKANLHVFLHIKDSQPGDSALYFCAV
Rattus norvegicus V548 trav AABR06083018.1 3525 MKKTHGDSVTQKEGQVTLSEGDFLFINCTYSTTGYPTLFWYVQYPGEGPQLLFQVTTANNKGKNRGFEALYDKGTTSFHLEKASVQESDSAVYYCALS
Rattus norvegicus V549 trav AABR06083019.1 2460 VSSQQKVQQSPESLTVPEGAKTSLNCTFSSSASQYFAWYRQHPGKEPKELLSIFSTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V550 trav AABR06083023.1 78 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASK
Rattus norvegicus V551 trav AABR06083023.1 3410 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V552 trav AABR06083025.1 6213 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V553 trav AABR06083026.1 6180 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V554 trav AABR06083026.1 9217 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V555 trav AABR06083026.1 18414 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSASSYFPWYKQEAGKGLHFVIDIISNVDRKENQRFKILLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V556 trav AABR06083026.1 33642 RTHGDSVTQTEGQVTISENGFLRINCTYSATRIVYPNLFWYVQYPGEGLQLLLKVITAGEKGSSRGFEATYNKETTSFHLEKASVQESDSAVYYCALG
Rattus norvegicus V557 trav AABR06083026.1 37531 VAGRTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDADAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V558 trav AABR06083026.1 41053 RSNGDSVTQTEGLVTLTEGSHVMLTCTYQTTYSGPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSRRSFSLQKPSAQLSDSALYYCAVE
Rattus norvegicus V559 trav AABR06083026.1 48105 VKGQQVQQSPVSLVLQEGENSELQCNFSISTNQLQWFFQRPGGSLVSLFFNPSGTKKSGRLTSMTVPKERRSSLHISSSQTTDSGTYFCAMDPQCS
Rattus norvegicus V560 trdv AABR06083027.1 3803 FNVAQKVTQVKSTASRQEGEEVTLDCSYETSQNLYYLFWYKQLQSGDIIFLIRQASSDSQNQRSSRYSVIFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V561 trav AABR06083028.1 1835 DSVVQGENGFEAEFSKSNSSWLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V562 trav AABR06083031.1 9316 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V563 trav AABR06083031.1 15757 DGQAQSVTQPDVHVTISEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLRYYSGDPVVQGENSFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V564 trav AABR06083031.1 24826 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V565 trav AABR06083037.1 9966 VQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGRGLQFLLKYYTGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V566 trav AABR06083047.1 6201 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHMRDLGPSDSAVYLCAV
Rattus norvegicus V567 trav AABR06083047.1 20306 RSNGDSVTQTEGRVLVTEGLHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSSRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V568 trav AABR06083048.1 73 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCALE
Rattus norvegicus V569 trav AABR06083049.1 897 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V570 trav AABR06083051.1 2806 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSTKQMQWFYQRPGGSLVSLLYNPSGTKQSGRLTSTTVAKERQSSLHISSSQTTDSGTYFCALDAQCS
Rattus norvegicus V571 trdv AABR06083053.1 7027 FNVAQVQSTASMQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V572 trav AABR06083053.1 19181 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V573 trav AABR06083053.1 37797 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDSKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V574 trav AABR06083053.1 44179 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V575 trav AABR06083053.1 58135 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V576 trav AABR06083053.1 69892 RSNGDSVTQTEGLVSLTEGSPVVLNCTYQTTYSASTLFWYVQYLSEAPRLLLRSSTDSKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V577 trav AABR06083054.1 4617 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V578 trav AABR06083055.1 2800 VKGQQVQQSPVSLVLQEGEKAELQCTFSTAFNSMQWFYQNPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V579 trdv AABR06083055.1 15955 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V580 trav AABR06083057.1 1237 VSRGEQVEQHLSHLSVLEGDSAAIICTYTDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V581 trav AABR06083057.1 8248 VAQAQSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYSQQGLLLLLKYYSGNPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALR
Rattus norvegicus V582 trav AABR06083058.1 6451 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V583 trdv AABR06083066.1 14381 FNVAQEVTQVQSTASWQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V584 trdv AABR06083068.1 453 FNVAQEVTQVQSTASRQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWES
Rattus norvegicus V585 trav AABR06083068.1 13491 VAQAQSVTQPDTHVTVSEEDSLQLRCTYSSSVPPSLFWDVQYPQQGLEMLLRYYSGNPMVQGMNGFVAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V586 trav AABR06083068.1 31986 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVG
Rattus norvegicus V587 trav AABR06083068.1 38379 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V588 trav AABR06083071.1 58 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V589 trav AABR06083072.1 239 VKGQQVQQSPVSLVLQEGENAELQCKFSTIATELQWFFQHPGGSLVSLLNNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V590 trdv AABR06083075.1 11378 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V591 trdv AABR06083077.1 1778 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V592 trav AABR06083081.1 6164 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V593 trav AABR06083085.1 5935 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V594 trav AABR06083085.1 16048 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V595 trav AABR06083090.1 317 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V596 trav AABR06083091.1 7559 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V597 trav AABR06083091.1 10350 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V598 trav AABR06083096.1 4377 VSRGEQVEQRPSHLSVREGDSAVIICTYTDSLSSYFYWYKHEPGAGLQLLMEVFSSTEIKGQGFIVLLNKKDKRLSLNITAVHLGDSATYFCPVR
Rattus norvegicus V599 trav AABR06083096.1 13012 VAQAQSVTQPDAHVTVSEEASLQLKCKYSYPGTPSLFWYVQYPQQGLQLLLKYYSGNPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V600 trav AABR06083101.1 116 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V601 trav AABR06083101.1 3304 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V602 trav AABR06083101.1 13874 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V603 trav AABR06083101.1 21808 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V604 trav AABR06083101.1 22767 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V605 trav AABR06083103.1 9573 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALG
Rattus norvegicus V606 trav AABR06083103.1 12342 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V607 trav AABR06083108.1 5939 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V608 trav AABR06083108.1 8892 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V609 trav AABR06083108.1 12320 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V610 trav AABR06083109.1 529 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V611 trav AABR06083109.1 3863 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V612 trav AABR06083109.1 14427 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V613 trav AABR06083110.1 2500 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V614 trav AABR06083115.1 38 RSNGDSVTQTEGRVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKNNRSFHLQKPSAQLSDSALYYCALS
Rattus norvegicus V615 trav AABR06083116.1 5672 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V616 trav AABR06083116.1 9568 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V617 trdv AABR06083117.1 4187 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V618 trav AABR06083117.1 17253 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V619 trav AABR06083117.1 37275 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V620 trav AABR06083117.1 43757 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V621 trav AABR06083117.1 51008 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V622 trav AABR06083117.1 65670 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V623 trdv AABR06083117.1 78608 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGTYYLFWYKQLLSGEMVFLILQPSFDSQNQRSGRYSVIFQQSLKSISLVISASQPEDSGKYFCALWET
Rattus norvegicus V624 trav AABR06083117.1 92415 VSRGEQVEQHLSHLSVLEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V625 trav AABR06083117.1 133758 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V626 trav AABR06083118.1 565 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V627 trav AABR06083122.1 9025 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V628 trav AABR06083122.1 14211 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V629 trav AABR06083122.1 30181 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGGSLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V630 trav AABR06083122.1 40269 VNSQRGEENRLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGRGPALLVLIRSNEREKHSGRLRATLDTSSQSISLSISAAQSADTAVYFCATD
Rattus norvegicus V631 trav AABR06083123.1 4251 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V632 trav AABR06083125.1 9204 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V633 trdv AABR06083125.1 26500 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V634 trav AABR06083128.1 5758 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSFSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V635 trav AABR06083131.1 7295 MSQGEQVKQFPSILRVQGGSNAILNCTYVDSASLYFPWYKQEPGMHPQLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V636 trav AABR06083131.1 17481 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V637 trav AABR06083131.1 22558 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V638 trav AABR06083132.1 5587 ANSQRGEENLLGLSTQEGENVTINCTYKTYTAVLQWYRQDSGGGPALLVLIRSNEREKHSGRLRTTLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V639 trav AABR06083134.1 1157 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V640 trav AABR06083134.1 12781 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V641 trdv AABR06083139.1 12411 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVVYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQQSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V642 trav AABR06083142.1 12616 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V643 trav AABR06083142.1 22037 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V644 trav AABR06083147.1 246 VSSQQKVQQNPESLTVPEGARTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V645 trav AABR06083148.1 571 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V646 trav AABR06083149.1 9939 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V647 trav AABR06083150.1 4309 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGGTPYLFWYIQHHGHGLQFLLRYYSGDPVVHGMNGFEAEFSKSNSSFHLKKASVHWSDSAVYFCAVG
Rattus norvegicus V648 trav AABR06083161.1 1000 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V649 trav AABR06083161.1 4136 VSSQQKVQQSPESLSVSEGAIVSLNCTFSDSASQSFWWYQQHLGKGPKMLISVFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V650 trav AABR06083161.1 25316 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSINQMQWFYQRPGGSLVRLLYNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMEPQCS
Rattus norvegicus V651 trav AABR06083161.1 42077 TSMAQKVMQTQASISVMETKTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMRE
Rattus norvegicus V652 trav AABR06083161.1 52937 VKGQQVQQSPVSLVLQEGEEAELQCNFSTSATRLQWFFQRPEGSLVSLLYNPSGTKKSGRLTSTTVTREQRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V653 trdv AABR06083161.1 73138 CNVAQEVTQVQSTASRQEGEEVTLDCSYETSYVAYYLSWYKQHLSGDIIFLIHQISSSTAEERSGRYSLVFQKSLKSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V654 trav AABR06083162.1 2134 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V655 trav AABR06083163.1 898 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V656 trav AABR06083163.1 9306 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V657 trav AABR06083163.1 22764 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V658 trav AABR06083163.1 34077 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V659 trav AABR06083163.1 41981 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V660 trav AABR06083165.1 6999 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWTDSAVYFCALG
Rattus norvegicus V661 trav AABR06083165.1 9769 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V662 trav AABR06083167.1 7457 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V663 trav AABR06083167.1 17704 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V664 trav AABR06083167.1 21167 VAGKTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDTGRGPVSLTVLTNKEEKTSRGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V665 trav AABR06083168.1 7769 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V666 trav AABR06083171.1 5317 VSSQQKVQQSPESLIVPEGGMTSLNCTFSNRASNNFRWYRQHSGKGLELLVSIFSNGEREEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V667 trav AABR06083178.1 6452 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V668 trav AABR06083185.1 7658 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V669 trav AABR06083187.1 1458 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSVQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V670 trav AABR06083189.1 4039 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPLGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V671 trav AABR06083190.1 1323 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V672 trdv AABR06083192.1 6271 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V673 trav AABR06083197.1 5775 VSRGEQVEQRPSHLSVREGDSAIIICTYTDPNNYYFYWYKKELGAGLQLLMSVLSSVDRKEGQGLIVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V674 trav AABR06083199.1 24413 GNSAQSVDQPDAHITVSEGASLELRCSYSYSATPSLFWYVQYPGQSLQLLLKYITGDTIVKSTNGFEAEFRKSNSSFNLKKSPAHWRDSAKYYCALR
Rattus norvegicus V676 trav AABR06083200.1 61361 VSGQANTVVQSPSVLSVWEKETAIINCTYTNTATNYFPWYKKEERKGFTLLTDIRSNVNRKKEGRFEVILDTNVKRVSLHITASRTEDSALYLCAP
Rattus norvegicus V677 trav AABR06083201.1 12699 IAGDAKTTQPDSVESTEEETVHLPCSHATISGNEYIHWYRQVPLQSPEYVIHGLQQNTSNSMAFLAIASDRKSSTLILPRVSLRDAAVYHCILRV
Rattus norvegicus V678 trav AABR06083203.1 4583 VNTQKLQQSPQSLTIQEGDELTMSCNSSSSLYALHWYRQGRDGGPIFLVTLQKGGDEKRKDKITAKLDKKMRQSFLSIQASQPSYAGTYLCAGS
Rattus norvegicus V680 trav AABR06083207.1 17976 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRGQVTLIIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQLGDAATYFCALMG
Rattus norvegicus V681 trav AABR06083207.1 30018 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRRQVTLVIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQPGDAATYFCALME
Rattus norvegicus V682 trav AABR06083207.1 52588 LRGEKTVQQNPLFLGTWEGRNSTIFCNYSSSATDRLLWYRQVVGESLEFLFALLSNGAVKRDRRLTASLDQKARISTLHFSGLQHSHSAIYFCAVG
Rattus norvegicus V683 trdv AABR06083208.1 69734 TSLDVILEPVAKTFTVIAGNPATFYCTVTGGDLKNYQMSWYKKSENNALFLVYKLNNNSTDDPMGNFKGKINISKSQFILDIQKATMKDAGVYYCGSD
Rattus norvegicus V740 igkv AABR06096856.1 45995 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V777 igkv AABR06106664.1 32936 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V778 igkv AABR06106665.1 42776 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V779 igkv AABR06106669.1 24443 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V780 igkv AABR06106669.1 52381 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V792 trav AABR06110406.1 679 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V795 trdv AABR06082296.1 214 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V796 trav AABR06082851.1 59200 ASGQGVEQPAKLMSVEGTFARVNCTYSTSGFNGLSWYQQHEGQAPVFLFYTVLDGLKDSGRFSTFLSRSDGYSYLLLTELQIKDSASYLCAVR
Rattus norvegicus V797 trav AABR06082861.1 1709 SWSLAKTTQPLSRDSYEGQAVNVSCSHTNIATSEYIYWYRQASHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPRVSLRDTAVYYCIVA
Rattus norvegicus V798 trav AABR06082865.1 107 VSRGEQVEQRPSHLSVLEGDSAAIVCTYTDSNNDYFFWYKQEFGAGLQLLMSVLSNVNRKEEQGLTVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V799 trav AABR06082868.1 7956 ESQGEQVKQHPSSLSVQEGATALINCSYTDSASVYFPWYKQEPGRRPQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLNITATEPGDSAVYFCTAS
Rattus norvegicus V800 trav AABR06082870.1 311 VSSQQKVQQSPESLIVSEGDTASLNCTFSDSASNSFWWYRQHSGKGPKALMSIFSSGDKQEGRFTAHLNIASLHVSLHIRDLGPSDSALYLCAV
Rattus norvegicus V801 trav AABR06082873.1 732 VSSQQKVQQSPESLIVSEGDTSSLNCTFSDSSSYSFWWYRQHSGEGPKVLMSIVSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYFCAVS
Rattus norvegicus V802 trav AABR06082873.1 5961 WTHGNSVTQTQGQVTLSEEEFLFINCTYSSTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYEKRTTSFHLQKASVQESDSAVYYCVLG
Rattus norvegicus V803 trav AABR06082874.1 1210 RTHGNSVTQTQGQVTLSEGKFLFINCTYSTTTYPTLFWYVQHPGEGPQLLLKVTTANNKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALG
Rattus norvegicus V804 trav AABR06082874.1 13391 VRSQEKVQQNPDILIVPEGATASFNCTSSDRNVDYFWWYRQHSGKAPKMLMSIVSNGVKEEGRFTAHFNKASLHVSLHINDSQPSDSAVYLCAVS
Rattus norvegicus V805 trav AABR06082876.1 2751 GVRGIQVEQNPEALSLHEGAGSGLRCNFSTTMNSVQWFRQNPRGSLINLFFLASGTKENGRLKSTFDSKERYSTLHISDAQLEDSGTYFCAAE
Rattus norvegicus V806 trav AABR06082882.1 4205 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSTSDYFWWFRQYSGKSPKALMSIFSNGDKQEGRFTVHLNKTSLHVSLHINDSQPTDSAVYLCAVS
Rattus norvegicus V807 trav AABR06082882.1 8322 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSASQYFWWYRQYSGKSPKALMSIFSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYLCAV
Rattus norvegicus V808 trav AABR06082888.1 233 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V809 trav AABR06082987.1 8160 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYLQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V810 trav AABR06083013.1 1508 VSRGEQVEQHLSHLSVWEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQYFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V811 trav AABR06083014.1 226 VSRGEQVEQRLSHLSVREGDSAFIICTYRDSLSSYFYWYKQEPRAGLQLLIMQVFWSTEIKEAQGIIVLLNKKDKRLSLNITSARIGDSATYFCAVSTQCSS
Rattus norvegicus V812 trav AABR06083017.1 1322 VSSQQKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELLSIFSTGEKEEGRFKIHVIKANLHVFLHIKDSQPGDSALYFCAV
Rattus norvegicus V813 trav AABR06083018.1 3525 MKKTHGDSVTQKEGQVTLSEGDFLFINCTYSTTGYPTLFWYVQYPGEGPQLLFQVTTANNKGKNRGFEALYDKGTTSFHLEKASVQESDSAVYYCALS
Rattus norvegicus V814 trav AABR06083019.1 2460 VSSQQKVQQSPESLTVPEGAKTSLNCTFSSSASQYFAWYRQHPGKEPKELLSIFSTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V815 trav AABR06083023.1 78 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASK
Rattus norvegicus V816 trav AABR06083023.1 3410 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V817 trav AABR06083025.1 6213 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V818 trav AABR06083026.1 6180 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V819 trav AABR06083026.1 9217 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V820 trav AABR06083026.1 18414 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSASSYFPWYKQEAGKGLHFVIDIISNVDRKENQRFKILLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V821 trav AABR06083026.1 33642 RTHGDSVTQTEGQVTISENGFLRINCTYSATRIVYPNLFWYVQYPGEGLQLLLKVITAGEKGSSRGFEATYNKETTSFHLEKASVQESDSAVYYCALG
Rattus norvegicus V822 trav AABR06083026.1 37531 VAGRTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDADAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V823 trav AABR06083026.1 41053 RSNGDSVTQTEGLVTLTEGSHVMLTCTYQTTYSGPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSRRSFSLQKPSAQLSDSALYYCAVE
Rattus norvegicus V824 trav AABR06083026.1 48105 VKGQQVQQSPVSLVLQEGENSELQCNFSISTNQLQWFFQRPGGSLVSLFFNPSGTKKSGRLTSMTVPKERRSSLHISSSQTTDSGTYFCAMDPQCS
Rattus norvegicus V825 trdv AABR06083027.1 3803 FNVAQKVTQVKSTASRQEGEEVTLDCSYETSQNLYYLFWYKQLQSGDIIFLIRQASSDSQNQRSSRYSVIFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V826 trav AABR06083028.1 1835 DSVVQGENGFEAEFSKSNSSWLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V827 trav AABR06083031.1 9316 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V828 trav AABR06083031.1 15757 DGQAQSVTQPDVHVTISEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLRYYSGDPVVQGENSFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V829 trav AABR06083031.1 24826 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V830 trav AABR06083037.1 9966 VQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGRGLQFLLKYYTGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V831 trav AABR06083047.1 6201 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHMRDLGPSDSAVYLCAV
Rattus norvegicus V832 trav AABR06083047.1 20306 RSNGDSVTQTEGRVLVTEGLHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSSRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V833 trav AABR06083048.1 73 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCALE
Rattus norvegicus V834 trav AABR06083049.1 897 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V835 trav AABR06083051.1 2806 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSTKQMQWFYQRPGGSLVSLLYNPSGTKQSGRLTSTTVAKERQSSLHISSSQTTDSGTYFCALDAQCS
Rattus norvegicus V836 trdv AABR06083053.1 7027 FNVAQVQSTASMQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V837 trav AABR06083053.1 19181 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V838 trav AABR06083053.1 37797 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDSKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V839 trav AABR06083053.1 44179 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V840 trav AABR06083053.1 58135 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V841 trav AABR06083053.1 69892 RSNGDSVTQTEGLVSLTEGSPVVLNCTYQTTYSASTLFWYVQYLSEAPRLLLRSSTDSKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V842 trav AABR06083054.1 4617 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V843 trav AABR06083055.1 2800 VKGQQVQQSPVSLVLQEGEKAELQCTFSTAFNSMQWFYQNPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V844 trdv AABR06083055.1 15955 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V845 trav AABR06083057.1 1237 VSRGEQVEQHLSHLSVLEGDSAAIICTYTDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V846 trav AABR06083057.1 8248 VAQAQSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYSQQGLLLLLKYYSGNPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALR
Rattus norvegicus V847 trav AABR06083058.1 6451 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V848 trdv AABR06083066.1 14381 FNVAQEVTQVQSTASWQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V849 trdv AABR06083068.1 453 FNVAQEVTQVQSTASRQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWES
Rattus norvegicus V850 trav AABR06083068.1 13491 VAQAQSVTQPDTHVTVSEEDSLQLRCTYSSSVPPSLFWDVQYPQQGLEMLLRYYSGNPMVQGMNGFVAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V851 trav AABR06083068.1 31986 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVG
Rattus norvegicus V852 trav AABR06083068.1 38379 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V853 trav AABR06083071.1 58 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V854 trav AABR06083072.1 239 VKGQQVQQSPVSLVLQEGENAELQCKFSTIATELQWFFQHPGGSLVSLLNNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V855 trdv AABR06083075.1 11378 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V856 trdv AABR06083077.1 1778 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V857 trav AABR06083081.1 6164 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V858 trav AABR06083085.1 5935 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V859 trav AABR06083085.1 16048 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V860 trav AABR06083090.1 317 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V861 trav AABR06083091.1 7559 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V862 trav AABR06083091.1 10350 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V863 trav AABR06083096.1 4377 VSRGEQVEQRPSHLSVREGDSAVIICTYTDSLSSYFYWYKHEPGAGLQLLMEVFSSTEIKGQGFIVLLNKKDKRLSLNITAVHLGDSATYFCPVR
Rattus norvegicus V864 trav AABR06083096.1 13012 VAQAQSVTQPDAHVTVSEEASLQLKCKYSYPGTPSLFWYVQYPQQGLQLLLKYYSGNPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V865 trav AABR06083101.1 116 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V866 trav AABR06083101.1 3304 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V867 trav AABR06083101.1 13874 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V868 trav AABR06083101.1 21808 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V869 trav AABR06083101.1 22767 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V870 trav AABR06083103.1 9573 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALG
Rattus norvegicus V871 trav AABR06083103.1 12342 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V872 trav AABR06083108.1 5939 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V873 trav AABR06083108.1 8892 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V874 trav AABR06083108.1 12320 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V875 trav AABR06083109.1 529 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V876 trav AABR06083109.1 3863 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V877 trav AABR06083109.1 14427 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V878 trav AABR06083110.1 2500 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V879 trav AABR06083115.1 38 RSNGDSVTQTEGRVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKNNRSFHLQKPSAQLSDSALYYCALS
Rattus norvegicus V880 trav AABR06083116.1 5672 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V881 trav AABR06083116.1 9568 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V882 trdv AABR06083117.1 4187 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V883 trav AABR06083117.1 17253 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V884 trav AABR06083117.1 37275 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V885 trav AABR06083117.1 43757 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V886 trav AABR06083117.1 51008 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V887 trav AABR06083117.1 65670 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V888 trdv AABR06083117.1 78608 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGTYYLFWYKQLLSGEMVFLILQPSFDSQNQRSGRYSVIFQQSLKSISLVISASQPEDSGKYFCALWET
Rattus norvegicus V889 trav AABR06083117.1 92415 VSRGEQVEQHLSHLSVLEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V890 trav AABR06083117.1 133758 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V891 trav AABR06083118.1 565 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V892 trav AABR06083122.1 9025 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V893 trav AABR06083122.1 14211 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V894 trav AABR06083122.1 30181 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGGSLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V895 trav AABR06083122.1 40269 VNSQRGEENRLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGRGPALLVLIRSNEREKHSGRLRATLDTSSQSISLSISAAQSADTAVYFCATD
Rattus norvegicus V896 trav AABR06083123.1 4251 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V897 trav AABR06083125.1 9204 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V898 trdv AABR06083125.1 26500 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V899 trav AABR06083128.1 5758 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSFSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V900 trav AABR06083131.1 7295 MSQGEQVKQFPSILRVQGGSNAILNCTYVDSASLYFPWYKQEPGMHPQLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V901 trav AABR06083131.1 17481 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V902 trav AABR06083131.1 22558 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V903 trav AABR06083132.1 5587 ANSQRGEENLLGLSTQEGENVTINCTYKTYTAVLQWYRQDSGGGPALLVLIRSNEREKHSGRLRTTLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V904 trav AABR06083134.1 1157 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V905 trav AABR06083134.1 12781 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V906 trdv AABR06083139.1 12411 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVVYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQQSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V907 trav AABR06083142.1 12616 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V908 trav AABR06083142.1 22037 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V909 trav AABR06083147.1 246 VSSQQKVQQNPESLTVPEGARTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V910 trav AABR06083148.1 571 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V911 trav AABR06083149.1 9939 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V912 trav AABR06083150.1 4309 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGGTPYLFWYIQHHGHGLQFLLRYYSGDPVVHGMNGFEAEFSKSNSSFHLKKASVHWSDSAVYFCAVG
Rattus norvegicus V913 trav AABR06083161.1 1000 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V914 trav AABR06083161.1 4136 VSSQQKVQQSPESLSVSEGAIVSLNCTFSDSASQSFWWYQQHLGKGPKMLISVFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V915 trav AABR06083161.1 25316 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSINQMQWFYQRPGGSLVRLLYNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMEPQCS
Rattus norvegicus V916 trav AABR06083161.1 42077 TSMAQKVMQTQASISVMETKTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMRE
Rattus norvegicus V917 trav AABR06083161.1 52937 VKGQQVQQSPVSLVLQEGEEAELQCNFSTSATRLQWFFQRPEGSLVSLLYNPSGTKKSGRLTSTTVTREQRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V918 trdv AABR06083161.1 73138 CNVAQEVTQVQSTASRQEGEEVTLDCSYETSYVAYYLSWYKQHLSGDIIFLIHQISSSTAEERSGRYSLVFQKSLKSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V919 trav AABR06083162.1 2134 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V920 trav AABR06083163.1 898 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V921 trav AABR06083163.1 9306 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V922 trav AABR06083163.1 22764 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V923 trav AABR06083163.1 34077 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V924 trav AABR06083163.1 41981 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V925 trav AABR06083165.1 6999 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWTDSAVYFCALG
Rattus norvegicus V926 trav AABR06083165.1 9769 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V927 trav AABR06083167.1 7457 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V928 trav AABR06083167.1 17704 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V929 trav AABR06083167.1 21167 VAGKTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDTGRGPVSLTVLTNKEEKTSRGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V930 trav AABR06083168.1 7769 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V931 trav AABR06083171.1 5317 VSSQQKVQQSPESLIVPEGGMTSLNCTFSNRASNNFRWYRQHSGKGLELLVSIFSNGEREEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V932 trav AABR06083178.1 6452 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V933 trav AABR06083185.1 7658 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V934 trav AABR06083187.1 1458 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSVQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V935 trav AABR06083189.1 4039 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPLGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V936 trav AABR06083190.1 1323 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V937 trdv AABR06083192.1 6271 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V938 trav AABR06083197.1 5775 VSRGEQVEQRPSHLSVREGDSAIIICTYTDPNNYYFYWYKKELGAGLQLLMSVLSSVDRKEGQGLIVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V939 trav AABR06083199.1 24413 GNSAQSVDQPDAHITVSEGASLELRCSYSYSATPSLFWYVQYPGQSLQLLLKYITGDTIVKSTNGFEAEFRKSNSSFNLKKSPAHWRDSAKYYCALR
Rattus norvegicus V941 trav AABR06083200.1 61361 VSGQANTVVQSPSVLSVWEKETAIINCTYTNTATNYFPWYKKEERKGFTLLTDIRSNVNRKKEGRFEVILDTNVKRVSLHITASRTEDSALYLCAP
Rattus norvegicus V942 trav AABR06083201.1 12699 IAGDAKTTQPDSVESTEEETVHLPCSHATISGNEYIHWYRQVPLQSPEYVIHGLQQNTSNSMAFLAIASDRKSSTLILPRVSLRDAAVYHCILRV
Rattus norvegicus V943 trav AABR06083203.1 4583 VNTQKLQQSPQSLTIQEGDELTMSCNSSSSLYALHWYRQGRDGGPIFLVTLQKGGDEKRKDKITAKLDKKMRQSFLSIQASQPSYAGTYLCAGS
Rattus norvegicus V945 trav AABR06083207.1 17976 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRGQVTLIIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQLGDAATYFCALMG
Rattus norvegicus V946 trav AABR06083207.1 30018 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRRQVTLVIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQPGDAATYFCALME
Rattus norvegicus V947 trav AABR06083207.1 52588 LRGEKTVQQNPLFLGTWEGRNSTIFCNYSSSATDRLLWYRQVVGESLEFLFALLSNGAVKRDRRLTASLDQKARISTLHFSGLQHSHSAIYFCAVG
Rattus norvegicus V948 trdv AABR06083208.1 69734 TSLDVILEPVAKTFTVIAGNPATFYCTVTGGDLKNYQMSWYKKSENNALFLVYKLNNNSTDDPMGNFKGKINISKSQFILDIQKATMKDAGVYYCGSD
Rattus norvegicus V1005 igkv AABR06096856.1 45995 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V1042 igkv AABR06106664.1 32936 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V1043 igkv AABR06106665.1 42776 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V1044 igkv AABR06106669.1 24443 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V1045 igkv AABR06106669.1 52381 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V1057 trav AABR06110406.1 679 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1073 igkv AABR06005633.1 113098 ARCDIQMTQSPSSMSVSLGDTVTITCRASQDVGIYVNWFQQKPGKSPRHMIYRATNLADGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQYDEYP
Rattus norvegicus V1074 igkv AABR06005633.1 86455 THSDIVMTQTPLSLSVAIGQSASISCKSSQSLKYSDGKTYLNWVFQSPGQSPKRLIYQVSKLDSGVPDRFSGTGSETDFTLKISRVEAEDLGVYYCCQVHIL
Rattus norvegicus V1075 igkv AABR06005633.1 46536 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V1076 igkv AABR06005635.1 14651 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V1077 igkv AABR06005637.1 9956 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V1162 igkv AABR06022369.1 56419 STGDIVLTQSPVLAVSLGQRATISCRASQSVSISSINLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTIDPVQADDIAAYYCQQSRESP
Rattus norvegicus V1163 igkv AABR06022370.1 3621 SNGQITLTQQAESLWVSPGEKVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASIRTDGVPTRFIGSGSGTEFTLSIEDVQPEDIALYYCLQTLKKP
Rattus norvegicus V1164 igkv AABR06022371.1 76286 ADGETVMTQSPTSMSTSIGERVTLNCKASQSVGINVDWYQQTPGQSPKLLIYGASNRHTGVPDRFTGSGFGRDFTLTISNMEAEDLAVYYCLQYGSIP
Rattus norvegicus V1165 igkv AABR06022395.1 2273 STGDTVLTQSPALAVSPGERVTISCRASESVSTLMHWYQQKPGQQPTLLIYLASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYYCQQSWNDP
Rattus norvegicus V1166 igkv AABR06022401.1 26610 TCGDIVMTQSPSSLAVSAGETVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYLASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQHYSYP
Rattus norvegicus V1167 igkv AABR06022555.1 4375 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYEGSNLASGIPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V1168 igkv AABR06022597.1 16496 GRCAIQVTQSPTSLSASLGDRVTLTCRASQDINNKMAWYQQKPGEVPQLLIYYASTLQSGTPSRFSGSGAGTDFSFTISHLQSEDFATYYCLQGYSL
Rattus norvegicus V1169 igkv AABR06022608.1 14194 VRCDIQMTQSPSFLSASLGNSITITCHASQNIKGWLAWYQQKSGNAPELLIYKASSLQSGVPSRFSGSGSGTDYIFTISNLQPEDIATYYCQHYQSFP
Rattus norvegicus V1170 igkv AABR06022615.1 64789 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLSWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCLQAYSAP
Rattus norvegicus V1171 igkv AABR06022615.1 42344 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDPGIYYCLQGYSAP
Rattus norvegicus V1172 igkv AABR06022615.1 4018 GKCDIQMTQSPASLSASPEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYSATSLADGIPSRFSGSRSGTQYSLKISRLQVEDTGIYYCLQRYSNP
Rattus norvegicus V1173 igkv AABR06022635.1 16234 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCQQASSAP
Rattus norvegicus V1216 trbv AABR06030681.1 34659 VSAQTIHQWPAVKVQAVGSPLSLECTVKGTSNPNLYWYWQAPGGTLQQLFYSFNVGQSELVVQRNLSASRPKSEQFILSTEKLLLTHSGFYLCAWS
Rattus norvegicus V1222 igkv AABR06031580.1 666 TSGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVASDKNTYLNWLLQSPGRSPKRLIYQVSKLDSGVPDRFSGSGSEKDFTLKISRVEAEDLGVYYCLQG
Rattus norvegicus V1223 igkv AABR06031643.1 1119 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1224 igkv AABR06031646.1 5669 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V1225 igkv AABR06031651.1 1171 YRGDVVMTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQ
Rattus norvegicus V1226 igkv AABR06031655.1 1171 YRGDVVMTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQ
Rattus norvegicus V1227 igkv AABR06031659.1 59451 IQCDVQMTQSPYNLAASPGESVSINCKASKSISKYLAWYQQKPGKANKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRSLEPEDFGLYYCQQHNEY
Rattus norvegicus V1228 igkv AABR06031664.1 80224 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V1229 igkv AABR06031664.1 42319 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1230 igkv AABR06031679.1 23667 SRSDVVLTQTPVAMPVTLGDQASISCRSSQSLVYSDGNTYLEWYLQKPGQSPQLLIYEVSNQFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1231 igkv AABR06031684.1 5470 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1232 igkv AABR06031685.1 8785 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V1233 igkv AABR06031694.1 1708 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V1322 ighv AABR06046439.1 8913 VQCEVQLVESGGGLVQPRRSLKLSCAASGFTFINYGINWVHQTPEKILEWVAYISRASNDIYYADTMKGQFTISRDNAKNTLYLQLSSLRSEDTAFLYFCAG
Rattus norvegicus V1323 ighv AABR06046440.1 42718 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1324 ighv AABR06046440.1 25539 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1325 ighv AABR06046440.1 3241 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1326 ighv AABR06046441.1 353 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1327 ighv AABR06046443.1 13338 LLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAIYFCTR
Rattus norvegicus V1328 ighv AABR06046445.1 21784 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1329 ighv AABR06046445.1 6957 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1330 ighv AABR06046451.1 187227 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1331 ighv AABR06046451.1 179371 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1332 ighv AABR06046451.1 158812 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1333 ighv AABR06046451.1 150534 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1334 ighv AABR06046451.1 100129 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1335 ighv AABR06046451.1 93996 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1336 ighv AABR06046451.1 76817 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1337 ighv AABR06046451.1 54519 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1338 ighv AABR06046451.1 46466 VQCEVQLVESGGGLVQPGRSLKFSCAASGFTFSDYAMAWVRQAPKKGLEWVATIIYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1339 ighv AABR06046453.1 19908 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYYMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEETATYYCA
Rattus norvegicus V1340 ighv AABR06046456.1 221771 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1341 ighv AABR06046456.1 213915 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1342 ighv AABR06046456.1 193356 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1343 ighv AABR06046456.1 185078 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1344 ighv AABR06046456.1 134673 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1345 ighv AABR06046456.1 128540 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1346 ighv AABR06046456.1 111361 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1347 ighv AABR06046456.1 89063 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1348 ighv AABR06046456.1 81010 VQCEVQLVESGGGLVQPGRSLKFSCAASGFTFSDYAMAWVRQAPKKGLEWVATIIYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1349 ighv AABR06046456.1 32530 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1350 ighv AABR06046465.1 566 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPTVKCLEWMGVIWSDGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTATYFCAI
Rattus norvegicus V1351 ighv AABR06046508.1 162162 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYDMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1352 ighv AABR06046508.1 125628 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1353 ighv AABR06046508.1 117772 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1354 ighv AABR06046508.1 97213 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1355 ighv AABR06046508.1 88935 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1356 ighv AABR06046508.1 38530 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1357 ighv AABR06046508.1 32397 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1358 ighv AABR06046508.1 15218 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1359 ighv AABR06046517.1 1642 VWCEVQLVESSEGLVQPRSSSLKLSCVASGFTFNKYDMCWVHQAPKKGLELVAIIYYGGGNKYYEDTVKGQFTISRENSKNTLYLEMSNLRSKDTAIYYCA
Rattus norvegicus V1360 ighv AABR06046524.1 2197 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSSFAMAWVRQAPKKGLEWVATITSGGSNTYYPDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAK
Rattus norvegicus V1361 ighv AABR06046546.1 36294 VLSQVQWKESGPDLVQPSQTLSLTCTLSGFSLAGYDLQWVQQLPGKGLKWMGGIWGDGSTAYNSLLKSQLSISRDTSKSLVFLKMNSLKTEGTAMYYCAREGS
Rattus norvegicus V1362 ighv AABR06046546.1 11808 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSCGVHWVRQPPGKGLEWIAAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLKTEDTVMYYCTR
Rattus norvegicus V1363 ighv AABR06046556.1 36360 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPPGKGLEWMGVIWSNGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCAR
Rattus norvegicus V1364 ighv AABR06046556.1 28110 VQCEVQLVESGGGLVQPGRSLKLSCVASGFTFNNYWMTWIRQAPGKGLEWVASITNTGGSTYYPDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCTR
Rattus norvegicus V1365 ighv AABR06046557.1 89387 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGVIWSGGNTDYNSALKPRLSISRDTSKSQVFLTMNSLQTEDTGIYYCNR
Rattus norvegicus V1366 ighv AABR06046557.1 77153 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V1367 ighv AABR06046557.1 61826 VQYEVKLVESGEGLVQPGRSLKLSCAGSGFTFDDYRMAWVCQAPKKGLEWLAAINRNGGSTYYPDTVKGQFTICRDNDKSALYLQMNDLISEDTSMYYCA
Rattus norvegicus V1368 ighv AABR06046557.1 52287 VQCEVKLVESGGGLVQPGSPLKLSCAASGFTFSSNWLNWIRQAPGKGLEWVASINPDGSSTLYPDTVKGRFVVSKDNAKNTRYLQMNNLRSEDTAMYYCAR
Rattus norvegicus V1369 ighv AABR06046559.1 32818 VQCEVQLVESGGGLVQPGSSLKVSCVASGFTFSSYVMHWFRQAPENGIEWLAFINTDSSNTHYAETVKGRVTISRDNAKNTVDMQLSSLRSEDTAMYYCARE
Rattus norvegicus V1370 ighv AABR06046561.1 872 VLSQVQLKESGPGLLLSSETLSLTCTVSGFSLTSYDVSWVRQLPGKGLEWMGGVWIGGNTEYNSDLKSRLSISRDTSKSQVFLKMSNLKTEDTGTYYCAR
Rattus norvegicus V1371 ighv AABR06046574.1 2535 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V1372 ighv AABR06046576.1 82415 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSSYNMHWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V1373 ighv AABR06046576.1 37197 VLSQVQLKETGPGLVQPTQTLSITCTVSGFSLTSYYMQWVRQTPGKGLEWMGFIRSGGSTEYNSEFKSRLSISRDTSKNQVFLKMNSLKTEDTGVYYCAR
Rattus norvegicus V1375 ighv AABR06046576.1 3837 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGRMRYNGDTSYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTR
Rattus norvegicus V1376 ighv AABR06046580.1 124229 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPTVKCLEWMGVIWSDGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTATYFCAI
Rattus norvegicus V1377 ighv AABR06046580.1 116235 VQCEVQLVETGGGLVQPGRSLKLSCVASGFTFSSYWMYWIRQAPGKGLEWVSSINTDGGSTYYPDSVKGRFTISRDNAENTVYLQMNSLRSEDTATYYCAK
Rattus norvegicus V1378 ighv AABR06046580.1 116007 NAENTVYLQMNSLRSEDTATYYCAKDTCVASGFTFSSYWMYWIRQAPGKGLEWVSSINTDGGSTYYPDSVKGRFTISRDNAENTVYLQMNSLRSEDTATYYCAK
Rattus norvegicus V1379 ighv AABR06046580.1 82769 VLSQVQLKESGPGLMQPSETLSLTCTVSGFSLTSNGVGWVRQPLGKGLVWMGTIWAGGSTNYNSAVQSRLSISRDTSKSQVFLKMNSLQPEDTGTYYCA
Rattus norvegicus V1380 ighv AABR06046580.1 61459 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSNYGMNWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V1381 ighv AABR06046580.1 46067 ALSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVNWVRQPPGKGLEWMGTIWNDGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYLCAR
Rattus norvegicus V1382 ighv AABR06046581.1 61816 VQCAVQLVESGGGLVQPGKSLKLSCSASGFTFSSYGMHWIRQAPGKGLDWVAYISSSSGTVYADAVKERFTISRDNAKNTLYLQLNSLKSEDTAIYYCAR
Rattus norvegicus V1384 ighv AABR06046581.1 24084 VLSQVQMKETGPGLVQTTQTLSVTCTVSGFSLTSYGVHWVRQAPGKGLEWMGIIWGDGSTNYNSALKSRLSISRDTSKSQVFLTMNSLQTDDTAVYYCAE
Rattus norvegicus V1385 ighv AABR06046582.1 8065 IHCEVKLLESGGGLVQSGASLRLSCVASGFTFSDFFMDWVRQAPGKGLEWIAASRNKARDYSAVYSASVNGRFTISRDISQSILYLQMNTLKAEDTATYYCVRN
Rattus norvegicus V1387 ighv AABR06046585.1 62514 VQCEVKLVESGGGLVQPGRSLKLSCAASGFNFNDYWMGWVRQAPGKGLEWIGEINKDSSTINYTPSLKDKFTISRDNAQNTLYLQMSKLGSEDTAIYYCAR
Rattus norvegicus V1388 ighv AABR06046591.1 35642 VKGEVKLVESGGGLLKPGGSLKLSCVASGFTFSNYWMHWVRQAPGKGLEWIGEIEYDGTETNYAPSIKDRFTISRDNAKNTLYLQMSSVRSEDTATYFCTT
Rattus norvegicus V1389 ighv AABR06046591.1 7228 IQCEVKLAVHGGGLVEPGSSLRLSCVASGFTLGDYYMEWVRQAPGKGLEWIAATRNRAKDYSAEYSVSVNGRFTISRDVSQNILYLHMNNLKTEDTGIYYCARD
Rattus norvegicus V1390 ighv AABR06046593.1 15959 VQCEVQLVESGGSLVQPGGSLKLSCVASGYTFSNYWMDWVRQTPGKSLEWIGEINTDGSKTNYAPSIKDRFTISRDNAKSTLYLQMSNVKSDDTAIYYCTR
Rattus norvegicus V1391 ighv AABR06046596.1 8033 VYAEVQLQQSGPELRRPGSSVKLSCKASGYSITDYLMHWVKHRPEHGLEWIGWIDPEDGETKYAQKFQSKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V1392 ighv AABR06046598.1 31700 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSNYWGWIRKFPGNKMEWIGHISYSGSTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Rattus norvegicus V1393 ighv AABR06046600.1 27567 IQCEVKLLESGGGLVQPGGSLRLSCAASGFTFADFYMSWIRQSPGKAPEWLSFIRNKANSYTTEYNPSVKGRFTISRDDTQNVLYLQMNTLRAEDTAIYYCAKH
Rattus norvegicus V1394 ighv AABR06046606.1 83430 VLSQVNLQESGPGLVKPSQPLSVTCSVTGYSITTSYYYWNWIRKFPGNKLEWMGYISYDGSIYYNPSLKSRISITRDTSKNQFFLQLNTVTTEDTAVYYCA
Rattus norvegicus V1395 ighv AABR06046606.1 39516 IQCEVKLLESGGGLVQPGGSMRLSCAASGFTFTDFYMNWIRQPAGKAPEWLGFIRNKANGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCA
Rattus norvegicus V1396 ighv AABR06046606.1 9623 GAQAQIQLVQSGPELKKPGESVKISCKASGYTFTDYAMHWVKQAPGKGLKWMGWINTYTGKPTYADDFKGRFVFSLEASASTANLQISNLKNEDTATYFCA
Rattus norvegicus V1397 ighv AABR06046607.1 7190 ILSEVQIQESGPGLVKPSQSLSLTCSVTGYSITSRNYWSWIQKFPGNKMECMGHITDNGSANYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTDTYYCA
Rattus norvegicus V1398 ighv AABR06046609.1 19862 VQCEVKLVESGGGLVLSGGSLKLSCVASRFTFSSYWMTLVQQTPGKALEWIGEIKPDGSRTNYAPSLKNRFTISRDNAKSTLYLQMSNVRSEDTATYYCVK
Rattus norvegicus V1399 ighv AABR06046610.1 29887 VQCEVKLVESGGGLVLPGASLKLSCIVSGFTFSDYWMRWVRQAPGKGLEFIGEIKPDGSKTNYAPSMKGRFTISRDNAKNTLYLQMSSVRSEDTATYYCA
Rattus norvegicus V1400 ighv AABR06046611.1 3106 VNSEVQLQQYGAELGKPGTSVKLSCKVSGYNIRSTYMHWVNQRPGKGLEWIGRIDPANGNTIYAEKFKSKATLTADTSSNTAYMQLSQLKSDDTAIYFCA
Rattus norvegicus V1401 ighv AABR06046613.1 33460 VYSEVQLQQSGPEVGRPGSSVKISCKASGYTFTDYVMNWVKQSPGQGLEWIGWIDPEYGSTDYAEKFKKKATLTADTSSSTAYIQLSSLTSEDTATYFCA
Rattus norvegicus V1402 ighv AABR06046616.1 52572 TQSQIQLKESGPAVIEPSQSLFLICTVSRFSITSGYCWHWTRQILGKRLEWMGRICYEGSTYYSPSFKSRSTLSSDTSLNKFYILLNSVTAEDTAMYYCFRE
Rattus norvegicus V1403 ighv AABR06046619.1 79807 IFDCEVQLVESGGGLVQPGGSLKLSCVASGFTFRDYWMNWVRQAPGKTMEWIGDIKPDGSNTNYAPSVKNRFTISRDNAKSILYLQMSNMRSDYTATYYCVR
Rattus norvegicus V1404 ighv AABR06046619.1 30554 IQCEVKLVEYGGGLVQPGASLRLSCEASGFTFSDFYMEWIRQAPGKGLEWIAASRNKANDYSTVYSASVKDRFTISRDTYKSILYLQMNTLKPEDTAIYYCARD
Rattus norvegicus V1405 ighv AABR06046623.1 16620 VRCEVQILETGGGLVKPGGSLRLSCATSGFNFNDYFMNWVRQAPGKGLEWVAQIRNKNYNYATYYAESLEGRVTISRDDSKSSVYLQVSSLRAEDTAIYYCT
Rattus norvegicus V1406 ighv AABR06046623.1 4804 VLCEVKLEESGGGLVQPGMSVKLSCTTSGFTFSDYWMEWVRQAPGKGLEWVAEIRNKANNYATYYGKSVKGRFTISRDDSKSIVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V1407 ighv AABR06046625.1 16135 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGNGLDWVASISIKTYNYATVYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAWYYCTV
Rattus norvegicus V1408 ighv AABR06046628.1 10560 VNSEVQLQQSGPELQRPGASVKLSCKASGYTFTEYYMYWVKQRPKQGLELIGRIDPEDGSTDYVEKFKNKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V1409 ighv AABR06046629.1 48429 VQCEVQVLESGGGLVQPGNSLKLSCATSGFTFSTAWMYWYRQFPEKRLEWVARIKAKSNNYATDYTESVKGRFTISRDDSKSSIYLQMNNLKEEDTAIYYCA
Rattus norvegicus V1410 ighv AABR06046629.1 36371 IQCEVQLVETGGGLVRPGSSLKLSCATSGFTFSNTWMNWVRQAPGKGLEWVALIKDKYSNYEANYAESVKGRFTISRDDSKSRVYLQMNTLRDQDTATYYCT
Rattus norvegicus V1411 ighv AABR06046629.1 11608 AQAQIQLVQSGPEVKKPGESVKISCKASGYTFTQAGMQWLKQAQGKSLKWMGWINTNTGKTTYAADFTGRFVFSLETSASTAYLQITNLKNEDMATYFCA
Rattus norvegicus V1412 ighv AABR06046630.1 16461 FQCEVQLVETGGSLVQPGKSLKLTCATSGFTFSNAWMHWVRQSPEKQLEWVAQIKAKSNNYATYYAESVKGRFTISRDDSKSSVYLQMNSLKEEDTAIYYCT
Rattus norvegicus V1413 ighv AABR06046633.1 63891 AHCEVQLVETGGGLVQPGKSLKLTCATSGFTFSTAWMHWVRQSPDKRLEWIARIKDKSNNYATDYVESVKGRFTISRDDSKSSVYLQMNSLKEEDTATYYCT
Rattus norvegicus V1414 ighv AABR06046633.1 23896 AHCEVQLMETGGGLVQPGKSLKLTCATSGFTFSTAWMNWVRQSPEKGLEWIARIKPKSTNYATEYAESVKGRFTISRDDSKSSIYLQMNSLKEEDTATYYCT
Rattus norvegicus V1415 ighv AABR06046633.1 5761 VHCEMQLVESGGGLVQPNGSLKLSCAASGFTFNTYDMSWVSQSPGKGLELVAGISIKSYNYATFYADSVKGRFTISRDDSQSMVYLQMNNLKTEDTALYYCTA
Rattus norvegicus V1416 ighv AABR06046634.1 129493 VLCEVKLEESGGGLVQPGVSLKLSCATSGFTFSNYWMEWVRQSPGKGLEWVAEIRTKANNYATYYGESMKGRFTISRDDSKSMVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V1417 ighv AABR06046634.1 56313 ILSQMQLQESGPGLVKPTQSLFLTCSVTGFSITSGYYWIWIRQSHGKHLEWMGYMTYSGETFYNPSLKSPISITRETSKNQFFLQLNSVTTEDTAMYYCAG
Rattus norvegicus V1418 ighv AABR06046634.1 24838 EKYEVKPLETGGGLEQSGNSLKLSCATSGFTFSTAGMSWIHQAPGNVLERLAQVEDKSNNYFISYVEYLKGRFTISRDNSKESIYLQVNILKEKDTAIYYCI
Rattus norvegicus V1419 ighv AABR06046634.1 6559 SQCEVQLVETGGGLVQPGNSLKLSCATSGFTFSTAWMNWIRQTPGKRLEWLAQIEDKSNNYFISYLESVKGRFTISRDDSKSSVYLQMNNLKEEDTAIYYCT
Rattus norvegicus V1420 ighv AABR06046635.1 43894 VLSQVTLKESGPGMLQPSQTLSLTCTFSGTSLSTSNMGLSWLRQPSGKGLEWLASIWNNDNYYNPSLRSRLTISKETSKNQVLLKFTSMEPADTATYYCAWR
Rattus norvegicus V1421 ighv AABR06046636.1 191743 VHSQVHLQQSGSDLVKPGASVKLSCKASGYTFSTSYMNWLKQVPGQSIEWIGYIYAGNGDINYNQKYKGKAKLTVDTSFSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V1422 ighv AABR06046636.1 76555 LVESAGGLVQTKGSLKLSCAASGFTFDTYAMNWVRQAPGKGLEWVASIRSKSDNYATYYADSVKGRFTISRDDSRSMLCLQMDNVKTEDTAIYYCTR
Rattus norvegicus V1423 ighv AABR06046636.1 63000 LHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNSYGMSWVRQAPGKGLDLVADISSKSYNYATYYADSVKDRFTISRDDSQSMVYLQMDNLKTEDTALYYCTV
Rattus norvegicus V1424 ighv AABR06046636.1 43567 VHCEVQLVESGGGLVQPKGSLKISCAASGFTFDTYSMNWVRQAPGKGLEWVAHIRSKSYNYARYYADSVKGRFTISRDDSRSMVYLQMYNLKTEDTAIYYCTR
Rattus norvegicus V1425 ighv AABR06046636.1 29804 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGKGLDWVASISIKTHNYATLYADSVKERFTISRDDSQSMVYLQMNNLKTEDTALYYCTV
Rattus norvegicus V1426 ighv AABR06046636.1 11081 VHCAVQLVESGGGLVQPKESLKISCAASGFTFSNAAMYWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSKSMVYLQMDNLKTEDTAMYYCTA
Rattus norvegicus V1427 ighv AABR06046637.1 53574 VHSQVQLQQSGAELVKPGSSVKISCKASGYTFTSYDMHWIKQQPGNGLEWIGWIYPGNGNTKYNQKFNGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V1428 ighv AABR06046637.1 2999 VHSQVQLQQSGTELVKPASSVKISCKASGYTFTSNYMHWIRQQPGNGLEWIGWIYPGNGNTKYNQKFDGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V1429 ighv AABR06046638.1 25088 VHSQVKLLQSGAELVKPGASVKLSCKTSGFTFSTSYMSWLKQVPGPSIEWIGWIYAGDGGTNYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDAAVYFCA
Rattus norvegicus V1430 ighv AABR06046639.1 2917 VHSQVKLLQSGAELVKPGASVKLSCKTSGFTFSTSYMSWLKQVPGPSIEWIGWIYAGDGGTNYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDAAVYFCA
Rattus norvegicus V1431 ighv AABR06046642.1 19596 VHSEVQLQQSGAELVKPGASVKLSCKTSGYTFSNYYMSWLKQMPGQNIEWIGNIYGGNGGTGYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V1432 ighv AABR06046644.1 4214 VHSQVQLQQSGAELVKPGSSVKMSCKASGYTFTSYYIYWIKQRPGQGLEWIGRIGPGSGDTNYNEKFKGKATFTVDKSSSTAYMQLSSLTPEDTAVYYCA
Rattus norvegicus V1433 ighv AABR06046649.1 123213 VLSQVSLKESGPGILQPFQTLSLTCSFSGFSLGTSNMGVGWIRQTSGKGLEYLATIWWDDDKYFNPSLNSRLTVSKDTSNNQAFLKITSVDTADTGTYYCTQR
Rattus norvegicus V1434 ighv AABR06046649.1 63038 VHSQVNLLQSRAALVKPGASVKLSCKASGYTFTDYYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKSKATLTVDKSTNTAYMELSRLTSEDSATYYCT
Rattus norvegicus V1435 ighv AABR06046649.1 33504 VHSQVKLLQSGAALVKPGASVKMSCKASGYTFTDYWVSWVKQSHGKSLEWIGEIYPNSGATNFNEKFKGKATLTVDKSTSTAYMELSRLTSEDSAIYYCT
Rattus norvegicus V1436 ighv AABR06046649.1 10306 VHSQVQLQQSGAELAKPGTSVKLSCKASGYTFTSYYIYWVKQRPGQGLEWIGYIYPGNGGTYYSEKFKGKATFTADTSSSTAYMLLGSLTPEDSAYYFCA
Rattus norvegicus V1437 ighv AABR06046651.1 24344 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGICVSWIRQPSGKGLEWLATICWEDSKGYNPSLKNRLTISKDTSNNQAFLKITSVDTADTAIYYCARR
Rattus norvegicus V1438 ighv AABR06046651.1 11095 VHSQVQLQQSGTELVKPGSSLKLSCKASGYTFTDYAMQWVKQRPGQGLEWIGYILPWNGVTDYNQKFKGKATLTVDTSSNTAYMELSRLTSDDSVVYYCA
Rattus norvegicus V1439 ighv AABR06046654.1 1717 VHSQVQLQQSGAELAKPGSSVKISCKASGYTFTSYDISWIKQTTGQGLEYIGYINTGSGGTYYNEKFKGKATLTVDKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V1440 ighv AABR06046663.1 2445 VHSQVQLQQSGAELVKPGTSVKLSCKASGYTFTSNHMNWIKQTTGQGLEWIGIINPGSGGTSYNVKFKGKATLTVDKSSSTAFMQLSSLTPEDSAVYYCA
Rattus norvegicus V1441 ighv AABR06046669.1 3882 VYSEVKLQQSGDELVRPGASVKISCKASGYTFTNYAMYWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V1442 ighv AABR06046684.1 4905 KLSCKNSYFSFRRQFLSSYCMSWVKKRPEQGMEWIGYINLYSGDTSYNQKFKEKATLSTDTSSKTAYMQLSSLVSEDSVVYYCARHSVVTTS
Rattus norvegicus V1443 ighv AABR06046711.1 1532 VLSQVTLKESGPGILQPSQTLSLTCTFSGFSLSTSGTGVSWICQPSGKGLEWLANIWWNDDKGYNPSLKSRLTVSKDTSNTRAFLKITSVDTADTATYYCARR
Rattus norvegicus V1444 ighv AABR06046713.1 660 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQVLEWIGAINPGSGGTGYNEKFKGKATLTEGKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V1445 ighv AABR06046719.1 28081 VLAQVTLKESGPGILQPSHTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLASIWWNGNTYNNPSLKSRLTVSKDTSNNQAFLKVTSVDTADTATYYCA
Rattus norvegicus V1446 ighv AABR06046719.1 15129 VHSQVQLQQCGAELVKPGTPVKMSCKVSGYTFTSYVISWIKQTTGQGLEWIGYIYPESGSTGYNEKFKGKATLTVDKSSNTAFMQLSSLAAGDSAVYYCA
Rattus norvegicus V1447 ighv AABR06046723.1 45157 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMCVGWIRQSSGKGLEWLANIWWNDDKYYNPSLKNRLTISKDTSNNQAFLKITNMDTADTATYYCARR
Rattus norvegicus V1448 ighv AABR06046724.1 7861 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQAVEWIGVINPESGGTDYNGKFRGKVTLTVDKSSSTAFMQLGSLTPEDTAVYYCA
Rattus norvegicus V1449 ighv AABR06046724.1 715 VHSEVKLQQSGDELVRPGASVKMSCKASGYTFTDYAMHWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V1450 ighv AABR06046726.1 10187 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V1451 ighv AABR06046727.1 16570 VFSQVQLQQSGAELVKPGSSVKLSCKASGYTFTEYYIDWVKQRPGQGLEWIGDIDPENGDTAYNEKFKGRATMTADTSSNTAYMELSRLTSEDSAVYYCASVV
Rattus norvegicus V1452 ighv AABR06046727.1 4533 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V1453 ighv AABR06046734.1 2638 VLAQVTLKESGPGILQPSQTLSLTCSFSGFLLSASSVGVGWIRQPSGKGLEWLATIGWEDVKHYNPSLKSRLTVSKDTSNNQVFLKITSVDTADTGTYYCAHS
Rattus norvegicus V1456 igkv AABR06047980.1 14827 SKGDVVLTQSPATLSVTPGERISLSCRASESVDTYLHWYQQKPNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINGVELEDLSIYYCQQGNSLP
Rattus norvegicus V1623 igkv AABR06081722.1 1119 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1628 trdv AABR06082891.1 1411 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1629 trav AABR06082895.1 56358 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V1630 trav AABR06082895.1 46811 CVGESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V1631 trav AABR06082895.1 36470 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1632 trav AABR06082895.1 32544 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1633 trav AABR06082895.1 29198 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1634 trdv AABR06082895.1 6209 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1635 trav AABR06082896.1 638 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1636 trav AABR06082899.1 9178 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V1637 trav AABR06082899.1 1786 MNSQVAEENPWALRIHEGENVTVNCSYKTSIIALQWYRQDSGGGPALLVLICSNEREKHSGRLRATLDTSSQSSSLFITAAQSADTAVYFCATD
Rattus norvegicus V1638 trav AABR06082900.1 13617 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V1639 trav AABR06082900.1 3475 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V1640 trav AABR06082901.1 22131 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDPNNYYFYWYKQEPGAGLQLLMEVFSSTEIKEGQGFIVLLNKNDKRLLLNITAAHLGDSAKYFCAVR
Rattus norvegicus V1641 trav AABR06082901.1 12870 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V1642 trav AABR06082901.1 2412 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V1643 trdv AABR06082903.1 21438 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V1644 trdv AABR06082903.1 15580 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V1645 trdv AABR06082911.1 6424 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVEYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V1646 trav AABR06082912.1 29952 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V1647 trav AABR06082912.1 18252 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V1648 trav AABR06082913.1 2215 ANSQRGEENLLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGGGPVLLMLIRSNEREKHIGRLRATLDTSSQSSSLSITAAQSADTAVYFCATN
Rattus norvegicus V1649 trav AABR06082916.1 39270 VKGKQVQQSPVSLVLQEGEKAELQCNFSTALSNMQWFFQRPGGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1650 trav AABR06082916.1 23907 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V1651 trav AABR06082916.1 18713 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V1652 trav AABR06082916.1 2704 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGESLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1653 trav AABR06082921.1 1782 MSQGEQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPGKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V1654 trav AABR06082924.1 12429 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1655 trav AABR06082926.1 31195 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKEQSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V1656 trdv AABR06082926.1 19262 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGSYYLFWYKQLLSGEMVFLILQPSFDSQNQRRGRYSVIFQQSLKSISLVISASQPEDSGTYFCALWET
Rattus norvegicus V1657 trav AABR06082926.1 6046 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V1658 trav AABR06082927.1 863 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V1659 trav AABR06082929.1 4497 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1660 trav AABR06082934.1 13893 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1662 trav AABR06082935.1 46920 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1663 trav AABR06082935.1 42993 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1664 trav AABR06082935.1 39647 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1665 trav AABR06082935.1 33464 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V1666 trdv AABR06082935.1 18278 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1667 trav AABR06082936.1 1532 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V1668 trav AABR06082939.1 42117 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V1669 trav AABR06082939.1 30802 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V1670 trav AABR06082939.1 22903 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V1671 trav AABR06082939.1 5655 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1672 trav AABR06082939.1 316 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V1673 trav AABR06082946.1 26336 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQHSGKGLELLVSIFSNGQKEEGRFTVHLNIARLQVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V1674 trav AABR06082946.1 7609 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1675 trav AABR06082946.1 576 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V1676 trav AABR06082948.1 2061 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1677 trav AABR06082954.1 25684 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V1678 trav AABR06082954.1 4949 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V1679 trav AABR06082955.1 4651 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1680 trdv AABR06082957.1 3570 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V1681 trav AABR06082960.1 8519 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V1682 trav AABR06082961.1 10170 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1683 trav AABR06082961.1 4035 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1684 trav AABR06082962.1 3365 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V1685 trav AABR06082963.1 19500 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIAYPTLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1686 trav AABR06082963.1 16207 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1687 trav AABR06082971.1 9739 MNSQVVEENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLGQDPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V1688 trav AABR06082972.1 19160 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V1689 trav AABR06082972.1 15016 VSSPAEGQQNPESLTVPEGGRTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPSDSALYLCAV
Rattus norvegicus V1690 trav AABR06082972.1 5411 VSSQEKVQQSPESLIVPEGSIASLNCTYSDPNFLYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAHFSKASLHVSLHIRDSKPSDSALYFCAASE
Rattus norvegicus V1691 trav AABR06082974.1 16039 VSRGEQVEQHLSHLSVREGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V1692 trav AABR06082974.1 6395 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V1693 trdv AABR06082981.1 12908 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSREMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALKEL
Rattus norvegicus V1694 trav AABR06082985.1 338 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V1695 trdv AABR06082994.1 32458 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1696 trav AABR06082994.1 9996 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1697 trdv AABR06082996.1 8318 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V1698 trav AABR06083000.1 672 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1699 trdv AABR06083004.1 1596 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V1701 trdv AABR06083212.1 925 KNALCVTLTQSSLDQAVVSGSKVTLLCTFDGSSPNPDLFWYRKRPDGSFQFILYRDNSRSHDADFVQGRFSVKHSKADGTFHLVIAPVRLEDSATYYCALG
Rattus norvegicus V1731 igkv AABR06091203.1 60833 LNGDIVMTQGALPNPVPSGESASITCQSSKSLLHSNGKTYLNWYLQRPGQSPQFLIYWMSTRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDLEFP
Rattus norvegicus V1732 igkv AABR06091203.1 6950 TRCDIRMTQTPASLSASLGESVTITCRASQDIGKSLLWFQQKTGKPPKILIYTASNLVSGISPRFSGSGSGTQFSLKISSLKPEDTANYYCCQGYSLS
Rattus norvegicus V1733 igkv AABR06091206.1 52776 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSLVHNNGNTYLSWYLQKPGQSPQLLIYKVSNRFSGISDRFSGSGSGTDLTLKISRVEPDDLGVYYCGQG
Rattus norvegicus V1734 igkv AABR06091208.1 15147 SRGDVVMTQTPVSLPVSLGGQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGDYYCLQS
Rattus norvegicus V1735 igkv AABR06091214.1 39226 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V1736 igkv AABR06091214.1 17724 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHRSRIS
Rattus norvegicus V1737 igkv AABR06091215.1 9660 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V1741 igkv AABR06091909.1 11635 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1743 trgv AABR06092040.1 54256 RQTSSYLEERIMSITRPVGSSVIITCDIHGNDNYIHWYRFQKGQDPQHLLYYNSISSTTVVDSRLDPEKYHVYEGTDRRYKFVLRNVEESDSALYYCATWA
Rattus norvegicus V1744 trgv AABR06092040.1 48513 GRGKLEQPEISISRARDETAEISCKVFVESFQSVAIHWYRQKPNQGLEFLLYVLATPTETFLNKKYKKMKASKNSSASTSILTIYSLEEEDEAIYYCSYG
Rattus norvegicus V1745 trgv AABR06092040.1 43044 LGGSILTSPLVSYVIKRKGNTAFLKCQIKTSALKPNTYIHWYRQKPGQPLQRMLCSSSSENTVYEKGFSEERFEARTWQNDLPSVLRIHQVTEDDMGTYYCACWD
Rattus norvegicus V1746 trgv AABR06092040.1 41220 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYKLKEGEPLKRIFYGSAKAYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Rattus norvegicus V1747 trgv AABR06092040.1 4851 GLGQLKQTKMSVTKATGQSAQIPCIVSVPDFGTTPIHWYRQKTNQQIEYLIFVSTGYNQRPLDGKYKKIEARKDFQTSTSNLTLNYLKKEDEATYYCALWA
Rattus norvegicus V1833 trdv AABR06111057.1 906 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V1835 igkv AABR06081722.1 1119 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1840 trdv AABR06082891.1 1411 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1841 trav AABR06082895.1 56358 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V1842 trav AABR06082895.1 46811 CVGESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V1843 trav AABR06082895.1 36470 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1844 trav AABR06082895.1 32544 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1845 trav AABR06082895.1 29198 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1846 trdv AABR06082895.1 6209 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1847 trav AABR06082896.1 638 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1848 trav AABR06082899.1 9178 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V1849 trav AABR06082899.1 1786 MNSQVAEENPWALRIHEGENVTVNCSYKTSIIALQWYRQDSGGGPALLVLICSNEREKHSGRLRATLDTSSQSSSLFITAAQSADTAVYFCATD
Rattus norvegicus V1850 trav AABR06082900.1 13617 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V1851 trav AABR06082900.1 3475 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V1852 trav AABR06082901.1 22131 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDPNNYYFYWYKQEPGAGLQLLMEVFSSTEIKEGQGFIVLLNKNDKRLLLNITAAHLGDSAKYFCAVR
Rattus norvegicus V1853 trav AABR06082901.1 12870 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V1854 trav AABR06082901.1 2412 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V1855 trdv AABR06082903.1 21438 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V1856 trdv AABR06082903.1 15580 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V1857 trdv AABR06082911.1 6424 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVEYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V1858 trav AABR06082912.1 29952 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V1859 trav AABR06082912.1 18252 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V1860 trav AABR06082913.1 2215 ANSQRGEENLLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGGGPVLLMLIRSNEREKHIGRLRATLDTSSQSSSLSITAAQSADTAVYFCATN
Rattus norvegicus V1861 trav AABR06082916.1 39270 VKGKQVQQSPVSLVLQEGEKAELQCNFSTALSNMQWFFQRPGGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1862 trav AABR06082916.1 23907 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V1863 trav AABR06082916.1 18713 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V1864 trav AABR06082916.1 2704 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGESLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1865 trav AABR06082921.1 1782 MSQGEQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPGKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V1866 trav AABR06082924.1 12429 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1867 trav AABR06082926.1 31195 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKEQSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V1868 trdv AABR06082926.1 19262 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGSYYLFWYKQLLSGEMVFLILQPSFDSQNQRRGRYSVIFQQSLKSISLVISASQPEDSGTYFCALWET
Rattus norvegicus V1869 trav AABR06082926.1 6046 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V1870 trav AABR06082927.1 863 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V1871 trav AABR06082929.1 4497 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1872 trav AABR06082934.1 13893 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1874 trav AABR06082935.1 46920 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1875 trav AABR06082935.1 42993 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1876 trav AABR06082935.1 39647 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1877 trav AABR06082935.1 33464 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V1878 trdv AABR06082935.1 18278 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1879 trav AABR06082936.1 1532 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V1880 trav AABR06082939.1 42117 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V1881 trav AABR06082939.1 30802 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V1882 trav AABR06082939.1 22903 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V1883 trav AABR06082939.1 5655 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1884 trav AABR06082939.1 316 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V1885 trav AABR06082946.1 26336 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQHSGKGLELLVSIFSNGQKEEGRFTVHLNIARLQVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V1886 trav AABR06082946.1 7609 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1887 trav AABR06082946.1 576 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V1888 trav AABR06082948.1 2061 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1889 trav AABR06082954.1 25684 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V1890 trav AABR06082954.1 4949 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V1891 trav AABR06082955.1 4651 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1892 trdv AABR06082957.1 3570 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V1893 trav AABR06082960.1 8519 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V1894 trav AABR06082961.1 10170 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V1895 trav AABR06082961.1 4035 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V1896 trav AABR06082962.1 3365 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V1897 trav AABR06082963.1 19500 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIAYPTLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V1898 trav AABR06082963.1 16207 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V1899 trav AABR06082971.1 9739 MNSQVVEENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLGQDPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V1900 trav AABR06082972.1 19160 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V1901 trav AABR06082972.1 15016 VSSPAEGQQNPESLTVPEGGRTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPSDSALYLCAV
Rattus norvegicus V1902 trav AABR06082972.1 5411 VSSQEKVQQSPESLIVPEGSIASLNCTYSDPNFLYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAHFSKASLHVSLHIRDSKPSDSALYFCAASE
Rattus norvegicus V1903 trav AABR06082974.1 16039 VSRGEQVEQHLSHLSVREGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V1904 trav AABR06082974.1 6395 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V1905 trdv AABR06082981.1 12908 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSREMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALKEL
Rattus norvegicus V1906 trav AABR06082985.1 338 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V1907 trdv AABR06082994.1 32458 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V1908 trav AABR06082994.1 9996 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1909 trdv AABR06082996.1 8318 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V1910 trav AABR06083000.1 672 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V1911 trdv AABR06083004.1 1596 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V1913 trdv AABR06083212.1 925 KNALCVTLTQSSLDQAVVSGSKVTLLCTFDGSSPNPDLFWYRKRPDGSFQFILYRDNSRSHDADFVQGRFSVKHSKADGTFHLVIAPVRLEDSATYYCALG
Rattus norvegicus V1943 igkv AABR06091203.1 60833 LNGDIVMTQGALPNPVPSGESASITCQSSKSLLHSNGKTYLNWYLQRPGQSPQFLIYWMSTRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDLEFP
Rattus norvegicus V1944 igkv AABR06091203.1 6950 TRCDIRMTQTPASLSASLGESVTITCRASQDIGKSLLWFQQKTGKPPKILIYTASNLVSGISPRFSGSGSGTQFSLKISSLKPEDTANYYCCQGYSLS
Rattus norvegicus V1945 igkv AABR06091206.1 52776 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSLVHNNGNTYLSWYLQKPGQSPQLLIYKVSNRFSGISDRFSGSGSGTDLTLKISRVEPDDLGVYYCGQG
Rattus norvegicus V1946 igkv AABR06091208.1 15147 SRGDVVMTQTPVSLPVSLGGQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGDYYCLQS
Rattus norvegicus V1947 igkv AABR06091214.1 39226 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V1948 igkv AABR06091214.1 17724 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHRSRIS
Rattus norvegicus V1949 igkv AABR06091215.1 9660 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V1953 igkv AABR06091909.1 11635 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1955 trgv AABR06092040.1 54256 RQTSSYLEERIMSITRPVGSSVIITCDIHGNDNYIHWYRFQKGQDPQHLLYYNSISSTTVVDSRLDPEKYHVYEGTDRRYKFVLRNVEESDSALYYCATWA
Rattus norvegicus V1956 trgv AABR06092040.1 48513 GRGKLEQPEISISRARDETAEISCKVFVESFQSVAIHWYRQKPNQGLEFLLYVLATPTETFLNKKYKKMKASKNSSASTSILTIYSLEEEDEAIYYCSYG
Rattus norvegicus V1957 trgv AABR06092040.1 43044 LGGSILTSPLVSYVIKRKGNTAFLKCQIKTSALKPNTYIHWYRQKPGQPLQRMLCSSSSENTVYEKGFSEERFEARTWQNDLPSVLRIHQVTEDDMGTYYCACWD
Rattus norvegicus V1958 trgv AABR06092040.1 41220 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYKLKEGEPLKRIFYGSAKAYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Rattus norvegicus V1959 trgv AABR06092040.1 4851 GLGQLKQTKMSVTKATGQSAQIPCIVSVPDFGTTPIHWYRQKTNQQIEYLIFVSTGYNQRPLDGKYKKIEARKDFQTSTSNLTLNYLKKEDEATYYCALWA
Rattus norvegicus V2045 trdv AABR06111057.1 906 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V61 igkv AABR07013111.1 3849 MRCDIQMTQSPPVLSASVGDRVTLSCKASQNINKNLDWYQQKHGEAPKLLIYYTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V62 igkv AABR07013116.1 3898 GKCDIQMTQSPASLSASLEEIVTITCQPSQGIGNYLSWYQQKLGKSPQLLIHSATSLEDGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQISSTP
Rattus norvegicus V90 trdv AABR07017212.1 214 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V92 trav AABR07017583.1 332563 ASGQGVEQPAKLMSVEGTFARVNCTYSTSGFNGLSWYQQHEGQAPVFLFYTVLDGLKDSGRFSTFLSRSDGYSYLLLTELQIKDSASYLCAVR
Rattus norvegicus V93 trav AABR07017588.1 24404 SWSLAKTTQPLSRDSYEGQAVNVSCSHTNIATSEYIYWYRQASHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPRVSLRDTAVYYCIVA
Rattus norvegicus V94 trav AABR07017591.1 107 VSRGEQVEQRPSHLSVLEGDSAAIVCTYTDSNNDYFFWYKQEFGAGLQLLMSVLSNVNRKEEQGLTVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V95 trav AABR07017593.1 9801 ESQGEQVKQHPSSLSVQEGATALINCSYTDSASVYFPWYKQEPGRRPQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLNITATEPGDSAVYFCTAS
Rattus norvegicus V96 trav AABR07017594.1 856 VSSQQKVQQSPESLIVSEGDTASLNCTFSDSASNSFWWYRQHSGKGPKALMSIFSSGDKQEGRFTAHLNIASLHVSLHIRDLGPSDSALYLCAV
Rattus norvegicus V97 trav AABR07017596.1 5669 VSSQQKVQQSPESLIVSEGDTSSLNCTFSDSSSYSFWWYRQHSGEGPKVLMSIVSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYFCAVS
Rattus norvegicus V98 trav AABR07017596.1 10898 WTHGNSVTQTQGQVTLSEEEFLFINCTYSSTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYEKRTTSFHLQKASVQESDSAVYYCVLG
Rattus norvegicus V99 trav AABR07017597.1 1210 RTHGNSVTQTQGQVTLSEGKFLFINCTYSTTTYPTLFWYVQHPGEGPQLLLKVTTANNKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALG
Rattus norvegicus V100 trav AABR07017597.1 13391 VRSQEKVQQNPDILIVPEGATASFNCTSSDRNVDYFWWYRQHSGKAPKMLMSIVSNGVKEEGRFTAHFNKASLHVSLHINDSQPSDSAVYLCAVS
Rattus norvegicus V101 trav AABR07017599.1 3554 GVRGIQVEQNPEALSLHEGAGSGLRCNFSTTMNSVQWFRQNPRGSLINLFFLASGTKENGRLKSTFDSKERYSTLHISDAQLEDSGTYFCAAE
Rattus norvegicus V102 trav AABR07017604.1 4458 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSTSDYFWWFRQYSGKSPKALMSIFSNGDKQEGRFTVHLNKTSLHVSLHINDSQPTDSAVYLCAVS
Rattus norvegicus V103 trav AABR07017604.1 8575 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSASQYFWWYRQYSGKSPKALMSIFSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYLCAV
Rattus norvegicus V104 trav AABR07017610.1 233 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V105 trav AABR07017707.1 8215 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYLQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V106 trav AABR07017733.1 1508 VSRGEQVEQHLSHLSVWEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQYFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V107 trav AABR07017734.1 226 VSRGEQVEQRLSHLSVREGDSAFIICTYRDSLSSYFYWYKQEPRAGLQLLIMQVFWSTEIKEAQGIIVLLNKKDKRLSLNITSARIGDSATYFCAVSTQCSS
Rattus norvegicus V108 trav AABR07017737.1 1682 VSSQQKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELLSIFSTGEKEEGRFKIHVIKANLHVFLHIKDSQPGDSALYFCAV
Rattus norvegicus V109 trav AABR07017738.1 3732 MKKTHGDSVTQKEGQVTLSEGDFLFINCTYSTTGYPTLFWYVQYPGEGPQLLFQVTTANNKGKNRGFEALYDKGTTSFHLEKASVQESDSAVYYCALS
Rattus norvegicus V110 trav AABR07017738.1 12191 VSSQQKVQQSPESLTVPEGAKTSLNCTFSSSASQYFAWYRQHPGKEPKELLSIFSTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V111 trav AABR07017742.1 74 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASK
Rattus norvegicus V112 trav AABR07017742.1 3406 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V113 trav AABR07017744.1 6213 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V114 trav AABR07017745.1 6180 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V115 trav AABR07017745.1 9217 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V116 trav AABR07017745.1 18414 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSASSYFPWYKQEAGKGLHFVIDIISNVDRKENQRFKILLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V117 trav AABR07017745.1 33642 RTHGDSVTQTEGQVTISENGFLRINCTYSATRIVYPNLFWYVQYPGEGLQLLLKVITAGEKGSSRGFEATYNKETTSFHLEKASVQESDSAVYYCALG
Rattus norvegicus V118 trav AABR07017745.1 37531 VAGRTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDADAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V119 trav AABR07017745.1 41053 RSNGDSVTQTEGLVTLTEGSHVMLTCTYQTTYSGPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSRRSFSLQKPSAQLSDSALYYCAVE
Rattus norvegicus V120 trav AABR07017745.1 48105 VKGQQVQQSPVSLVLQEGENSELQCNFSISTNQLQWFFQRPGGSLVSLFFNPSGTKKSGRLTSMTVPKERRSSLHISSSQTTDSGTYFCAMDPQCS
Rattus norvegicus V121 trdv AABR07017745.1 58703 FNVAQKVTQVKSTASRQEGEEVTLDCSYETSQNLYYLFWYKQLQSGDIIFLIRQASSDSQNQRSSRYSVIFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V122 trav AABR07017745.1 63329 DSVVQGENGFEAEFSKSNSSWLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V123 trav AABR07017748.1 9316 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V124 trav AABR07017748.1 15757 DGQAQSVTQPDVHVTISEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLRYYSGDPVVQGENSFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V125 trav AABR07017748.1 24826 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V126 trav AABR07017754.1 10510 VQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGRGLQFLLKYYTGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V127 trav AABR07017763.1 6201 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHMRDLGPSDSAVYLCAV
Rattus norvegicus V128 trav AABR07017763.1 20306 RSNGDSVTQTEGRVLVTEGLHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSSRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V129 trav AABR07017764.1 73 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCALE
Rattus norvegicus V130 trav AABR07017765.1 897 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V131 trav AABR07017767.1 2836 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSTKQMQWFYQRPGGSLVSLLYNPSGTKQSGRLTSTTVAKERQSSLHISSSQTTDSGTYFCALDAQCS
Rattus norvegicus V132 trdv AABR07017768.1 7022 FNVAQVQSTASMQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V133 trav AABR07017768.1 19176 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V134 trav AABR07017768.1 37792 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDSKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V135 trav AABR07017768.1 44174 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V136 trav AABR07017768.1 58130 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V137 trav AABR07017768.1 69887 RSNGDSVTQTEGLVSLTEGSPVVLNCTYQTTYSASTLFWYVQYLSEAPRLLLRSSTDSKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V138 trav AABR07017769.1 4617 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V139 trav AABR07017770.1 2800 VKGQQVQQSPVSLVLQEGEKAELQCTFSTAFNSMQWFYQNPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V140 trdv AABR07017770.1 15955 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V141 trav AABR07017772.1 1234 VSRGEQVEQHLSHLSVLEGDSAAIICTYTDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V142 trav AABR07017772.1 8245 VAQAQSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYSQQGLLLLLKYYSGNPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALR
Rattus norvegicus V143 trav AABR07017773.1 6451 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V144 trdv AABR07017781.1 14381 FNVAQEVTQVQSTASWQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V145 trdv AABR07017783.1 576 FNVAQEVTQVQSTASRQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWES
Rattus norvegicus V146 trav AABR07017783.1 13614 VAQAQSVTQPDTHVTVSEEDSLQLRCTYSSSVPPSLFWDVQYPQQGLEMLLRYYSGNPMVQGMNGFVAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V147 trav AABR07017783.1 32109 RSNGDSMTQTEGLVTLTEQSPVMLTCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVG
Rattus norvegicus V148 trav AABR07017783.1 38502 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V149 trav AABR07017786.1 58 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V150 trav AABR07017786.1 6654 VKGQQVQQSPVSLVLQEGENAELQCKFSTIATELQWFFQHPGGSLVSLLNNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V151 trdv AABR07017789.1 11378 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V152 trdv AABR07017791.1 1778 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL
Rattus norvegicus V153 trav AABR07017794.1 6164 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V154 trav AABR07017798.1 5935 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V155 trav AABR07017798.1 16048 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V156 trav AABR07017803.1 317 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V157 trav AABR07017804.1 8806 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V158 trav AABR07017804.1 11597 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V159 trav AABR07017809.1 4610 VSRGEQVEQRPSHLSVREGDSAVIICTYTDSLSSYFYWYKHEPGAGLQLLMEVFSSTEIKGQGFIVLLNKKDKRLSLNITAVHLGDSATYFCPVR
Rattus norvegicus V160 trav AABR07017809.1 13245 VAQAQSVTQPDAHVTVSEEASLQLKCKYSYPGTPSLFWYVQYPQQGLQLLLKYYSGNPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V161 trav AABR07017812.1 116 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V162 trav AABR07017812.1 3304 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V163 trav AABR07017812.1 13874 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V164 trav AABR07017812.1 21808 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V165 trav AABR07017812.1 22767 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V166 trav AABR07017814.1 9573 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALG
Rattus norvegicus V167 trav AABR07017814.1 12342 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V168 trav AABR07017818.1 5939 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V169 trav AABR07017818.1 8892 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V170 trav AABR07017818.1 12320 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V171 trav AABR07017819.1 529 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V172 trav AABR07017819.1 3863 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V173 trav AABR07017819.1 14427 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V174 trav AABR07017819.1 19179 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V175 trav AABR07017824.1 38 RSNGDSVTQTEGRVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKNNRSFHLQKPSAQLSDSALYYCALS
Rattus norvegicus V176 trav AABR07017824.1 9750 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V177 trav AABR07017824.1 13646 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V178 trdv AABR07017825.1 4187 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V179 trav AABR07017825.1 17253 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V180 trav AABR07017825.1 37275 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V181 trav AABR07017825.1 43757 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V182 trav AABR07017825.1 51008 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V183 trav AABR07017825.1 65670 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V184 trdv AABR07017825.1 78608 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGTYYLFWYKQLLSGEMVFLILQPSFDSQNQRSGRYSVIFQQSLKSISLVISASQPEDSGKYFCALWET
Rattus norvegicus V185 trav AABR07017825.1 92415 VSRGEQVEQHLSHLSVLEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V186 trav AABR07017825.1 133758 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V187 trav AABR07017826.1 565 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V188 trav AABR07017830.1 9025 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V189 trav AABR07017830.1 14211 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V190 trav AABR07017830.1 30181 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGGSLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V191 trav AABR07017830.1 40269 VNSQRGEENRLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGRGPALLVLIRSNEREKHSGRLRATLDTSSQSISLSISAAQSADTAVYFCATD
Rattus norvegicus V192 trav AABR07017831.1 4251 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V193 trav AABR07017833.1 9204 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V194 trdv AABR07017833.1 26500 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V195 trav AABR07017836.1 5758 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSFSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V196 trav AABR07017838.1 8197 MSQGEQVKQFPSILRVQGGSNAILNCTYVDSASLYFPWYKQEPGMHPQLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V197 trav AABR07017838.1 18383 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V198 trav AABR07017838.1 23460 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V199 trav AABR07017839.1 5587 ANSQRGEENLLGLSTQEGENVTINCTYKTYTAVLQWYRQDSGGGPALLVLIRSNEREKHSGRLRTTLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V200 trav AABR07017841.1 1497 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V201 trav AABR07017841.1 13121 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V202 trdv AABR07017846.1 12706 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVVYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQQSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V203 trav AABR07017849.1 12616 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V204 trav AABR07017849.1 22037 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V205 trav AABR07017854.1 246 VSSQQKVQQNPESLTVPEGARTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V206 trav AABR07017855.1 571 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V207 trav AABR07017856.1 9939 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V208 trav AABR07017858.1 2889 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGGTPYLFWYIQHHGHGLQFLLRYYSGDPVVHGMNGFEAEFSKSNSSFHLKKASVHWSDSAVYFCAVG
Rattus norvegicus V209 trav AABR07017868.1 1000 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V210 trav AABR07017868.1 4136 VSSQQKVQQSPESLSVSEGAIVSLNCTFSDSASQSFWWYQQHLGKGPKMLISVFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V211 trav AABR07017868.1 25316 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSINQMQWFYQRPGGSLVRLLYNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMEPQCS
Rattus norvegicus V212 trav AABR07017868.1 42077 TSMAQKVMQTQASISVMETKTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMRE
Rattus norvegicus V213 trav AABR07017868.1 52937 VKGQQVQQSPVSLVLQEGEEAELQCNFSTSATRLQWFFQRPEGSLVSLLYNPSGTKKSGRLTSTTVTREQRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V214 trdv AABR07017868.1 73138 CNVAQEVTQVQSTASRQEGEEVTLDCSYETSYVAYYLSWYKQHLSGDIIFLIHQISSSTAEERSGRYSLVFQKSLKSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V215 trav AABR07017869.1 2134 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V216 trav AABR07017870.1 898 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V217 trav AABR07017870.1 9306 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V218 trav AABR07017870.1 22764 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V219 trav AABR07017870.1 34077 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V220 trav AABR07017870.1 41981 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V221 trav AABR07017872.1 6999 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWTDSAVYFCALG
Rattus norvegicus V222 trav AABR07017872.1 9769 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V223 trav AABR07017874.1 7457 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V224 trav AABR07017874.1 17704 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V225 trav AABR07017874.1 21167 VAGKTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDTGRGPVSLTVLTNKEEKTSRGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V226 trav AABR07017875.1 7769 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V227 trav AABR07017878.1 5317 VSSQQKVQQSPESLIVPEGGMTSLNCTFSNRASNNFRWYRQHSGKGLELLVSIFSNGEREEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V228 trav AABR07017885.1 6452 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V229 trav AABR07017892.1 7658 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V230 trav AABR07017892.1 14264 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSVQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V231 trav AABR07017894.1 4039 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPLGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V232 trav AABR07017895.1 1323 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V233 trdv AABR07017897.1 6271 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V234 trav AABR07017901.1 26871 VSRGEQVEQRPSHLSVREGDSAIIICTYTDPNNYYFYWYKKELGAGLQLLMSVLSSVDRKEGQGLIVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V235 trav AABR07017902.1 29892 GNSAQSVDQPDAHITVSEGASLELRCSYSYSATPSLFWYVQYPGQSLQLLLKYITGDTIVKSTNGFEAEFRKSNSSFNLKKSPAHWRDSAKYYCALR
Rattus norvegicus V237 trav AABR07017902.1 92590 VSGQANTVVQSPSVLSVWEKETAIINCTYTNTATNYFPWYKKEERKGFTLLTDIRSNVNRKKEGRFEVILDTNVKRVSLHITASRTEDSALYLCAP
Rattus norvegicus V238 trav AABR07017902.1 111765 IAGDAKTTQPDSVESTEEETVHLPCSHATISGNEYIHWYRQVPLQSPEYVIHGLQQNTSNSMAFLAIASDRKSSTLILPRVSLRDAAVYHCILRV
Rattus norvegicus V239 trav AABR07017902.1 120310 VNTQKLQQSPQSLTIQEGDELTMSCNSSSSLYALHWYRQGRDGGPIFLVTLQKGGDEKRKDKITAKLDKKMRQSFLSIQASQPSYAGTYLCAGS
Rattus norvegicus V241 trav AABR07017905.1 18393 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRGQVTLIIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQLGDAATYFCALMG
Rattus norvegicus V242 trav AABR07017905.1 30435 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRRQVTLVIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQPGDAATYFCALME
Rattus norvegicus V243 trav AABR07017905.1 53005 LRGEKTVQQNPLFLGTWEGRNSTIFCNYSSSATDRLLWYRQVVGESLEFLFALLSNGAVKRDRRLTASLDQKARISTLHFSGLQHSHSAIYFCAVG
Rattus norvegicus V244 trdv AABR07017907.1 68687 TSLDVILEPVAKTFTVIAGNPATFYCTVTGGDLKNYQMSWYKKSENNALFLVYKLNNNSTDDPMGNFKGKINISKSQFILDIQKATMKDAGVYYCGSD
Rattus norvegicus V304 trgv AABR07027871.1 70877 RQTSSYLEERIMSITRPVGSSVIITCDIHGNDNYIHWYRFQKGQDPQHLLYYNSISSTTVVDSRLDPEKYHVYEGTDRRYKFVLRNVEESDSALYYCATWA
Rattus norvegicus V305 trgv AABR07027871.1 76620 GRGKLEQPEISISRARDETAEISCKVFVESFQSVAIHWYRQKPNQGLEFLLYVLATPTETFLNKKYKKMKASKNSSASTSILTIYSLEEEDEAIYYCSYG
Rattus norvegicus V306 trgv AABR07027871.1 82089 LGGSILTSPLVSYVIKRKGNTAFLKCQIKTSALKPNTYIHWYRQKPGQPLQRMLCSSSSENTVYEKGFSEERFEARTWQNDLPSVLRIHQVTEDDMGTYYCACWD
Rattus norvegicus V307 trgv AABR07027871.1 83913 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYKLKEGEPLKRIFYGSAKAYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Rattus norvegicus V308 trgv AABR07027872.1 29595 GLGQLKQTKMSVTKATGQSAQIPCIVSVPDFGTTPIHWYRQKTNQQIEYLIFVSTGYNQRPLDGKYKKIEARKDFQTSTSNLTLNYLKKEDEATYYCALWA
Rattus norvegicus V366 igkv AABR07034718.1 3536 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V367 igkv AABR07034718.1 14882 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V368 igkv AABR07034718.1 40071 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V369 igkv AABR07034719.1 13090 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V370 iglv AABR07034730.1 23034 AISQAVVTQESALTTLPGGTVTLTCHSSTGAVTTSNYANWIQEKADHLFTGIVGDTSNRAPGAPARFSGSLLEGKAALTITGAQIEDEATYFCSLWYSNH
Rattus norvegicus V371 iglv AABR07034730.1 61083 SYGQFTLTQPKSVSGSLRSTITIPCERSSGDIGDSYVSWYQQHLGRPPINVIYADDQRPSEVSDRFSGSIDSSSNSASLTITNLQMDDEADYFCQSYDSNIDI
Rattus norvegicus V372 iglv AABR07034730.1 100991 SCAQAVLTQPNSVSTSLGSTVKLSCTLSSGNIENNYVHWYQQYEGRSPTTMIYNDDKRPDGVPDRFSGSIDSSSNSAFLTINNVEIEDEAIYFCHSYVSSI
Rattus norvegicus V373 iglv AABR07034730.1 125187 SCAQFVLTQPNSVSTNLGSTVKLSCKRSTGNIGSNYVNWYQQHEGRSPTTMIYRDDKRPDGVPDRFSGSIDRSSNSALLTINNVQTEDEADYFCQSYSSGI
Rattus norvegicus V374 iglv AABR07034736.1 32875 SVTSYELIQPPSASVTLGNTVSLTCVGDELPKRYAYWYQQKPDQSIVRVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCHSTYSDDKL
Rattus norvegicus V375 iglv AABR07034736.1 78229 SVTSYELIQPPSASVTLGNTVSITCSGDELPKRYAYWYQQKPDKSIVRVIYKDSERPSGISDRFSGSSSGTTATLTIRDTQAEDEADYYCHSTYSDDKL
Rattus norvegicus V376 iglv AABR07034737.1 23684 SVTSYELIQPPSASVTLENTVSITCSGDELSNKYAHWYQQKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILTIRDAQAEDEADYYCLSTYSDDDL
Rattus norvegicus V408 igkv AABR07040284.1 32936 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V409 igkv AABR07040285.1 42776 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V410 igkv AABR07040288.1 24443 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V411 igkv AABR07040288.1 52381 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V420 igkv AABR07042681.1 46162 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V446 trav AABR07046563.1 679 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V475 igkv AABR07051532.1 29006 ADGDIVMTQSPTSMSISVGDRVTMNCKASQNVGSNVDWYQQKTGQSPKLLIYKASNRYTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQSNSYP
Rattus norvegicus V476 igkv AABR07051533.1 18428 STWNIVLTQSPASLAVILGQKATISCTASESVNKFGINLMHWYQQKPGQLPKILIYNEFSRAPGIPARFSGDEAELNFTLTIEPVEADDVATYYCQQGLTFP
Rattus norvegicus V477 igkv AABR07051533.1 44462 ADGDTVMTQSPASMSTSVGERVTVNCKASQSVGTVVAWFQQKPGQSPKRLIYLATNRHTGVPDRFTGSGFGRDFTLTISNVEAEDLAVYYCLQYDSIP
Rattus norvegicus V478 igkv AABR07051534.1 3404 SNGQITLTQQAESLWISPGERVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASVRTDGVPTRFIGSGSGTEFTLSIEHVQPEDFAIYYCLQ
Rattus norvegicus V479 igkv AABR07051534.1 25642 STGDIVLTQSPALAVSLGQRATISCRASQSVSTSSYNLMHWYQQKPGEQPKLLIYDASNLASGIPVRFSGSGSGTDFTLTINPVQADDIATYYCQQSRELP
Rattus norvegicus V480 igkv AABR07051536.1 16613 VYGNTVMTQSPTSMFTSVGDRVTMSCKASQNVGINVGWYQQKTGQSPKRLIYWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHNSYP
Rattus norvegicus V481 igkv AABR07051537.1 9870 TCGDILINQSPASLTVSAGEKVTMSCKSSQSLLYSENNQDYLAWYQQKPGQFPKLLIYGASNRHTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCEQTYSYP
Rattus norvegicus V482 igkv AABR07051548.1 3090 TCGDIVMTQSPFSLAVSEGEMVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYYASTRQSGVPDRFIGSGSGTDFTLTISDVQAEDLADYYCLQHYSYP
Rattus norvegicus V483 igkv AABR07051550.1 17025 TCGDIVMTQSPSSLAVSAGDKVTMSCKSSQSLLSSEYQGNYLSWFQQKPGQSPKLLISLASTRETGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYSYP
Rattus norvegicus V484 igkv AABR07051551.1 24983 STGDTVLTQSPALAVSPGERVTISCRASESVSTGMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNDP
Rattus norvegicus V485 igkv AABR07051552.1 8627 ADGNIVMTQSPKSMSISVGDRVTMNCKASQNVYNNIAWYQQKPGQSPKLLIYYASNRYNGVPDRFTGSGYGTDFTLTINSVQAEDAAFYYCQRIYNSP
Rattus norvegicus V486 igkv AABR07051555.1 50653 TCGDIAITQSPSSVAVSVGETVTLSCKSSQSLLYSENNKDYLAWYQQKPGQTPKPLIYWATNRHTGVPDRFTGSGSGTDFTLIISSVQAEDLADYYCEQYFVYP
Rattus norvegicus V487 igkv AABR07051556.1 12200 VYGNTVMTQSPTSMFTSVGDRVTMSCKASQNVGINVGWYQQKTGQSPKRLIYWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHNSYP
Rattus norvegicus V488 igkv AABR07051563.1 13395 TCGDIVMTQTPSSQAVSAGEKVTMSCKSSQSLLYSENKKNYLAWYQQKPGQSPKLLISWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYDTP
Rattus norvegicus V489 igkv AABR07051564.1 3622 STGDTVLTQSPALAVSLGQRVTISCRASKSVSTYMHWYQQKSGQQPKLLIYSASNLESGVPSRFSGSGSGTDFTLTIDPVEADDIANYYCQQSNELP
Rattus norvegicus V490 igkv AABR07051565.1 34063 STGDIVLTQSPALAVSLGQRATISCRASESVRSSMHWYQQKSGQQPKLLIYGASNLASGVPARFSGSGSGTDFTFTIDPVEADDIATYYCQQSRNDP
Rattus norvegicus V491 igkv AABR07051578.1 5568 ANANVMMTQSPTSLAVSAGEMVSLSCKSSENLYSSTYKENYLAWYQKKSGQSPKLLIFYASHRASGVPDRFIGSGSGTDFTLTIRSMQAEDTADYYCARHYSSL
Rattus norvegicus V492 igkv AABR07051578.1 59301 TKGDVVLTQTPSTLSATIGQSVSISCRSSQSLLDSAGNTYLYWYLQRPGQSPQLLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V493 igkv AABR07051580.1 6905 TKGDVVLTQTPSILSATIGQSVSISCRSSQSLLDSDGNTYLYWFLQRPGQSPQRLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V494 igkv AABR07051582.1 19653 SKGDVVLTQSPATLSVTPGERISLSCRASESVDTYLHWYQQKPNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINGVELEDLSIYYCQQGNSLP
Rattus norvegicus V495 igkv AABR07051583.1 11570 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLDSDGDTYLNWLLQRPGQSPQLLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V496 igkv AABR07051589.1 15578 AQCDIHMTQNPVSLSAFIGDKVTITCWASQDISRYLGWYQQKQGQSPKFLMYYASNLLSVVPSRFSGSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V497 igkv AABR07051592.1 1336 GICDIQMTQSPASLSASLGETVTIECLASEDIYSNLAWYQQKPGKSPQLLIYDASSLQDGVPSRFSGSESGTQYSLEINSLQSEDAATYFCQQHHDYP
Rattus norvegicus V498 igkv AABR07051592.1 19799 GICDIQMTQSPASLSASLGETISIECRASEDIYSNLAWYQQKSGKSPQLLIYAANRLQDGVPSRFSGSGSGTQYSLKISGMQPEDEGDYFCLQGSKFP
Rattus norvegicus V499 igkv AABR07051608.1 36707 AICDIQMTQSPASLSASLGETVTIECRASEDIYNGLAWYQQKPGKSPQLLIYNANSLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQQYYDYP
Rattus norvegicus V500 igkv AABR07051611.1 7312 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRPGQPPQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQSTHAP
Rattus norvegicus V501 igkv AABR07051613.1 24867 SDVTGETTQSPASLSFSLGETATMTCRASDSVGSYLAWYQQKTGQVPRLLIHTASTRASGVPARFSGSGSGTDFTLTVSSLESEDVAIYYCQPYKNWS
Rattus norvegicus V502 igkv AABR07051614.1 2789 AQCDIHMTQNPVSLSAFIGDKVTITCRASQDISRYLGWYQQKQGQSPKFLMYYASNLLSGVPSRFSDSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V503 igkv AABR07051622.1 41260 SRGNIVLTQSPATLSVTPGESVSLSCRASQSISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSIYYCQQSYSSL
Rattus norvegicus V504 igkv AABR07051622.1 58270 AICDIRMTQSPASLSASLGETVNIECLASEDIYSDLAWYQQKPGKSPQLLIYNANSLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQYNNYP
Rattus norvegicus V505 igkv AABR07051626.1 36384 AICDIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKINSLESEDAATYFCLQDSEYP
Rattus norvegicus V506 igkv AABR07051626.1 110005 SRGDIVLTQSPTTLSVTPGETVSLSCRASHSIGTNLHWYQQKTNESPRLLIKYASQSISGIPSRFSASGSGTDFTLNINNVEFDDVSSYFCQQTQSWP
Rattus norvegicus V507 igkv AABR07051626.1 135187 ARCDIQMTQSPASLSASLGETVTIECLASEDIYDILAWYQQKPGKSPQLLIYDASSLHTGVPSRFSGSGSGTQYSLKINSLQPEDFASYYCQNGLSAP
Rattus norvegicus V508 igkv AABR07051632.1 6398 AICDIQMTQSPPSLSASLGETISIECLASEGIYSNLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQFSLKISSMQPEDEADYFCQQSYKFP
Rattus norvegicus V509 igkv AABR07051638.1 3697 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLHWLLQRPGQSLQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQGTHAP
Rattus norvegicus V510 igkv AABR07051638.1 36483 SDVTGETTQSPASLSFSLGETATMTCRASDSVGSYLAWYQQKTGQVPRLLIHTASTRASGVPARFSGSGSGTDFTLTVSSLESEDVAIYYCQPYKNWS
Rattus norvegicus V511 igkv AABR07051639.1 6823 SRGNIVLTQSPATLSVTPGESVSLSCRASQSISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSIYYCQQSYSSL
Rattus norvegicus V512 igkv AABR07051639.1 30443 AICDIRMTQSPASLSASLGETVNIECLASEDIYSDLAWYQQKPGKSPQLLIYNANSLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQYNNYP
Rattus norvegicus V513 igkv AABR07051639.1 66882 AICDIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKINSLESEDAATYFCLQDSEYP
Rattus norvegicus V514 igkv AABR07051642.1 1625 SRGDIVLTQSPATLFVTPGERISLSCRSSQNIGTNIHWYQEKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVEPEDFSVYYCQQSNSC
Rattus norvegicus V515 igkv AABR07051642.1 23033 AIRDIQMTQSPASLSASLGETVTIQCRASEDIYSGLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQYSLKISSMQTEDEGVYFCQQGLKYP
Rattus norvegicus V516 igkv AABR07051646.1 34436 TNGDVVLTQTPPTLLATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRTGQSPQPLIYLVSKLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQFTHYP
Rattus norvegicus V517 igkv AABR07051652.1 16782 AICDIQMTQSPHSLSASLGETVSIECLASEGISNYLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKISNMQPEDEGVYYCQQGYKYP
Rattus norvegicus V518 igkv AABR07051654.1 31061 IVSSGEIVLTQSPTTMAASPGEKVTLTCLASSSVNYMYWYQQKSSASPKLLIYYTSSLASGVPDRFSGSGSGTSYSLTISSMEAEDAAIYYCLQLTST
Rattus norvegicus V519 igkv AABR07051658.1 14652 IVSSGETVLTQSPTTTAASPGEKVTITCRASSSVSYMHWYQQKSGASPKLWIYDTSNRASGVPNCFSGSGSGTSYSLTISSMETEDAATYYCQQWSSN
Rattus norvegicus V520 igkv AABR07051659.1 9812 SSGEIVLTQSPTTMAASLGEKVTITCSASSSVNYMHWYQQKSGTSPKLLIYYTSSLASGVPDRFSGSGSGTTYLLRISTMETEDAATYYCQYWSSSQ
Rattus norvegicus V521 igkv AABR07051659.1 28372 SSGEIVLTQSPTTMAASPGEKVTLNCLASSSVSYMNWYQQKSGASPKLWIYGTSNLASGVPNRFSGSGSGTSYSLTISSMEAEDVATYYCLQLSSY
Rattus norvegicus V522 igkv AABR07051665.1 8787 IVSSGEIVLTQSPTTTAASPGEKVTITCLASSSVSNMYWYQQKSGASPKLLIYSTSSLASGVPDRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSN
Rattus norvegicus V523 igkv AABR07051670.1 5777 TVSSGEIVLTQSPTTMAASPGEKVTLTCHASSSVSYMHWYQQRSGASPKLWIYETSKLASGVPNRFSGSGSGTSYSLTINSMETEDAATYYCQQGSSY
Rattus norvegicus V524 igkv AABR07051671.1 16924 SSGEIVLTQSPITMAASPGEKVTITCRASSSVSYMYWYQQKSGASSKLWIYDTSKLASGVPDRFSGSGSGTSYSLTISSVETEDAATYYCQQWSST
Rattus norvegicus V525 igkv AABR07051673.1 7765 LVSSREIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQMSNASPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCST
Rattus norvegicus V526 igkv AABR07051675.1 6473 LVSSREIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQMSNASPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCST
Rattus norvegicus V527 igkv AABR07051680.1 8103 IVSNGEIVLIQSLTTMTASPGEKVTITCSGSSSVRYMYWYQQKSGASPKLCIYDTSNLASGVSDRFSGSGSGTSYYLTISTIEAEDAATYYCQQWSSNQ
Rattus norvegicus V528 igkv AABR07051680.1 23352 SSGEIILTQSPTIMAASLGEKITITCSASSSLSYMYWYQQKSGASPKLWVHRTSNLASGVPDRFSGSGSGTSYYLTISTMEAEDAATYFCHQWSSSQ
Rattus norvegicus V529 igkv AABR07051684.1 26550 SRGDIVLTQSPATLSVTPGESVSLSCRASQGISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSVYYCQQSYSLP
Rattus norvegicus V530 igkv AABR07051684.1 48746 AICDIQMTQSPASLSASLGETVSIECLASEGISNDLAWYQQKSGKSPQLLIYAASRLQDGVPSRFSGSGSGTRYSLKISGMQPEDEADYFCQQSYKYP
Rattus norvegicus V531 igkv AABR07051689.1 12581 TVSSGEIVLTQSPTTIAASPGEKVTITCRASSSVSYMYWYQQKSGASPKLWIYDTSKLASGVPNRFSGSGSGTSYSLTINTMETEDAATYYCQQWSST
Rattus norvegicus V532 igkv AABR07051692.1 37908 TVSSGEIVLTQSPTTMAASPGEKVTITCHASSSVSYMHWYQQKPGASPKPWIYATSTLASGVPDRFSGSGSGTSYSLTINNVEAEDAATYYCQQWNY
Rattus norvegicus V533 igkv AABR07051700.1 7877 IVSSGEIVLTQSPTTMAASPGEKVTITCRASSSVSYMHWFQQKSGTSPKPWIYDTSKLASGVPDRFSGSGSGTSYSLTISSMEAEDAATYYCLQRSSY
Rattus norvegicus V534 igkv AABR07051700.1 22881 IVFSGEIVLTQSPTTMAESPGEKVTITCSASSSVSYMHWYQQKTGTSHKLLIYKTYTLASGVPHHFHGTGSGTSYSLTIITMETKDVSTYYCKQWSSN
Rattus norvegicus V535 igkv AABR07051701.1 4931 SKGEIVLTQSPVSITASQGEKVTITCRASSSISSNYLHWYQQKAGSYPKLLIYRTSILASGFPDSFSGSGSDTSYTLTISCMQDEVAASYYCQQGSSS
Rattus norvegicus V536 igkv AABR07051704.1 45573 SRGDVVLVTQTPSSLPVSLGDQASISCKSSKSLVHNNGITYLAWFLQKPGQLPQSLIHTVSNRFSGVPDRFSGSGSVSDFTLKISRVEPEDLGVYYCLQYVHYP
Rattus norvegicus V537 igkv AABR07051707.1 8367 SSGAIVLNQSPSSIVASQGEKVTITCRASSSISSNYLHWYQQKPGAFPKLVIYSTSYRASGVPSRFSGSGSGTSYSFTISRVEAEDVATYYCQQGSSN
Rattus norvegicus V538 igkv AABR07051708.1 7234 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPRQLIHYTSTLVSGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLP
Rattus norvegicus V539 igkv AABR07051708.1 46819 ARCDIQMTQTPSSMPASLGERVTISCRASQGISNYLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQYDSSP
Rattus norvegicus V540 igkv AABR07051712.1 62106 SRGDVVLVTQTPSSLPVSLGDQASISCKSSKSLVHNNGITYLAWFLQKPGQLPQSLIHTVSNRFSGVPDRFSGSGSVSDFTLKISRVEPEDLGVYYCLQYVHYP
Rattus norvegicus V541 igkv AABR07051716.1 25753 ARCDIQLTQSPSTLPASLGERVTISCRASQSISNSLNWYQQKPDGTVKRLIYSTSTLESGVPSRFSGSGSGTDYSLSISSLESEDFAMYYCLQYATY
Rattus norvegicus V542 igkv AABR07051716.1 34161 STGDVVMTQTPVSLSVSLGNQASISCRSSQSLFHSDGNTYLSWYLQKPGQSPQLLIYLASNRFSGVSNRFSGSGSGTDFTLKISRVEPEDLGVYYCFQH
Rattus norvegicus V543 igkv AABR07051726.1 6645 SRGDVVMTQTPLSLPISLGDQASFSCRSSQSLLHSNGNTYLAWYLQKSGQSPQILIYRISNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQH
Rattus norvegicus V544 igkv AABR07051728.1 44999 SSGAIVLNQSPSSIVASQGEKVTITCRASSSISSNYLHWYQQKPGAFPKLVIYSTSYRASGVPSRFSGSGSGTSYSFTISRVEAEDVATYYCQQGSSN
Rattus norvegicus V545 igkv AABR07051728.1 86239 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPRQLIHYTSTLVSGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNSP
Rattus norvegicus V546 igkv AABR07051730.1 29381 ARCDIQMTQSPSSLPASLGERVTISCRASQGISNNLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQDASFP
Rattus norvegicus V547 igkv AABR07051731.1 13728 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNYLSWYQQKPGKSPQLLIHSATSLADGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQHYSAP
Rattus norvegicus V548 igkv AABR07051731.1 32798 GKCDIQMTQSPASLSASLDEIVTITCQASLDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKICKLQVEDTGIYYCLQHYSAP
Rattus norvegicus V549 igkv AABR07051735.1 18259 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKRLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDFATYFCLQHNSF
Rattus norvegicus V550 igkv AABR07051737.1 10380 MRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V551 igkv AABR07051737.1 39322 GKCDIQVTQSPASLSASPEEIVTITCQASQDIGSSLLWYQQKPGKSPQLLIYSATILADGVPSRFSGSRSGTQYSLKISRLQVEDIGTYYCLQVSSSP
Rattus norvegicus V552 igkv AABR07051741.1 14817 MRCDIQMTQSPSLLSASVGDRVTLSCKASQSIYNSLAWYQQKLGEAPKLLIYKTNSLQTGIPSSFSGSGSGTDYTLTISSLQPEDVATYFCQKYNSG
Rattus norvegicus V553 igkv AABR07051744.1 743 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCLQHSSR
Rattus norvegicus V610 trbv AABR07060350.1 175506 HTGPNVQQIPSHQVIDIGQTVILSCDPVSNHLYFYWYKQILGQQMEFLVSFFDGKIGEKSKLFKDEFLVDRQHGSYFTLKIQRTTLEDSAVYFCASSL
Rattus norvegicus V611 trbv AABR07060350.1 183573 PLETAVFQTPKHRVAQVGSEVFFKCDQTLGHDTMYWYKQDSKQLLKVMFSYNNKQRILNETASSRFLPQSSDKAHLNLRIKSVEPGDSAVYLCASS
Rattus norvegicus V612 trbv AABR07060352.1 58835 PANSGVVQSPRHIIKEKGGRSILKCIPISGHRSVAWYQQTQGQELTFLIQKYEQMDRGKGNLPSRFSVQQFSDYHSEMNMSALELEDSAVYFCASS
Rattus norvegicus V613 trbv AABR07060352.1 62698 HMEAAVTQSPRNKVTLKGGKVTLSCKQNNNHNNMFWYRQDMGHGLRLIHYSYDVNSTEKGDVPNGYKVSRPSQGDFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V614 trbv AABR07060352.1 66298 SAHSGVVQSPRHIIKEKGGRSILKCIPISEHNNVAWYQQTHGQELKFLIRHYEKSEREKGNLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Rattus norvegicus V615 trbv AABR07060352.1 69903 HMEAAVTQSPRNKVTLKGGKVTLSCKQNNNHNNMFWYRQDMGHGLRLIHYSYDVNSTEKGDVPNGYKVSRPSQGDFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V616 trbv AABR07060352.1 78359 HMEAAVTQSPRNRVAVTGGEVTLSCRQTNNHDYMYWYRQNMGDELRLIHYSYDVNRTEKGDVSSGYKASRPSQEDFSLILESASLSQTAVYFCASSD
Rattus norvegicus V617 trbv AABR07060353.1 5938 LSETGVTQSPRYAIIQESQTVSFWCDPVSGHERLYWYQQHRAQGPRLLVYFQNEVDIDKSQLPKDRFFAVRTEGVNSTLKIQSAKQSDSATYLCASSL
Rattus norvegicus V618 trbv AABR07060353.1 10989 NADAGVTQTPRHEVAEKGQTIILTCEPVSGHNDLFWYRQTKIKGLELLSYFLNKSPMEDAGALKDRFTAEIQDSSISTLKIQPTEPQDSAVYLCASSL
Rattus norvegicus V619 trbv AABR07060353.1 22276 PTNAGVIQTPRHKVTGKGQEVTLRCEPISGHSAVFWYRQSTVKGLELLIYFNNQAPIDDSGMPKERFSAQMPNQRLSTLKIQTTQPQDSAVYLCASSL
Rattus norvegicus V620 trbv AABR07060353.1 30792 FVDTMVMQNPRYKVARVGKPVNLICSQTMDHDSMFWYQQKPNQGPKLLLYYYDSNLNRETDTSDNFQSSRHNTSFCSLNITSAGLGDSAMYLCASSR
Rattus norvegicus V621 trbv AABR07060353.1 43900 TTHGGAITQTPKFLIGHEGQELTLKCKQNFNHDSMFWYRQDPGKGLRLIYYSITESDLQKGDLSEGYDASRKEKASFSLTVKSAQKRQMAVYLCASSI
Rattus norvegicus V623 trbv AABR07060353.1 64105 SMDSGVIQSPRHLVKGKEQKARMQCTPIKEHSYVYWYYKKLGEDLKFLVYFQNTDIMDKTDMIKKIISAECFTNKTCTIEIKSSKLTDSAVYYCASSQ
Rattus norvegicus V624 trbv AABR07060353.1 80176 SLDCQVIQTPQHLLRGKGQKAKMTCIAEKGHTFVYWYQQKQNKELKFLIYFQRQEPRDSIDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Rattus norvegicus V625 trbv AABR07060353.1 83486 SFDAAVIQTPRHLIKMKGQQVEMNCNPEKDHPAVFWYQQKQSKELKFLIYFQNQRPVDQIDMVKERFSAEWPSNSLCSLKISTSEVEDSALYLCSSSQ
Rattus norvegicus V626 trbv AABR07060353.1 85642 SFVAEVTQTPRYLIKEKGQRVNMSCSPEKAHTAFYWYQQNQKKELTFLINFRKVDIIDQTDLVKKRFSAQCVPDLHCTLEIPSSEEGDSALYFCASSL
Rattus norvegicus V628 trbv AABR07060386.1 2735 LVDMNVTQMPRNLIKRVGKNVLLECVQDMKHERMYWYRQDPDLGLRLIYLSYDVDSNSEGDIHKGYKVSRKKRENFSLILESAKTNHTSVYFCASSL
Rattus norvegicus V629 trbv AABR07060386.1 8204 SVFSVFLYQKPNRDICQSGTSLKIQCVVDSQVALMFWYQQFQGQNLMLMATANEGSEATYESGFSREKFPISRPNLTFSTLTVNNARPEDSSVYFCSSG
Rattus norvegicus V630 igkv AABR07060784.1 1918 ARCDIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRPMIYYATNLANGVPSRFSGSRSGSDYSLTISSLESEDMADYHCLQYKQYP
Rattus norvegicus V631 igkv AABR07060784.1 6609 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLLGTSGKTFLNWILQRPGQSPKRLIYQVSKLYSEVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQG
Rattus norvegicus V632 igkv AABR07060786.1 6298 ARCDIQMTQAPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMADYYCVQSKESP
Rattus norvegicus V633 igkv AABR07060788.1 12057 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V634 igkv AABR07060789.1 149 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V635 igkv AABR07060790.1 1891 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V636 igkv AABR07060792.1 37930 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDYSLTINSLESEDMAIYYCLQHNEYP
Rattus norvegicus V637 igkv AABR07060793.1 12414 ARCDIQMTQSPSSMSVSLGDRVTITCRASQDIGNYLSWYQQKPEKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLESEDTGIYFCLQHKQYP
Rattus norvegicus V638 igkv AABR07060795.1 36765 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V639 igkv AABR07060881.1 2830 ADGNTVMTQSPTSMFISVGDRVTMNCKASQNVGTNVDWYQQKTGQSPKLLIYGASNRYTGVPDRFTGSGSGTDFTLTISNMQAEDLAVYYCLQYNYNP
Rattus norvegicus V640 igkv AABR07060883.1 1007 STGDIVLTQSPALAVSLGQRATISCRASQSVSISRYNLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTINPVQADDIATYYCQQSRESP
Rattus norvegicus V642 igkv AABR07060944.1 25143 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V644 igkv AABR07060953.1 2433 ARGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGRSPKRLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCAQT
Rattus norvegicus V645 igkv AABR07060957.1 29478 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V646 igkv AABR07060958.1 42776 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V647 igkv AABR07060962.1 24443 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V648 igkv AABR07060962.1 52381 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V649 igkv AABR07060963.1 7986 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V650 igkv AABR07060963.1 30457 ARCDIQMTQSPSSMSVSLGDTVTITCRASQDVGIYVNWFQQKPGKSPRHMIYRATNLADGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQYDEYP
Rattus norvegicus V651 igkv AABR07060963.1 57100 THSDIVMTQTPLSLSVAIGQSASISCKSSQSLKYSDGKTYLNWVFQSPGQSPKRLIYQVSKLDSGVPDRFSGTGSETDFTLKISRVEAEDLGVYYCCQVHIL
Rattus norvegicus V652 igkv AABR07060963.1 97019 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V653 igkv AABR07060971.1 3221 TRGDVVMTHTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGQSPKLLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCVQATHFP
Rattus norvegicus V654 igkv AABR07060979.1 13008 ARCDVHMTQSPSSMSASLGDKVTPTCWASQNISRYLSWLQQQPRKSPKVLIYGATILEDWVPSKFSGSGSRADYSFTISNLVSEDFGTYYCLQYLHF
Rattus norvegicus V655 igkv AABR07060980.1 2513 ARCDIQVTQSPSSLLASLGERVTITCQTSQSISNNLNWYQQKPGQAPMLLIYYATSLQTGMPSRFSGQYSGRSFTLTITSLEPEDIANYFCLQHYSA
Rattus norvegicus V656 igkv AABR07060992.1 20379 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V657 igkv AABR07060992.1 49098 SRSDVVLTQTLVAQPVRLGDQASISCRSSQSLVLTDGHTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGSDFTLKISRVEPEDLGVYYCFEG
Rattus norvegicus V658 igkv AABR07060994.1 40566 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V659 igkv AABR07060995.1 32088 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V660 igkv AABR07061001.1 3115 IQCDVQMTQSPYNLAASPGESVSINCKASKSISKYLAWYQQKPGKANKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRSLEPEDFGLYYCQQHNEY
Rattus norvegicus V661 igkv AABR07061003.1 32402 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V662 igkv AABR07061005.1 21925 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V663 igkv AABR07061005.1 43427 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHRSRIS
Rattus norvegicus V664 igkv AABR07061022.1 1522 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V665 igkv AABR07061022.1 12288 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V666 igkv AABR07061022.1 37478 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V667 igkv AABR07061022.1 83214 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDYSLTINSLESEDMAIYYCLQHNEYP
Rattus norvegicus V668 igkv AABR07061027.1 6674 MRCDIQMTQSPSFLSASVGDRVTLSCKASQNINKYLAWYQQKLGEAPKLLIYNANSLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSW
Rattus norvegicus V669 igkv AABR07061068.1 20379 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V670 igkv AABR07061068.1 49098 SRSDVVLTQTLVAQPVRLGDQASISCRSSQSLVLTDGHTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGSDFTLKISRVEPEDLGVYYCFEG
Rattus norvegicus V671 igkv AABR07061131.1 4611 SRGDVVMTQTPVSLPVSLGSQVSITCRSSHSLVYSDGNTYLSWYLQKPGQDPQPLIYKVSNRFSGVPDRFSGSRSGSYFTLKISRGEPEDLGVYYCGQR
Rattus norvegicus V672 igkv AABR07061134.1 5566 AQCDVQMTQSPSYLAASPGESVSISCKASKSISNYLAWYQQKPGEANKLLIYSGSTLQSGTPSRFSGSGSGTDFTLTIRNLEPEDFAVYYCQQYYEK
Rattus norvegicus V673 igkv AABR07061136.1 3777 ARCDIKMTQSPSSLSASLGERVTISCRASENINNILAWYQKKEDGSVKLLIYYTSNLQSGVPSRFSGSGSGKDYSLTISGLESEDIATYYCQQGYT
Rattus norvegicus V711 ighv AABR07065673.1 10359 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V712 ighv AABR07065676.1 5222 LLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAIYFCTR
Rattus norvegicus V713 ighv AABR07065679.1 468 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V714 ighv AABR07065680.1 4761 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V715 ighv AABR07065684.1 15261 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V716 ighv AABR07065688.1 21404 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V717 ighv AABR07065693.1 41398 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V718 ighv AABR07065693.1 47531 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V719 ighv AABR07065693.1 64710 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V720 ighv AABR07065699.1 25396 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYDMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V721 ighv AABR07065699.1 61930 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V722 ighv AABR07065699.1 69786 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V723 ighv AABR07065699.1 90345 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V724 ighv AABR07065699.1 98623 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V734 igkv AABR07066919.1 4564 ATGDIMMTQSPLSVAVTPGESASISCRSSKSLLHSNGITYLSWYLQRPEKSPQLLIYQISNLASGVSGRFSGSGSGTDFTLKISRVETEDVGIYYCVQFLEVP
Rattus norvegicus V779 iglv AABR07072262.1 19742 SCAQFVLTQSNSMSTSLGSTVKLSCKRSTGNIGSSYVYWYQQHEGRSPTTMIYDDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQIEDEAIYFCQSYSSGI
Rattus norvegicus V780 iglv AABR07072262.1 35718 IYEDSKRLIQPPSASVTLGNTVSITCSGDELPKKYAQWYQQKPDQSIVTVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCQSAYSDDNL
Rattus norvegicus V781 iglv AABR07072262.1 48501 YVTSYELIQPPSASVTLGNTVSLTCVGDELSKRYAQWYQQKPDKTIVSVIYKDSERPSGISDRFSGSSSGTTATLTIHGTLAEDEADYYCLSTYSDDNL
Rattus norvegicus V793 trbv AABR07073006.1 20519 HTGPNVQQIPSHQVIDIGQTVILSCDPVSNHLYFYWYKQILGQQMEFLVSFFDGKIGEKSKLFKDEFLVDRQHGSYFTLKIQRTTLEDSAVYFCASSL
Rattus norvegicus V794 trbv AABR07073007.1 1866 LVDMNVTQMPRNLIKRVGKNVLLECVQDMKHERMYWYRQDPDLGLRLIYLSYDVDSNSEGDIHKGYKVSRKKRENFSLILESAKTNHTSVYFCASSL
Rattus norvegicus V818 igkv AABR07003833.1 120420 ARCDIQMTQSPSSMSVSLGDTVTITCRASQDVGIYVNWFQQKPGKSPRHMIYRATNLADGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQYDEYP
Rattus norvegicus V819 igkv AABR07003833.1 93777 THSDIVMTQTPLSLSVAIGQSASISCKSSQSLKYSDGKTYLNWVFQSPGQSPKRLIYQVSKLDSGVPDRFSGTGSETDFTLKISRVEAEDLGVYYCCQVHIL
Rattus norvegicus V820 igkv AABR07003833.1 53858 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V821 igkv AABR07003835.1 14651 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V822 igkv AABR07003837.1 9956 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V918 igkv AABR07016858.1 1119 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V923 trdv AABR07017613.1 1403 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V924 trav AABR07017617.1 57233 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V925 trav AABR07017617.1 47686 CVGESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V926 trav AABR07017617.1 37345 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V927 trav AABR07017617.1 33419 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V928 trav AABR07017617.1 30073 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V929 trdv AABR07017617.1 7084 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V930 trav AABR07017619.1 638 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V931 trav AABR07017622.1 9173 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V932 trav AABR07017622.1 1781 MNSQVAEENPWALRIHEGENVTVNCSYKTSIIALQWYRQDSGGGPALLVLICSNEREKHSGRLRATLDTSSQSSSLFITAAQSADTAVYFCATD
Rattus norvegicus V933 trav AABR07017623.1 14000 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V934 trav AABR07017623.1 3858 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V935 trav AABR07017624.1 22127 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDPNNYYFYWYKQEPGAGLQLLMEVFSSTEIKEGQGFIVLLNKNDKRLLLNITAAHLGDSAKYFCAVR
Rattus norvegicus V936 trav AABR07017624.1 12866 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V937 trav AABR07017624.1 2408 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V938 trdv AABR07017626.1 21438 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V939 trdv AABR07017626.1 15580 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V940 trdv AABR07017634.1 6769 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVEYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V941 trav AABR07017635.1 29952 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V942 trav AABR07017635.1 18252 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V943 trav AABR07017636.1 2215 ANSQRGEENLLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGGGPVLLMLIRSNEREKHIGRLRATLDTSSQSSSLSITAAQSADTAVYFCATN
Rattus norvegicus V944 trav AABR07017639.1 39270 VKGKQVQQSPVSLVLQEGEKAELQCNFSTALSNMQWFFQRPGGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V945 trav AABR07017639.1 23907 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V946 trav AABR07017639.1 18713 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V947 trav AABR07017639.1 2704 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGESLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V948 trav AABR07017644.1 1782 MSQGEQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPGKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V949 trav AABR07017647.1 12429 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V950 trav AABR07017649.1 31195 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKEQSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V951 trdv AABR07017649.1 19262 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGSYYLFWYKQLLSGEMVFLILQPSFDSQNQRRGRYSVIFQQSLKSISLVISASQPEDSGTYFCALWET
Rattus norvegicus V952 trav AABR07017649.1 6046 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V953 trav AABR07017650.1 863 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V954 trav AABR07017652.1 4497 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V955 trav AABR07017657.1 13893 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V957 trav AABR07017658.1 46916 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V958 trav AABR07017658.1 42989 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V959 trav AABR07017658.1 39643 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V960 trav AABR07017658.1 33460 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V961 trdv AABR07017658.1 18274 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V962 trav AABR07017659.1 1532 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V963 trav AABR07017662.1 42117 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V964 trav AABR07017662.1 30802 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V965 trav AABR07017662.1 22903 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V966 trav AABR07017662.1 5655 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V967 trav AABR07017662.1 316 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V968 trav AABR07017669.1 26336 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQHSGKGLELLVSIFSNGQKEEGRFTVHLNIARLQVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V969 trav AABR07017669.1 7609 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V970 trav AABR07017669.1 576 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V971 trav AABR07017670.1 2061 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V972 trav AABR07017676.1 25684 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V973 trav AABR07017676.1 4949 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V974 trav AABR07017677.1 4651 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V975 trdv AABR07017679.1 3570 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V976 trav AABR07017682.1 8519 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V977 trav AABR07017683.1 10170 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V978 trav AABR07017683.1 4035 MKGQQVQQSPVSLVLQEGEKADLECNFSTSIYQMQWFYQSPGGSLVSLFYNPSGTKQSGRLTSTTVTEESRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V979 trav AABR07017684.1 3365 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V980 trav AABR07017685.1 19500 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIAYPTLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V981 trav AABR07017685.1 16207 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFGNLRWYKQDTGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V982 trav AABR07017692.1 9739 MNSQVVEENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLGQDPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V983 trav AABR07017693.1 19160 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V984 trav AABR07017693.1 15016 VSSPAEGQQNPESLTVPEGGRTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPSDSALYLCAV
Rattus norvegicus V985 trav AABR07017693.1 5411 VSSQEKVQQSPESLIVPEGSIASLNCTYSDPNFLYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAHFSKASLHVSLHIRDSKPSDSALYFCAASE
Rattus norvegicus V986 trav AABR07017694.1 16568 VSRGEQVEQHLSHLSVREGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V987 trav AABR07017694.1 6924 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V988 trdv AABR07017701.1 12908 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSREMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALKEL
Rattus norvegicus V989 trav AABR07017705.1 338 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V990 trdv AABR07017714.1 32458 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V991 trav AABR07017714.1 9996 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V992 trdv AABR07017716.1 8318 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V993 trav AABR07017720.1 672 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V994 trdv AABR07017724.1 1596 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYHLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V996 trdv AABR07017909.1 22189 KNALCVTLTQSSLDQAVVSGSKVTLLCTFDGSSPNPDLFWYRKRPDGSFQFILYRDNSRSHDADFVQGRFSVKHSKADGTFHLVIAPVRLEDSATYYCALG
Rattus norvegicus V1020 trdv AABR07022402.1 906 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVTYYLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALREL
Rattus norvegicus V1039 igkv AABR07027447.1 70274 LNGDIVMTQGALPNPVPSGESASITCQSSKSLLHSNGKTYLNWYLQRPGQSPQFLIYWMSTRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDLEFP
Rattus norvegicus V1040 igkv AABR07027447.1 16391 TRCDIRMTQTPASLSASLGESVTITCRASQDIGKSLLWFQQKTGKPPKILIYTASNLVSGISPRFSGSGSGTQFSLKISSLKPEDTANYYCCQGYSLS
Rattus norvegicus V1041 igkv AABR07027450.1 52776 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSLVHNNGNTYLSWYLQKPGQSPQLLIYKVSNRFSGISDRFSGSGSGTDLTLKISRVEPDDLGVYYCGQG
Rattus norvegicus V1042 igkv AABR07027451.1 27185 SRGDVVMTQTPVSLPVSLGGQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGDYYCLQS
Rattus norvegicus V1043 igkv AABR07027457.1 39226 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V1044 igkv AABR07027457.1 17724 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHRSRIS
Rattus norvegicus V1045 igkv AABR07027458.1 9660 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V1049 igkv AABR07028049.1 11635 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1235 igkv AABR07051532.1 56419 STGDIVLTQSPVLAVSLGQRATISCRASQSVSISSINLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTIDPVQADDIAAYYCQQSRESP
Rattus norvegicus V1236 igkv AABR07051533.1 85644 ADGETVMTQSPTSMSTSIGERVTLNCKASQSVGINVDWYQQTPGQSPKLLIYGASNRHTGVPDRFTGSGFGRDFTLTISNMEAEDLAVYYCLQYGSIP
Rattus norvegicus V1237 igkv AABR07051533.1 3621 SNGQITLTQQAESLWVSPGEKVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASIRTDGVPTRFIGSGSGTEFTLSIEDVQPEDIALYYCLQTLKKP
Rattus norvegicus V1238 igkv AABR07051556.1 2273 STGDTVLTQSPALAVSPGERVTISCRASESVSTLMHWYQQKPGQQPTLLIYLASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYYCQQSWNDP
Rattus norvegicus V1239 igkv AABR07051562.1 27653 TCGDIVMTQSPSSLAVSAGETVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYLASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQHYSYP
Rattus norvegicus V1240 igkv AABR07051684.1 72655 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYEGSNLASGIPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V1241 igkv AABR07051718.1 16634 GRCAIQVTQSPTSLSASLGDRVTLTCRASQDINNKMAWYQQKPGEVPQLLIYYASTLQSGTPSRFSGSGAGTDFSFTISHLQSEDFATYYCLQGYSL
Rattus norvegicus V1242 igkv AABR07051728.1 14192 VRCDIQMTQSPSFLSASLGNSITITCHASQNIKGWLAWYQQKSGNAPELLIYKASSLQSGVPSRFSGSGSGTDYIFTISNLQPEDIATYYCQHYQSFP
Rattus norvegicus V1243 igkv AABR07051733.1 65053 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLSWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCLQAYSAP
Rattus norvegicus V1244 igkv AABR07051733.1 42608 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDPGIYYCLQGYSAP
Rattus norvegicus V1245 igkv AABR07051733.1 4282 GKCDIQMTQSPASLSASPEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYSATSLADGIPSRFSGSRSGTQYSLKISRLQVEDTGIYYCLQRYSNP
Rattus norvegicus V1246 igkv AABR07051746.1 24997 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCQQASSAP
Rattus norvegicus V1278 igkv AABR07056026.1 14827 SKGDVVLTQSPATLSVTPGERISLSCRASESVDTYLHWYQQKPNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINGVELEDLSIYYCQQGNSLP
Rattus norvegicus V1319 igkv AABR07060979.1 1418 TSGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVASDKNTYLNWLLQSPGRSPKRLIYQVSKLDSGVPDRFSGSGSEKDFTLKISRVEAEDLGVYYCLQG
Rattus norvegicus V1320 igkv AABR07061036.1 1119 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1321 igkv AABR07061039.1 5669 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V1322 igkv AABR07061044.1 1171 YRGDVVMTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQ
Rattus norvegicus V1323 igkv AABR07061048.1 1171 YRGDVVMTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQ
Rattus norvegicus V1324 igkv AABR07061052.1 59451 IQCDVQMTQSPYNLAASPGESVSINCKASKSISKYLAWYQQKPGKANKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRSLEPEDFGLYYCQQHNEY
Rattus norvegicus V1325 igkv AABR07061057.1 80224 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V1326 igkv AABR07061057.1 42319 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1327 igkv AABR07061072.1 23667 SRSDVVLTQTPVAMPVTLGDQASISCRSSQSLVYSDGNTYLEWYLQKPGQSPQLLIYEVSNQFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V1328 igkv AABR07061077.1 5470 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V1329 igkv AABR07061078.1 8785 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V1330 igkv AABR07061087.1 1708 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V1383 ighv AABR07065639.1 9559 VQCEVQLVESGGGLVQPRRSLKLSCAASGFTFINYGINWVHQTPEKILEWVAYISRASNDIYYADTMKGQFTISRDNAKNTLYLQLSSLRSEDTAFLYFCAG
Rattus norvegicus V1384 ighv AABR07065640.1 42718 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1385 ighv AABR07065640.1 25539 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1386 ighv AABR07065640.1 3241 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1387 ighv AABR07065641.1 353 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1388 ighv AABR07065643.1 13338 LLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAIYFCTR
Rattus norvegicus V1389 ighv AABR07065645.1 21821 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1390 ighv AABR07065645.1 6994 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1391 ighv AABR07065651.1 187227 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1392 ighv AABR07065651.1 179371 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1393 ighv AABR07065651.1 158812 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1394 ighv AABR07065651.1 150534 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1395 ighv AABR07065651.1 100129 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1396 ighv AABR07065651.1 93996 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1397 ighv AABR07065651.1 76817 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1398 ighv AABR07065651.1 54519 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1399 ighv AABR07065651.1 46466 VQCEVQLVESGGGLVQPGRSLKFSCAASGFTFSDYAMAWVRQAPKKGLEWVATIIYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1400 ighv AABR07065653.1 19908 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYYMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEETATYYCA
Rattus norvegicus V1401 ighv AABR07065656.1 221771 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1402 ighv AABR07065656.1 213915 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1403 ighv AABR07065656.1 193356 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1404 ighv AABR07065656.1 185078 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1405 ighv AABR07065656.1 134673 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1406 ighv AABR07065656.1 128540 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1407 ighv AABR07065656.1 111361 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1408 ighv AABR07065656.1 89063 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V1409 ighv AABR07065656.1 81010 VQCEVQLVESGGGLVQPGRSLKFSCAASGFTFSDYAMAWVRQAPKKGLEWVATIIYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1410 ighv AABR07065656.1 32530 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1411 ighv AABR07065665.1 566 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPTVKCLEWMGVIWSDGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTATYFCAI
Rattus norvegicus V1412 ighv AABR07065705.1 162156 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYDMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V1413 ighv AABR07065705.1 125622 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V1414 ighv AABR07065705.1 117766 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V1415 ighv AABR07065705.1 97207 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V1416 ighv AABR07065705.1 88929 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V1417 ighv AABR07065705.1 38524 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V1418 ighv AABR07065705.1 32391 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V1419 ighv AABR07065705.1 15212 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V1420 ighv AABR07065713.1 1631 VWCEVQLVESSEGLVQPRSSSLKLSCVASGFTFNKYDMCWVHQAPKKGLELVAIIYYGGGNKYYEDTVKGQFTISRENSKNTLYLEMSNLRSKDTAIYYCA
Rattus norvegicus V1421 ighv AABR07065719.1 2197 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSSFAMAWVRQAPKKGLEWVATITSGGSNTYYPDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAK
Rattus norvegicus V1422 ighv AABR07065740.1 36294 VLSQVQWKESGPDLVQPSQTLSLTCTLSGFSLAGYDLQWVQQLPGKGLKWMGGIWGDGSTAYNSLLKSQLSISRDTSKSLVFLKMNSLKTEGTAMYYCAREGS
Rattus norvegicus V1423 ighv AABR07065740.1 11808 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSCGVHWVRQPPGKGLEWIAAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLKTEDTVMYYCTR
Rattus norvegicus V1424 ighv AABR07065750.1 141887 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGVIWSGGNTDYNSALKPRLSISRDTSKSQVFLTMNSLQTEDTGIYYCNR
Rattus norvegicus V1425 ighv AABR07065750.1 129653 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V1426 ighv AABR07065750.1 114326 VQYEVKLVESGEGLVQPGRSLKLSCAGSGFTFDDYRMAWVCQAPKKGLEWLAAINRNGGSTYYPDTVKGQFTICRDNDKSALYLQMNDLISEDTSMYYCA
Rattus norvegicus V1427 ighv AABR07065750.1 104787 VQCEVKLVESGGGLVQPGSPLKLSCAASGFTFSSNWLNWIRQAPGKGLEWVASINPDGSSTLYPDTVKGRFVVSKDNAKNTRYLQMNNLRSEDTAMYYCAR
Rattus norvegicus V1428 ighv AABR07065750.1 36360 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPPGKGLEWMGVIWSNGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCAR
Rattus norvegicus V1429 ighv AABR07065750.1 28110 VQCEVQLVESGGGLVQPGRSLKLSCVASGFTFNNYWMTWIRQAPGKGLEWVASITNTGGSTYYPDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCTR
Rattus norvegicus V1430 ighv AABR07065752.1 32814 VQCEVQLVESGGGLVQPGSSLKVSCVASGFTFSSYVMHWFRQAPENGIEWLAFINTDSSNTHYAETVKGRVTISRDNAKNTVDMQLSSLRSEDTAMYYCARE
Rattus norvegicus V1431 ighv AABR07065753.1 2617 VLSQVQLKESGPGLLLSSETLSLTCTVSGFSLTSYDVSWVRQLPGKGLEWMGGVWIGGNTEYNSDLKSRLSISRDTSKSQVFLKMSNLKTEDTGTYYCAR
Rattus norvegicus V1432 ighv AABR07065766.1 3492 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V1433 ighv AABR07065768.1 82987 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSSYNMHWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V1434 ighv AABR07065768.1 37769 VLSQVQLKETGPGLVQPTQTLSITCTVSGFSLTSYYMQWVRQTPGKGLEWMGFIRSGGSTEYNSEFKSRLSISRDTSKNQVFLKMNSLKTEDTGVYYCAR
Rattus norvegicus V1436 ighv AABR07065768.1 4409 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGRMRYNGDTSYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTR
Rattus norvegicus V1437 ighv AABR07065772.1 125161 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPTVKCLEWMGVIWSDGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTATYFCAI
Rattus norvegicus V1438 ighv AABR07065772.1 117167 VQCEVQLVETGGGLVQPGRSLKLSCVASGFTFSSYWMYWIRQAPGKGLEWVSSINTDGGSTYYPDSVKGRFTISRDNAENTVYLQMNSLRSEDTATYYCAK
Rattus norvegicus V1439 ighv AABR07065772.1 116939 NAENTVYLQMNSLRSEDTATYYCAKDTCVASGFTFSSYWMYWIRQAPGKGLEWVSSINTDGGSTYYPDSVKGRFTISRDNAENTVYLQMNSLRSEDTATYYCAK
Rattus norvegicus V1440 ighv AABR07065772.1 83701 VLSQVQLKESGPGLMQPSETLSLTCTVSGFSLTSNGVGWVRQPLGKGLVWMGTIWAGGSTNYNSAVQSRLSISRDTSKSQVFLKMNSLQPEDTGTYYCA
Rattus norvegicus V1441 ighv AABR07065772.1 62391 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSNYGMNWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V1442 ighv AABR07065772.1 46999 ALSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVNWVRQPPGKGLEWMGTIWNDGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYLCAR
Rattus norvegicus V1443 ighv AABR07065773.1 61816 VQCAVQLVESGGGLVQPGKSLKLSCSASGFTFSSYGMHWIRQAPGKGLDWVAYISSSSGTVYADAVKERFTISRDNAKNTLYLQLNSLKSEDTAIYYCAR
Rattus norvegicus V1445 ighv AABR07065773.1 24084 VLSQVQMKETGPGLVQTTQTLSVTCTVSGFSLTSYGVHWVRQAPGKGLEWMGIIWGDGSTNYNSALKSRLSISRDTSKSQVFLTMNSLQTDDTAVYYCAE
Rattus norvegicus V1446 ighv AABR07065774.1 8135 IHCEVKLLESGGGLVQSGASLRLSCVASGFTFSDFFMDWVRQAPGKGLEWIAASRNKARDYSAVYSASVNGRFTISRDISQSILYLQMNTLKAEDTATYYCVRN
Rattus norvegicus V1448 ighv AABR07065776.1 62514 VQCEVKLVESGGGLVQPGRSLKLSCAASGFNFNDYWMGWVRQAPGKGLEWIGEINKDSSTINYTPSLKDKFTISRDNAQNTLYLQMSKLGSEDTAIYYCAR
Rattus norvegicus V1449 ighv AABR07065778.1 89632 VQCEVQLVESGGSLVQPGGSLKLSCVASGYTFSNYWMDWVRQTPGKSLEWIGEINTDGSKTNYAPSIKDRFTISRDNAKSTLYLQMSNVKSDDTAIYYCTR
Rattus norvegicus V1450 ighv AABR07065778.1 35642 VKGEVKLVESGGGLLKPGGSLKLSCVASGFTFSNYWMHWVRQAPGKGLEWIGEIEYDGTETNYAPSIKDRFTISRDNAKNTLYLQMSSVRSEDTATYFCTT
Rattus norvegicus V1451 ighv AABR07065778.1 7228 IQCEVKLAVHGGGLVEPGSSLRLSCVASGFTLGDYYMEWVRQAPGKGLEWIAATRNRAKDYSAEYSVSVNGRFTISRDVSQNILYLHMNNLKTEDTGIYYCARD
Rattus norvegicus V1452 ighv AABR07065779.1 21240 VYAEVQLQQSGPELRRPGSSVKLSCKASGYSITDYLMHWVKHRPEHGLEWIGWIDPEDGETKYAQKFQSKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V1453 ighv AABR07065781.1 32514 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSNYWGWIRKFPGNKMEWIGHISYSGSTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Rattus norvegicus V1454 ighv AABR07065782.1 40040 IQCEVKLLESGGGLVQPGGSLRLSCAASGFTFADFYMSWIRQSPGKAPEWLSFIRNKANSYTTEYNPSVKGRFTISRDDTQNVLYLQMNTLRAEDTAIYYCAKH
Rattus norvegicus V1455 ighv AABR07065789.1 83430 VLSQVNLQESGPGLVKPSQPLSVTCSVTGYSITTSYYYWNWIRKFPGNKLEWMGYISYDGSIYYNPSLKSRISITRDTSKNQFFLQLNTVTTEDTAVYYCA
Rattus norvegicus V1456 ighv AABR07065789.1 39516 IQCEVKLLESGGGLVQPGGSMRLSCAASGFTFTDFYMNWIRQPAGKAPEWLGFIRNKANGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCA
Rattus norvegicus V1457 ighv AABR07065789.1 9623 GAQAQIQLVQSGPELKKPGESVKISCKASGYTFTDYAMHWVKQAPGKGLKWMGWINTYTGKPTYADDFKGRFVFSLEASASTANLQISNLKNEDTATYFCA
Rattus norvegicus V1458 ighv AABR07065790.1 8738 ILSEVQIQESGPGLVKPSQSLSLTCSVTGYSITSRNYWSWIQKFPGNKMECMGHITDNGSANYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTDTYYCA
Rattus norvegicus V1459 ighv AABR07065791.1 30599 VQCEVKLVESGGGLVLSGGSLKLSCVASRFTFSSYWMTLVQQTPGKALEWIGEIKPDGSRTNYAPSLKNRFTISRDNAKSTLYLQMSNVRSEDTATYYCVK
Rattus norvegicus V1460 ighv AABR07065792.1 45377 VNSEVQLQQYGAELGKPGTSVKLSCKVSGYNIRSTYMHWVNQRPGKGLEWIGRIDPANGNTIYAEKFKSKATLTADTSSNTAYMQLSQLKSDDTAIYFCA
Rattus norvegicus V1461 ighv AABR07065792.1 30114 VQCEVKLVESGGGLVLPGASLKLSCIVSGFTFSDYWMRWVRQAPGKGLEFIGEIKPDGSKTNYAPSMKGRFTISRDNAKNTLYLQMSSVRSEDTATYYCA
Rattus norvegicus V1462 ighv AABR07065794.1 19623 VYSEVQLQQSGPEVGRPGSSVKISCKASGYTFTDYVMNWVKQSPGQGLEWIGWIDPEYGSTDYAEKFKKKATLTADTSSSTAYIQLSSLTSEDTATYFCA
Rattus norvegicus V1463 ighv AABR07065795.1 68163 TQSQIQLKESGPAVIEPSQSLFLICTVSRFSITSGYCWHWTRQILGKRLEWMGRICYEGSTYYSPSFKSRSTLSSDTSLNKFYILLNSVTAEDTAMYYCFRE
Rattus norvegicus V1464 ighv AABR07065798.1 81613 IFDCEVQLVESGGGLVQPGGSLKLSCVASGFTFRDYWMNWVRQAPGKTMEWIGDIKPDGSNTNYAPSVKNRFTISRDNAKSILYLQMSNMRSDYTATYYCVR
Rattus norvegicus V1465 ighv AABR07065798.1 32360 IQCEVKLVEYGGGLVQPGASLRLSCEASGFTFSDFYMEWIRQAPGKGLEWIAASRNKANDYSTVYSASVKDRFTISRDTYKSILYLQMNTLKPEDTAIYYCARD
Rattus norvegicus V1466 ighv AABR07065802.1 17629 VRCEVQILETGGGLVKPGGSLRLSCATSGFNFNDYFMNWVRQAPGKGLEWVAQIRNKNYNYATYYAESLEGRVTISRDDSKSSVYLQVSSLRAEDTAIYYCT
Rattus norvegicus V1467 ighv AABR07065802.1 5813 VLCEVKLEESGGGLVQPGMSVKLSCTTSGFTFSDYWMEWVRQAPGKGLEWVAEIRNKANNYATYYGKSVKGRFTISRDDSKSIVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V1468 ighv AABR07065804.1 16135 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGNGLDWVASISIKTYNYATVYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAWYYCTV
Rattus norvegicus V1469 ighv AABR07065807.1 13233 VNSEVQLQQSGPELQRPGASVKLSCKASGYTFTEYYMYWVKQRPKQGLELIGRIDPEDGSTDYVEKFKNKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V1470 ighv AABR07065808.1 67886 FQCEVQLVETGGSLVQPGKSLKLTCATSGFTFSNAWMHWVRQSPEKQLEWVAQIKAKSNNYATYYAESVKGRFTISRDDSKSSVYLQMNSLKEEDTAIYYCT
Rattus norvegicus V1471 ighv AABR07065808.1 49812 VQCEVQVLESGGGLVQPGNSLKLSCATSGFTFSTAWMYWYRQFPEKRLEWVARIKAKSNNYATDYTESVKGRFTISRDDSKSSIYLQMNNLKEEDTAIYYCA
Rattus norvegicus V1472 ighv AABR07065808.1 37754 IQCEVQLVETGGGLVRPGSSLKLSCATSGFTFSNTWMNWVRQAPGKGLEWVALIKDKYSNYEANYAESVKGRFTISRDDSKSRVYLQMNTLRDQDTATYYCT
Rattus norvegicus V1473 ighv AABR07065808.1 12991 AQAQIQLVQSGPEVKKPGESVKISCKASGYTFTQAGMQWLKQAQGKSLKWMGWINTNTGKTTYAADFTGRFVFSLETSASTAYLQITNLKNEDMATYFCA
Rattus norvegicus V1474 ighv AABR07065811.1 80815 AHCEVQLVETGGGLVQPGKSLKLTCATSGFTFSTAWMHWVRQSPDKRLEWIARIKDKSNNYATDYVESVKGRFTISRDDSKSSVYLQMNSLKEEDTATYYCT
Rattus norvegicus V1475 ighv AABR07065811.1 40820 AHCEVQLMETGGGLVQPGKSLKLTCATSGFTFSTAWMNWVRQSPEKGLEWIARIKPKSTNYATEYAESVKGRFTISRDDSKSSIYLQMNSLKEEDTATYYCT
Rattus norvegicus V1476 ighv AABR07065811.1 22685 VHCEMQLVESGGGLVQPNGSLKLSCAASGFTFNTYDMSWVSQSPGKGLELVAGISIKSYNYATFYADSVKGRFTISRDDSQSMVYLQMNNLKTEDTALYYCTA
Rattus norvegicus V1477 ighv AABR07065812.1 130268 VLCEVKLEESGGGLVQPGVSLKLSCATSGFTFSNYWMEWVRQSPGKGLEWVAEIRTKANNYATYYGESMKGRFTISRDDSKSMVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V1478 ighv AABR07065812.1 57088 ILSQMQLQESGPGLVKPTQSLFLTCSVTGFSITSGYYWIWIRQSHGKHLEWMGYMTYSGETFYNPSLKSPISITRETSKNQFFLQLNSVTTEDTAMYYCAG
Rattus norvegicus V1479 ighv AABR07065812.1 25613 EKYEVKPLETGGGLEQSGNSLKLSCATSGFTFSTAGMSWIHQAPGNVLERLAQVEDKSNNYFISYVEYLKGRFTISRDNSKESIYLQVNILKEKDTAIYYCI
Rattus norvegicus V1480 ighv AABR07065812.1 7334 SQCEVQLVETGGGLVQPGNSLKLSCATSGFTFSTAWMNWIRQTPGKRLEWLAQIEDKSNNYFISYLESVKGRFTISRDDSKSSVYLQMNNLKEEDTAIYYCT
Rattus norvegicus V1481 ighv AABR07065813.1 43894 VLSQVTLKESGPGMLQPSQTLSLTCTFSGTSLSTSNMGLSWLRQPSGKGLEWLASIWNNDNYYNPSLRSRLTISKETSKNQVLLKFTSMEPADTATYYCAWR
Rattus norvegicus V1482 ighv AABR07065814.1 191819 VHSQVHLQQSGSDLVKPGASVKLSCKASGYTFSTSYMNWLKQVPGQSIEWIGYIYAGNGDINYNQKYKGKAKLTVDTSFSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V1483 ighv AABR07065814.1 76631 LVESAGGLVQTKGSLKLSCAASGFTFDTYAMNWVRQAPGKGLEWVASIRSKSDNYATYYADSVKGRFTISRDDSRSMLCLQMDNVKTEDTAIYYCTR
Rattus norvegicus V1484 ighv AABR07065814.1 63076 LHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNSYGMSWVRQAPGKGLDLVADISSKSYNYATYYADSVKDRFTISRDDSQSMVYLQMDNLKTEDTALYYCTV
Rattus norvegicus V1485 ighv AABR07065814.1 43643 VHCEVQLVESGGGLVQPKGSLKISCAASGFTFDTYSMNWVRQAPGKGLEWVAHIRSKSYNYARYYADSVKGRFTISRDDSRSMVYLQMYNLKTEDTAIYYCTR
Rattus norvegicus V1486 ighv AABR07065814.1 29880 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGKGLDWVASISIKTHNYATLYADSVKERFTISRDDSQSMVYLQMNNLKTEDTALYYCTV
Rattus norvegicus V1487 ighv AABR07065814.1 11157 VHCAVQLVESGGGLVQPKESLKISCAASGFTFSNAAMYWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSKSMVYLQMDNLKTEDTAMYYCTA
Rattus norvegicus V1488 ighv AABR07065815.1 87352 VHSQVKLLQSGAELVKPGASVKLSCKTSGFTFSTSYMSWLKQVPGPSIEWIGWIYAGDGGTNYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDAAVYFCA
Rattus norvegicus V1489 ighv AABR07065815.1 53574 VHSQVQLQQSGAELVKPGSSVKISCKASGYTFTSYDMHWIKQQPGNGLEWIGWIYPGNGNTKYNQKFNGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V1490 ighv AABR07065815.1 2999 VHSQVQLQQSGTELVKPASSVKISCKASGYTFTSNYMHWIRQQPGNGLEWIGWIYPGNGNTKYNQKFDGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V1491 ighv AABR07065816.1 3247 VHSQVKLLQSGAELVKPGASVKLSCKTSGFTFSTSYMSWLKQVPGPSIEWIGWIYAGDGGTNYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDAAVYFCA
Rattus norvegicus V1492 ighv AABR07065818.1 19596 VHSEVQLQQSGAELVKPGASVKLSCKTSGYTFSNYYMSWLKQMPGQNIEWIGNIYGGNGGTGYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V1493 ighv AABR07065820.1 4214 VHSQVQLQQSGAELVKPGSSVKMSCKASGYTFTSYYIYWIKQRPGQGLEWIGRIGPGSGDTNYNEKFKGKATFTVDKSSSTAYMQLSSLTPEDTAVYYCA
Rattus norvegicus V1494 ighv AABR07065823.1 123213 VLSQVSLKESGPGILQPFQTLSLTCSFSGFSLGTSNMGVGWIRQTSGKGLEYLATIWWDDDKYFNPSLNSRLTVSKDTSNNQAFLKITSVDTADTGTYYCTQR
Rattus norvegicus V1495 ighv AABR07065823.1 63038 VHSQVNLLQSRAALVKPGASVKLSCKASGYTFTDYYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKSKATLTVDKSTNTAYMELSRLTSEDSATYYCT
Rattus norvegicus V1496 ighv AABR07065823.1 33504 VHSQVKLLQSGAALVKPGASVKMSCKASGYTFTDYWVSWVKQSHGKSLEWIGEIYPNSGATNFNEKFKGKATLTVDKSTSTAYMELSRLTSEDSAIYYCT
Rattus norvegicus V1497 ighv AABR07065823.1 10306 VHSQVQLQQSGAELAKPGTSVKLSCKASGYTFTSYYIYWVKQRPGQGLEWIGYIYPGNGGTYYSEKFKGKATFTADTSSSTAYMLLGSLTPEDSAYYFCA
Rattus norvegicus V1498 ighv AABR07065825.1 24589 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGICVSWIRQPSGKGLEWLATICWEDSKGYNPSLKNRLTISKDTSNNQAFLKITSVDTADTAIYYCARR
Rattus norvegicus V1499 ighv AABR07065825.1 11340 VHSQVQLQQSGTELVKPGSSLKLSCKASGYTFTDYAMQWVKQRPGQGLEWIGYILPWNGVTDYNQKFKGKATLTVDTSSNTAYMELSRLTSDDSVVYYCA
Rattus norvegicus V1500 ighv AABR07065827.1 5007 VHSQVQLQQSGAELAKPGSSVKISCKASGYTFTSYDISWIKQTTGQGLEYIGYINTGSGGTYYNEKFKGKATLTVDKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V1502 ighv AABR07065834.1 2442 VHSQVQLQQSGAELVKPGTSVKLSCKASGYTFTSNHMNWIKQTTGQGLEWIGIINPGSGGTSYNVKFKGKATLTVDKSSSTAFMQLSSLTPEDSAVYYCA
Rattus norvegicus V1503 ighv AABR07065839.1 4543 VYSEVKLQQSGDELVRPGASVKISCKASGYTFTNYAMYWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V1504 ighv AABR07065852.1 5184 KLSCKNSYFSFRRQFLSSYCMSWVKKRPEQGMEWIGYINLYSGDTSYNQKFKEKATLSTDTSSKTAYMQLSSLVSEDSVVYYCARHSVVTTS
Rattus norvegicus V1505 ighv AABR07065875.1 1532 VLSQVTLKESGPGILQPSQTLSLTCTFSGFSLSTSGTGVSWICQPSGKGLEWLANIWWNDDKGYNPSLKSRLTVSKDTSNTRAFLKITSVDTADTATYYCARR
Rattus norvegicus V1506 ighv AABR07065877.1 653 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQVLEWIGAINPGSGGTGYNEKFKGKATLTEGKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V1507 ighv AABR07065883.1 31408 VLAQVTLKESGPGILQPSHTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLASIWWNGNTYNNPSLKSRLTVSKDTSNNQAFLKVTSVDTADTATYYCA
Rattus norvegicus V1508 ighv AABR07065883.1 18456 VHSQVQLQQCGAELVKPGTPVKMSCKVSGYTFTSYVISWIKQTTGQGLEWIGYIYPESGSTGYNEKFKGKATLTVDKSSNTAFMQLSSLAAGDSAVYYCA
Rattus norvegicus V1509 ighv AABR07065886.1 78617 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQAVEWIGVINPESGGTDYNGKFRGKVTLTVDKSSSTAFMQLGSLTPEDTAVYYCA
Rattus norvegicus V1510 ighv AABR07065886.1 71471 VHSEVKLQQSGDELVRPGASVKMSCKASGYTFTDYAMHWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V1511 ighv AABR07065886.1 45157 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMCVGWIRQSSGKGLEWLANIWWNDDKYYNPSLKNRLTISKDTSNNQAFLKITNMDTADTATYYCARR
Rattus norvegicus V1512 ighv AABR07065888.1 10187 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V1513 ighv AABR07065889.1 16570 VFSQVQLQQSGAELVKPGSSVKLSCKASGYTFTEYYIDWVKQRPGQGLEWIGDIDPENGDTAYNEKFKGRATMTADTSSNTAYMELSRLTSEDSAVYYCASVV
Rattus norvegicus V1514 ighv AABR07065889.1 4533 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V1515 ighv AABR07065895.1 4814 VLAQVTLKESGPGILQPSQTLSLTCSFSGFLLSASSVGVGWIRQPSGKGLEWLATIGWEDVKHYNPSLKSRLTVSKDTSNNQVFLKITSVDTADTGTYYCAHS
Rattus norvegicus V0 igkv AAHX01021006.1 732 ADGDTVMTQSPASMSTSVGERVTVNCKASQSVGTVVAWFQQKPGQSPKRLIYLATNRHTGVPDRFTGSGFGRDFTLTISNVEAEDLAVYYCLQYDSIP
Rattus norvegicus V1 igkv AAHX01021009.1 2476 ADGETVMTQSPTSMSTSIGERVTLNCKASQSVGINVDWYQQTPGQSPKLLIYGASNRHTGVPDRFTGSGFGRDFTLTISNMEAEDLAVYYCLQYGSIP
Rattus norvegicus V2 igkv AAHX01021014.1 3295 SNGQITLTQQAESLWISPGERVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASVRTDGVPTRFIGSGSGTEFTLSIEHVQPEDFAIYYCLQ
Rattus norvegicus V3 igkv AAHX01021017.1 2685 STGDIVLTQSPALAVSLGQRATISCRASQSVSTSSYNLMHWYQQKPGEQPKLLIYDASNLASGIPVRFSGSGSGTDFTLTINPVQADDIATYYCQQSRELP
Rattus norvegicus V4 igkv AAHX01021029.1 3123 STGDTVLTQSPALAVSPGERVSISCRASEGVNSYMHWYQQKPGQQPKLLIYKASNLASGVPARFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNDP
Rattus norvegicus V5 igkv AAHX01021034.1 766 TCGDIVMTQSPFSLAVSEGEMVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYYASTRQSGVPDRFIGSGSGTDFTLTISDVQAEDLADYYCLQHYSYP
Rattus norvegicus V6 igkv AAHX01021035.1 24096 TCGDIVMTQSPSSLAVSAGDKVTMSCKSSQSLLSSEYQGNYLSWFQQKPGQSPKLLISLASTRETGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYSYP
Rattus norvegicus V7 igkv AAHX01021042.1 2843 STGDTVLTQSPALAVSPGERVTISCRASESVSTLMHWYQQKPGQQPTLLIYLASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNDP
Rattus norvegicus V8 igkv AAHX01021044.1 7550 VYGNTVMTQSPTSMFTSVGDRVTMSCKASQNVGINVGWYQQKTGQSPKRLIYWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHNSYP
Rattus norvegicus V9 igkv AAHX01021050.1 4111 STGDTVLTQSPALAVSLGQRVTISCRASKSVSTYMHWYQQKSGQQPKLLIYSASNLESGVPSRFSGSGSGTDFTLTIDPVEADDIANYYCQQSNELP
Rattus norvegicus V10 igkv AAHX01021059.1 5617 ANANVMMTQSPTSLAVSAGEMVSLSCKSSENLYSSTYKENYLAWYQKKSGQSPKLLIFYASHRASGVPDRFIGSGSGTDFTLTIRSMQAEDTADYYCARHYSSL
Rattus norvegicus V11 igkv AAHX01021073.1 9297 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLDSDGDTYLNWLLQRPGQSPQLLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V12 igkv AAHX01021083.1 11707 AICDIQMTQSPASLSASLGETVTIECRASEDIYNGLAWYQQKPGKSPQLLIYNANSLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQQYYNYP
Rattus norvegicus V13 igkv AAHX01021083.1 30681 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLHWLLQRPGQSLQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQGTHAP
Rattus norvegicus V14 igkv AAHX01021084.1 19062 SDVTGETTQSPASLSFSLGETATMTCRASDSVGSYLAWYQQKTGQVPRLLIHTASTRASGVPARFSGSGSGTDFTLTVSSLESEDVAIYYCQPYKNWS
Rattus norvegicus V15 igkv AAHX01021084.1 39901 AQCDIHMTQNPVSLSAFIGDKVTITCRASQDISRYLGWYQQKQGQSPKFLMYYASNLLSGVPSRFSDSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V16 igkv AAHX01021087.1 27977 SRGNIVLTQSPATLSVTPGESVSLSCRASQSISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSIYYCQQSYSSL
Rattus norvegicus V17 igkv AAHX01021087.1 46457 AICDIRMTQSPASLSASLGETVNIECLASEDIYSDLAWYQQKPGKSPQLLIYNANSLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQYNNYP
Rattus norvegicus V18 igkv AAHX01021090.1 36441 AICDIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKINSLESEDAATYFCLQDSEYP
Rattus norvegicus V19 igkv AAHX01021090.1 110113 SRGDIVLTQSPTTLSVTPGETVSLSCRASHSIGTNLHWYQQKTNESPRLLIKYASQSISGIPSRFSASGSGTDFTLNINNVEFDDVSSYFCQQTQSWP
Rattus norvegicus V20 igkv AAHX01021090.1 135124 ARCDIQMTQSPASLSASLGETVTIECLASEDIYDILAWYQQKPGKSPQLLIYDASSLHTGVPSRFSGSGSGTQYSLKINSLQPEDFASYYCQNGLSAP
Rattus norvegicus V21 igkv AAHX01021091.1 21195 SRGDIMLTQSPATLSVTPGESISLSCRASQSISTNLHWYQQKPNESPRVLIKYASQSISGIPSRFSGSGSGTDFTLSINRVEPEDFSVYYCQQSNSW
Rattus norvegicus V22 igkv AAHX01021093.1 10389 AICDIQMTQSPPSLSASLGETISIECLASEGIYSNLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQFSLKISSMQPEDEADYFCQQSYKFP
Rattus norvegicus V23 igkv AAHX01021093.1 49458 SRGDIVLTQSPATLFVTPGERISLSCRSSQNIGTNIHWYQEKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVEPEDFSVYYCQQSNSC
Rattus norvegicus V24 igkv AAHX01021094.1 6077 AIRDIQMTQSPASLSASLGETVTIQCRASEDIYSGLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQYSLKISSMQTEDEGVYFCQQGLKYP
Rattus norvegicus V25 igkv AAHX01021098.1 33504 IVSSGEIVLTQSPTTMAASPGEKVTLTCLASSSVNYMYWYQQKSSASPKLLIYYTSSLASGVPDRFSGSGSGTSYSLTISSMEAEDAAIYYCLQLTST
Rattus norvegicus V26 igkv AAHX01021101.1 1587 IVSSGEIVLTQSPTTMAASPGEKVTLTCRASSSVSYMHWYQQKSGASPKLWIYDTSNRASGVPNCFSGSGSGTSYSLTISSMETEDAATYYCQQWSSN
Rattus norvegicus V27 igkv AAHX01021109.1 15009 SRGDIVLTQSPATLSVTPGESVSLSCRASQGISTSIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVESEDFSVYYCQQSYSLP
Rattus norvegicus V28 igkv AAHX01021110.1 34153 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYEGSNLASGIPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V29 igkv AAHX01021121.1 3506 IVSSGETVLTQSPTTTAASPGEKVTITCRASSSVSYMHWYQQKSGASPKLWIYDTSKLASGVPNRFSGSGSGTSYSLIISSIETEDAATYYCQQKSSD
Rattus norvegicus V30 igkv AAHX01021121.1 18385 SSGEIVLTQSPTTMAASLGEKVTITCSASSSVNYMHWYQQKSGTSPKLLIYYTSSLASGVPDRFSGSGSGTTYLLRISTMETEDAATYYCQYWSSSQ
Rattus norvegicus V31 igkv AAHX01021121.1 36710 SSGEIVLTQSPTTMAASPGEKVTLNCLASSSVSYMNWYQQKSGASPKLWIYGTSNLASGVPNRFSGSGSGTSYSLTISSMEAEDVATYYCLQLSSY
Rattus norvegicus V32 igkv AAHX01021124.1 8448 TVSSGEIVLTQSPTTMAASPGEKVTLTCHASSSVSYMHWYQQRSGASPKLWIYETSKLASGVPNRFSGSGSGTSYSLTINSMETEDAATYYCQQGSSY
Rattus norvegicus V33 igkv AAHX01021124.1 33264 SSGEIVLTQSPITMAASPGEKVTITCRASSSVSYMYWYQQKSGASSKLWIYDTSKLASGVPDRFSGSGSGTSYSLTISSVETEDAATYYCQQWSST
Rattus norvegicus V34 igkv AAHX01021130.1 1575 TVSSGEIVLTQSPTTIAASPGEKVTITCRASSSVSYMYWYQQKSGASPKLWIYDTSKLASGVPNRFSGSGSGTSYSLTINTMETEDAATYYCQQWSST
Rattus norvegicus V35 igkv AAHX01021139.1 9137 IVSSGEIVLTQSPTTMAASPGEKVTITCRASSSVSYMHWFQQKSGTSPKPWIYDTSKLASGVPDRFSGSGSGTSYSLTISSMEAEDAATYYCLQRSSY
Rattus norvegicus V36 igkv AAHX01021139.1 24145 IVFSGEIVLTQSPTTMAESPGEKVTITCSASSSVSYMHWYQQKTGTSHKLLIYKTYTLASGVPHHFHGTGSGTSYSLTIITMETKDVSTYYCKQWSSN
Rattus norvegicus V37 igkv AAHX01021154.1 6198 GRCAIQVTQSPTSLSASLGDRVTLTCRASQDINNKMAWYQQKPGEVPQLLIYYASTLQSGTPSRFSGSGAGTDFSFTISHLQSEDFATYYCLQGYSL
Rattus norvegicus V38 igkv AAHX01021164.1 6725 SRGDVVMTQTPLSLPISLGDQASFSCRSSQSLLHSNGNTYLAWYLQKSGQSPQILIYRISNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQH
Rattus norvegicus V39 igkv AAHX01021165.1 28686 VRCDIQMTQSPSFLSASLGNSITITCHASQNIKGWLAWYQQKSGNAPELLIYKASSLQSGVPSRFSGSGSGTDYIFTISNLQPEDIATYYCQHYQSFP
Rattus norvegicus V40 igkv AAHX01021166.1 2842 SSGAIVLNQSPSSIVASQGEKVTITCRASSSISSNYLHWYQQKPGAFPKLVIYSTSYRASGVPSRFSGSGSGTSYSFTISRVEAEDVATYYCQQGSSN
Rattus norvegicus V41 igkv AAHX01021168.1 1350 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPRQLIHYTSTLVSGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLP
Rattus norvegicus V42 igkv AAHX01021171.1 18257 AQCDIQMTQSPPSLSASLGDKVTITCQASQNINKYIAWYQQKPGKAPGLLIGYTSRLVSGIPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNSP
Rattus norvegicus V43 igkv AAHX01021174.1 23685 ARCDIQMTQSPSSLPASLGERVTISCRASQGISNNLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQDASFP
Rattus norvegicus V44 trbv AAHX01029744.1 41922 HTGPNVQQIPSHQVIDIGQTVILSCDPVSNHLYFYWYKQILGQQMEFLVSFFDGKIGEKSKLFKDEFLVDRQHGSYFTLKIQRTTLEDSAVYFCASSL
Rattus norvegicus V45 igkv AAHX01030724.1 26280 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMADYYCLQSKESP
Rattus norvegicus V46 igkv AAHX01030726.1 4781 STGDIVLTQSPVLAVSLGQRATISCRASQSVSISSINLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTIDPVQADDIAAYYCQQSRESP
Rattus norvegicus V47 igkv AAHX01030738.1 3263 ADGNTVMTQSPTSMFISVGDRVTMNCKASQNVGTNVDWYQQKTGQSPKLLIYGASNRYTGVPDRFTGSGSGTDFTLTISNMQAEDLAVYYCLQYNYNP
Rattus norvegicus V48 igkv AAHX01030739.1 7515 STGDIVLTQSPALAVSLGQRATISCRASQSVSISRYNLMHWYQQKPGQQPKLLIYRASNLASGIPARFSGSGSGTDFTLTINPVQADDIATYYCQQSRESP
Rattus norvegicus V49 ighv AAHX01046796.1 709 VQCEVQLVESGGGLVQPRRSLKLSCAASGFTFINYGINWVHQTPEKILEWVAYISRASNDIYYADTMKGQFTISRDNAKNTLYLQLSSLRSEDTAFLYFCAG
Rattus norvegicus V50 ighv AAHX01046798.1 703 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGKGLEWMGGIRSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYFCT
Rattus norvegicus V51 ighv AAHX01046801.1 4247 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V52 ighv AAHX01046801.1 19167 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTRYGVSWVCQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V53 ighv AAHX01046810.1 8696 LLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYTVSWVRQPPGKGLEWIGAIWSGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAIYFCTR
Rattus norvegicus V54 ighv AAHX01046816.1 1024 VLSQVQLKESEPDLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V55 ighv AAHX01046825.1 16047 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPPGKGLEWMGVIWSNGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCAR
Rattus norvegicus V56 ighv AAHX01046825.1 24123 VQCEVQLVESGGGLVQPGRSLKLSCVASGFTFNNYWMTWIRQAPGKGLEWVASITNTGGSTYYPDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCTR
Rattus norvegicus V57 ighv AAHX01046825.1 56750 VLSQVQLMESGPGLVQPSETLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGVMWSGGSTDYNSALKSRLSISRDTSKNQVFLKMNSLQSEDTTTYYCAR
Rattus norvegicus V58 ighv AAHX01046825.1 64961 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMAWVRQAPTKGLEWVATISYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V59 ighv AAHX01046833.1 1704 ALSQVRLKESGPRLVQPSQTLSVTCTVSGFSVTSYHVSWVRQPPGKGLEWVGAIWKGGSTDYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCA
Rattus norvegicus V60 ighv AAHX01046833.1 15249 VQCEVQLVESGGGLVQPGSSLKVSCVASGFTFSSYVMHWFRQAPENGIEWLAYINTDSSSTHYAETVKGRFTISRDNAKNTVDMQLSSLRSEDTAMYFCARE
Rattus norvegicus V61 ighv AAHX01046834.1 10690 VWCEVQLVESSEGLVQPRSSLKLSCVASGFTFNKYDMCWVHQAPKKGLELVAIIYYGGGNKYYEDTVKGQFTISRENSKNTLYLEMSNLRSKDTAIYYCA
Rattus norvegicus V62 ighv AAHX01046839.1 35462 VLSQVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVSWIRQPTVKCLEWMGVIWSDGGTDYNSAIKSRLSISRDTSKSQVFLKMNSLQTEDTATYFCAI
Rattus norvegicus V63 ighv AAHX01046839.1 43442 VQCEVQLVETGGGLVQPGRSLKLSCVASGFTFSSYWMYWIRQAPGKGLEWVSSINTDGGSTYYPDSVKGRFTISRDNAENTVYLQMNSLRSEDTATYYCAK
Rattus norvegicus V64 ighv AAHX01046839.1 76287 VLSQVQLKESGPGLMQPSETLSLTCTVSGFSLTSNGVGWVRQPLGKGLVWMGTIWAGGSTNYNSAVQSRLSISRDTSKSQVFLKMNSLQPEDTGTYYCA
Rattus norvegicus V65 ighv AAHX01046839.1 97597 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSNYGMNWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V66 ighv AAHX01046840.1 12414 VQCAVQLVESGGGLVQPGKSLKLSCSASGFTFSSYGMHWIRQAPGKGLDWVAYISSSSGTVYADAVKERFTISRDNAKNTLYLQLNSLKSEDTAIYYCAR
Rattus norvegicus V68 ighv AAHX01046840.1 50055 VLSQVQMKETGPGLVQTTQTLSVTCTVSGFSLTSYGVHWVRQAPGKGLEWMGIIWGDGSTNYNSALKSRLSISRDTSKSQVFLTMNSLQTDDTAVYYCAE
Rattus norvegicus V70 ighv AAHX01046850.1 4138 IQCEVKLAVHGGGLVEPGSSLRLSCVASGFTLGDYYMEWVRQAPGKGLEWIAATRNRAKDYSAEYSVSVNGRFTISRDVSQNILYLHMNNLKTEDTGIYYCARD
Rattus norvegicus V71 ighv AAHX01046857.1 13263 VQCEVQLVESGGSLVQPGGSLKLSCVASGYTFSNYWMDWVRQTPGKSLEWIGEINTDGSKTNYAPSIKDRFTISRDNAKSTLYLQMSNVKSDDTAIYYCTR
Rattus norvegicus V72 ighv AAHX01046860.1 6911 IQCEVKLLESGGGLVQPGGSLRLSCAASGFTFADFYMSWIRQSPGKAPEWLSFIRNKANSYTTEYNPSVKGRFTISRDDTQNVLYLQMNTLRAEDTAIYYCAKH
Rattus norvegicus V73 ighv AAHX01046861.1 10896 AQAQIQLVQSGPELKKPGESVKISCKASGYTFTDYAMNWVKQAPGNGLKWMGWINTQTGKPTYADDFKQRFVFSLETSASTAYLQINNLNIEDTATYFCT
Rattus norvegicus V74 ighv AAHX01046863.1 8797 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSSYRWNWIRKFPGNKLEWMGYINSAGSTNYNPSLKSRISITRDTSKNQFFLQVNSVTTEDTATYYCA
Rattus norvegicus V75 ighv AAHX01046867.1 9352 VLSQVNLQESGPGLVKPSQPLSVTCSVTGYSITTSYYYWNWIRKFPGNKLEWMGYISYDGSIYYNPSLKSRISITRDTSKNQFFLQLNTVTTEDTAVYYCA
Rattus norvegicus V76 ighv AAHX01046869.1 13014 ILSEVQIQESGPGLVKPSQSLSLTCSVTGYSITSRNYWSWIQKFPGNKMECMGHITDNGSANYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTDTYYCA
Rattus norvegicus V77 ighv AAHX01046873.1 11659 VQCEVKLVESGGGLVLSGGSLKLSCVASRFTFSSYWMTLVQQTPGKALEWIGEIKPDGSRTNYAPSLKNRFTISRDNAKSTLYLQMSNVRSEDTATYYCVK
Rattus norvegicus V78 ighv AAHX01046874.1 11727 VQCEVKLVESGGGLVLPGASLKLSCIVSGFTFSDYWMRWVRQAPGKGLEFIGEIKPDGSKTNYAPSMKGRFTISRDNAKNTLYLQMSSVRSEDTATYYCA
Rattus norvegicus V79 ighv AAHX01046875.1 6717 VNSEVQLQQYGAELGKPGTSVKLSCKVSGYNIRSTYMHWVNQRPGKGLEWIGRIDPANGNTIYAEKFKSKATLTADTSSNTAYMQLSQLKSDDTAIYFCA
Rattus norvegicus V81 ighv AAHX01046889.1 3992 FQCEVQLVETGGSLVQPGKSLKLTCATSGFTFSNAWMHWVRQSPEKQLEWVAQIKAKSNNYATYYAESVKGRFTISRDDSKSSVYLQMNSLKEEDTAIYYCT
Rattus norvegicus V82 ighv AAHX01046893.1 1514 AHCEVQLVETGGGLVQPGKSLKLTCATSGFTFSTAWMHWVRQSPDKRLEWIARIKDKSNNYATDYVESVKGRFTISRDDSKSSVYLQMNSLKEEDTATYYCT
Rattus norvegicus V83 ighv AAHX01046895.1 1201 SQCEVQLVETGGGLVQPGNSLKLSCATSGFTFSTAWMNWIRQTPGKRLEWLAQIEDKSNNYFISYLESVKGRFTISRDDSKSSVYLQMNNLKEEDTAIYYCT
Rattus norvegicus V84 ighv AAHX01046898.1 1345 EKYEVKPLETGGGLEQSGNSLKLSCATSGFTFSTAGMSWIHQAPGNVLERLAQVEDKSNNYFISYVEYLKGRFTISRDNSKESIYLQVNILKEKDTAIYYCI
Rattus norvegicus V85 ighv AAHX01046901.1 31739 ILSQMQLQESGPGLVKPTQSLFLTCSVTGFSITSGYYWIWIRQSHGKHLEWMGYMTYSGETFYNPSLKSPISITRETSKNQFFLQLNSVTTEDTAMYYCAG
Rattus norvegicus V86 ighv AAHX01046904.1 8375 VRCEVQILETGGGLVKPGGSLRLSCATSGFNFNDYFMNWVRQAPGKGLEWVAQIRNKNYNYATYYAESLEGRVTISRDDSKSSVYLQVSSLRAEDTAIYYCT
Rattus norvegicus V87 ighv AAHX01046904.1 20148 VLCEVKLEESGGGLVQPGMSVKLSCTTSGFTFSDYWMEWVRQAPGKGLEWVAEIRNKANNYATYYGKSVKGRFTISRDDSKSIVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V88 ighv AAHX01046913.1 26885 VHSQVQLQQSGAELVKPGSSVKMSCKASGYTFTSYYIYWIKQRPGQGLEWIGRIGPGSGDTNYNEKFKGKATFTVDKSSSTAYMQLSSLTPEDTAVYYCA
Rattus norvegicus V89 ighv AAHX01046918.1 888 VHSQVQLQQSGAELAKPGSSVKISCKASGYTFTSYYISWIKQTTGQGLEYIGYINTGSGGTNYNEKFKGKATLTVDKSSSTAFMQLSSLTPDDSAVYYCA
Rattus norvegicus V90 ighv AAHX01046918.1 20147 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGICVSWIRQPSGKGLEWLATICWEDSKGYNPSLKNRLTISKDTSNNQAFLKITSVDTADTAIYYCARR
Rattus norvegicus V91 ighv AAHX01046918.1 33591 VHSQVQLQQSGTELVKPGSSLKLSCKASGYTFTDYAMQWVKQRPGQGLEWIGYILPWNGVTDYNQKFKGKATLTVDTSSNTAYMELSRLTSDDSVVYYCA
Rattus norvegicus V92 ighv AAHX01046919.1 4048 KLSCKNSYFSFRRQFLSSYCMSWVKKRPEQGMEWIGYINLYSGDTSYNQKFKGKATLSTDTSTKTAYMELSSLVSEDSVVYYCARHSVVTTS
Rattus norvegicus V93 ighv AAHX01046927.1 17418 VHSQVQLQQSGAELVKPGTSVKLSCKASGYTFTSNHMNWIKQTTGQGLEWIGIINPGSGGTSYNVKFKGKATLTVDKSSSTAFMQLSSLTPEDSAVYYCA
Rattus norvegicus V94 ighv AAHX01046931.1 25377 VLAQVTLKESGPGILQPSHTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLASIWWNGNTYNNPSLKSRLTVSKDTSNNQAFLKVTSVDTADTATYYCA
Rattus norvegicus V95 ighv AAHX01046931.1 39270 VHSQVQLQQCGAELVKPGTPVKMSCKVSGYTFTSYVISWIKQTTGQGLEWIGYIYPESGSTGYNEKFKGKATLTVDKSSNTAFMQLSSLAAGDSAVYYCA
Rattus norvegicus V96 ighv AAHX01046933.1 23497 VLSQVTLKESGTGILQPSQTLSLTCSFSGFSLSTSGMGVRWIRQPSGKGLEWLANIWWNDNKGYNPSLKSRLTVSKDTSNTRAFLKITSVDTADTATYYCARR
Rattus norvegicus V97 ighv AAHX01046935.1 4833 VHSEVKLQQSGDELVRPGASVKISCKASGYTFTSYSMHWVKQRPGQGLEWIGAIIPIIDTTEYNQKFKGKATLTADKSSNTANMELSRLTSEDSAVYYCA
Rattus norvegicus V98 ighv AAHX01046938.1 13406 VHSQVQLQQSGAELAKPGSSVKISCKASGYTFTSYDISWIKQTTGQGLEYIGYINTGSGGTYYNEKFKGKATLTVDKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V99 ighv AAHX01046944.1 8873 KLSCKNSYFSFRRQFLSSYCMSWVKKRPEQGMEWIGYINLYSGDTSYNQKFKEKATLSTDTSSKTAYMQLSSLVSEDSVVYYCARHSVVTTS
Rattus norvegicus V100 ighv AAHX01046944.1 18305 VHSQVQLQQSGAELTKPGSSVKISCKASGYTFTSYDISWIKQRPGQALEWIGAINPGSGGTGYNEKFKGKATLTVDKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V102 iglv AAHX01070327.1 16315 AISQAVVTQESALTTLPGGTVTLTCHSSTGAVTTSNYANWIQEKADHLFTGIVGDTSNRAPGAPARFSGSLLEGKAALTITGAQIEDEATYFCSLWYSNH
Rattus norvegicus V103 iglv AAHX01070335.1 8569 SCAQFVLTQSNSMSTSLGSTVKLSCKRSTGNIGSSYVYWYQQHEGRSPTTMIYDDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQIEDEAIYFCQSYSSGI
Rattus norvegicus V104 trav AAHX01082620.1 3900 VSSQQKVQQNPESLTVPEGARTSLNCTFSNSASQYFAWYRQDPGKEPKELVSIFSTGEKEEGRVTIRVNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V105 trav AAHX01082620.1 13865 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASE
Rattus norvegicus V106 trav AAHX01082620.1 16585 MNSQVAEENPWALRILEGENVTVNCSYKTSLTALLWYRQDSGRGPALLVLISSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATDVQCEA
Rattus norvegicus V107 trav AAHX01082622.1 1399 GSNGDSVTQTEGQVTLSEGASLTVNCSYETTRYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQASDSAVYYCALG
Rattus norvegicus V108 trav AAHX01082622.1 11084 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKDLHFVIDIHSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAA
Rattus norvegicus V109 trav AAHX01082942.1 25240 ASGQGVEQPAKLMSVEGTFARVNCTYSTSGFNGLSWYQQHEGQAPVFLFYTVLDGLKDSGRFSTFLSRSDGYSYLLLTELQIKDSASYLCAVR
Rattus norvegicus V110 trav AAHX01082952.1 3035 VSSQQKVQQSPESLIVSEGDTASLNCTFSDSASNSFWWYRQHSGKGPKALMSIFSSGDKQEGRFTAHLNIASLHVSLHIRDLGPSDSALYLCAV
Rattus norvegicus V111 trav AAHX01082953.1 5348 MSSQQKVQQSPESLIVSEGAKASLNCTFSTSASQSFWWYRQHSGKGPKVLISISSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYLCAV
Rattus norvegicus V112 trav AAHX01082953.1 15126 VSSQQKVQQSPESLIVSEGARASFNCTFSASTSDYFWWYRQYSGKSPKALMSIVSNGDKQEGRFTAHINKASLHVSLHIIDSQPSDSAVYLCAVS
Rattus norvegicus V113 trav AAHX01082953.1 19681 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSTSDYFWWFRQYSGKSPKALMSIFSNGDKQEGRFTVHLNKTSLHVSLHINDSQPTDSAVYLCAVS
Rattus norvegicus V114 trav AAHX01082953.1 24396 VSSQQKVQQSPESLIVSEGAKASFNCTFSDSASQYFWWYRQYSGKSPKALMSIFSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYLCAV
Rattus norvegicus V115 trav AAHX01082954.1 2526 VSSQQKVQQSPESLIVSEGDTSSLNCTFSDSSSYSFWWYRQHSGEGPKVLMSIVSNGDKQEGRFTAHLNKASLHVSLHINDSQPSDSAVYFCAVS
Rattus norvegicus V116 trav AAHX01082954.1 7757 WTHGNSVTQTQGQVTLSEEEFLFINCTYSSTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYEKRTTSFHLQKASVQESDSAVYYCVLG
Rattus norvegicus V117 trav AAHX01082955.1 3320 RTHGNSVTQTQGQVTLSEGKFLFINCTYSTTTYPTLFWYVQHPGEGPQLLLKVTTANNKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALG
Rattus norvegicus V118 trav AAHX01082955.1 15501 VRSQEKVQQNPDILIVPEGATASFNCTSSDRNVDYFWWYRQHSGKAPKMLMSIVSNGVKEEGRFTAHFNKASLHVSLHINDSQPSDSAVYLCAVS
Rattus norvegicus V119 trav AAHX01082957.1 3616 GVRGIQVEQNPEALSLHEGAGSGLRCNFSTTMNSVQWFRQNPRGSLINLFFLASGTKENGRLKSTFDSKERYSTLHISDAQLEDSGTYFCAAE
Rattus norvegicus V120 trav AAHX01082957.1 22008 VSSQQKVQQSPESLIVPERAKTSLNCTFSSSASQYFAWYRQHPGKELKELMSIISTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V121 trav AAHX01082959.1 7692 MKKTHGDSVTQKEGQVTLSEGDFLFINCTYSTTGYPTLFWYVQYPGEGPQLLFQVTTANNKGKNRGFEALYDKGTTSFHLEKASVQESDSAVYYCALS
Rattus norvegicus V122 trav AAHX01082959.1 16203 VSSQQKVQQSPESLTVPEGAKTSLNCTFSSSASQYFAWYRQHPGKEPKELLSIFSTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V123 trav AAHX01082959.1 23143 LNSQVAEENPWALRIHEGENVTVNCSYKTSIAALQWYRQKSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V124 trav AAHX01082960.1 5736 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGGTPYLFWYIQHHGHGLQFLLRYYSGDPVVHGMNGFEAEFSKSNSSFHLKKASVHWSDSAVYFCAVG
Rattus norvegicus V125 trav AAHX01082960.1 8507 GSNGDSVTQTEGQVTLSEGASLTVNCSYETTRYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKVSVQALDSAVYYCALG
Rattus norvegicus V126 trdv AAHX01082968.1 4393 FNVAQKVTQVKSTASRQEGEEVTLDCSYETSQNLYYLFWYKQLQSGDIIFLIRQASSDSQNQRSSRYSVIFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V127 trav AAHX01082971.1 3376 VKGKQVQQSPVSLVLQEGEKAELQCNFSTALSNMQWFFQRPGGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V128 trav AAHX01082976.1 6475 VSRGEQVEQRPSHLSVREGDSAIIICTYTDPNNYYFYWYKKELGAGLQLLMSVLSSVDRKEGQGLIVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V129 trav AAHX01082979.1 24404 GNSAQSVDQPDAHITVSEGASLELRCSYSYSATPSLFWYVQYPGQSLQLLLKYITGDTIVKSTNGFEAEFRKSNSSFNLKKSPAHWRDSAKYYCALR
Rattus norvegicus V130 trdv AAHX01082988.1 32868 TSLDVILEPVAKTFTVIAGNPATFYCTVTGGDLKNYQMSWYKKSENNALFLVYKLNNNSTDDPMGNFKGKINISKSQFILDIQKATMKDAGVYYCGSD
Rattus norvegicus V131 trgv AAHX01091785.1 6774 RQTSSYLEERIMSITRPVGSSVIITCDIHGNDNYIHWYRFQKGQDPQHLLYYNSISSTTVVDSRLDPEKYHVYEGTDRRYKFVLRNVEESDSALYYCATWA
Rattus norvegicus V132 trgv AAHX01091785.1 12517 GRGKLEQPEISISRARDETAEISCKVFVESFQSVAIHWYRQKPNQGLEFLLYVLATPTETFLNKKYKKMKASKNSSASTSILTIYSLEEEDEAIYYCSYG
Rattus norvegicus V133 trgv AAHX01091785.1 17986 LGGSILTSPLVSYVIKRKGNTAFLKCQIKTSALKPNTYIHWYRQKPGQPLQRMLCSSSSENTVYEKGFSEERFEARTWQNDLPSVLRIHQVTEDDMGTYYCACWD
Rattus norvegicus V134 trgv AAHX01091785.1 19810 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYKLKEGEPLKRIFYGSAKAYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Rattus norvegicus V135 trgv AAHX01091790.1 3931 GLGQLKQTKMSVTKATGQSAQIPCIVSVPDFGTTPIHWYRQKTNQQIEYLIFVSTGYNQRPLDGKYKKIEARKDFQTSTSNLTLNYLKKEDEATYYCALW
Rattus norvegicus V136 igkv AAHX01096824.1 45773 STGDIVLTQSPALAVSLEQRATISCKTSQNVDNYGISYMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDIATYYCQQSKDYP
Rattus norvegicus V138 igkv AAHX01102362.1 1149 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMADYYCLQSKESP
Rattus norvegicus V139 igkv AAHX01102363.1 4715 ARCDIQMTQSPSSLSASLGDRVTITCRASQDIGNYLTWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQSIQY
Rattus norvegicus V140 igkv AAHX01102363.1 15481 ARCDIQMTQSPSSMSASLGDRVTITCRASQDIGNYLSWFQQKPGKSPRRMIYGATNLAAGVPSRFSGSRSGSDYSLTISSLESEDMAIYYCLQSIQYP
Rattus norvegicus V141 igkv AAHX01102363.1 40670 ARCNIQMTQSSSSMPASLIDREILACRASQDIRNYLSWYQQKPGKSPKLMISGGTNLAARIPSRFSGSRSGSDYSLTISSLESEDEADYHCLQYDESP
Rattus norvegicus V142 igkv AAHX01102367.1 39619 TSGDVVMTQTPVSLSVAIGQPASISCKSSQSLVHSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSETDFTLKISRVEADDLGVYYCLQG
Rattus norvegicus V143 igkv AAHX01102377.1 18288 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLIHSDGKTYLSWILQRPGQSPKRLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQA
Rattus norvegicus V144 igkv AAHX01102394.1 19254 TSGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVASDKNTYLNWLLQSPGRSPKRLIYQVSKLDSGVPDRFSGSGSEKDFTLKISRVEAEDLGVYYCLQG
Rattus norvegicus V145 igkv AAHX01102401.1 39986 SRGDVVMTQTPVSLSVSLGGQTSISCRSSQSLVHSDGNTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQG
Rattus norvegicus V146 igkv AAHX01102401.1 74671 VNGDIVMTQGALPNPVPSGESASITCRSSKSLVYKDGKTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYP
Rattus norvegicus V147 igkv AAHX01102751.1 3435 ATGDIMMTQSPLSVAVTPGESASISCRSSKSLLHSNGITYLSWYLQRPEKSPQLLIYQISNLASGVSGRFSGSGSGTDFTLKISRVETEDVGIYYCVQFLEVP
Rattus norvegicus V148 igkv AAHX01102755.1 16543 SRGDVVMTQTPVSLPVSLGSQVSITCRSSHSLVYSDGNTYLSWYLQKPGQDPQPLIYKVSNRFSGVPDRFSGSRSGSYFTLKISRGEPEDLGVYYCGQR
Rattus norvegicus V149 igkv AAHX01102767.1 9639 LNGDIVMTQGALPNPVPSGESASITCQSSKSLLHSNGKTYLNWYLQRPGQSPQFLIYWMSTRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDLEFP
Rattus norvegicus V150 igkv AAHX01102982.1 2260 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINRYLNWYQQKLGEAPKLLIYNANSLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSW
Rattus norvegicus V151 ighv AAHX01103195.1 4014 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSSFPMAWVRQAPKKGLEWVASISSGGGGTYYPDSVKGRFTISRDNAKSTLYLQMDSLRSEDTASYYCA
Rattus norvegicus V152 trav AAHX01103265.1 2968 VAQAQSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYSQQGLLLLLKYYSGNPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALR
Rattus norvegicus V153 trav AAHX01103265.1 15930 VSSQQKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELLSIFSTGEKEEGRFKIHVIKANLHVFLHIKDSQPGDSALYFCAV
Rattus norvegicus V154 trav AAHX01103266.1 5251 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V155 trav AAHX01103266.1 8042 GSNGDSVTQTEGQVTLSEGASLTVNCFYETTQYPALFWYVQYPREGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSVVYYCALG
Rattus norvegicus V156 trav AAHX01103266.1 17709 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSASSYFPWYKQEAGKGLHFVIDIISNVDRKENQRFKILLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V157 trav AAHX01103401.1 2186 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V158 trav AAHX01103401.1 5608 EAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDKGAKHSTLHISASLLDDTATYICVVA
Rattus norvegicus V159 trav AAHX01103401.1 13963 VSSQQKVQQSPESLIVPEGGMTSLNCTFSNRASNNFRWYRQHSGKGLELLVSIFSNGEREEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V160 trav AAHX01103402.1 1854 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVS
Rattus norvegicus V161 trav AAHX01103403.1 802 VKGQQVQQSPVSLVLQEGENAELQCKFSTIATELQWFFQHPGGSLVSLLNNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V162 trdv AAHX01103404.1 3699 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYYLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALKEL
Rattus norvegicus V163 trav AAHX01103857.1 8490 VSSQEKVQQSPESLIVPEGARTSLNCTFSDSASLYFAWYRQHPGKEPKELVSIFSTGEKEEGRFKIHVIKANLHVFLHIRDSQPGDSAFYFCAV
Rattus norvegicus V164 trav AAHX01103922.1 949 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDPNNYYFYWYKQEPGAGLQLLMEVFSSTEIKEGQGFIVLLNKNDKRLLLNITAAHLGDSAKYFCAVR
Rattus norvegicus V165 trav AAHX01103922.1 12187 VAQAQSVTQPDAHVTISEEASLQLKCNYSTPRAPSLFWYVQYPQQGLQLLLKYYSGNPVVQGLNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V166 trav AAHX01104037.1 12249 DAQAQSVTQPDAHVIFSEEASLQLRCNYSYPGTPSLFWFVQYPQQGLEMLLKYYSGDPVVQGMKGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V167 trav AAHX01104059.1 7666 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSINQMQWFYQRPGGSLVRLLYNPSGTKQSGRLTSTTVVKERSSSLHISSSQTTDSGTYFCAMEPQCS
Rattus norvegicus V168 ighv AAHX01104120.1 8956 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYSVSWVRQPSGKGPEWMGRMWYDGDTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTR
Rattus norvegicus V169 trav AAHX01104303.1 48 SVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVETQ
Rattus norvegicus V170 trav AAHX01104322.1 764 VSRGEQVEQRLSHLSVREGDSAFIICTYRDSLSSYFYWYKQEPRAGLQLLIMQVFWSTEIKEAQGIIVLLNKKDKRLSLNITSARIGDSATYFCAVSTQCSS
Rattus norvegicus V171 trav AAHX01104322.1 7809 VAQAQSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYSQQGLLLLLKYYSGNPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALR
Rattus norvegicus V172 trav AAHX01104620.1 7860 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSTKQMQWFYQRPGGSLVSLLYNPSGTKQSGRLTSTTVAKERQSSLHISSSQTTDSGTYFCALDAQCS
Rattus norvegicus V173 ighv AAHX01104879.1 8012 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYYMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEETATYYCA
Rattus norvegicus V174 trgv AAHX01105018.1 807 RQTSSYLEERIMLITRLVGSSVIITCDIHGNDNYIHWYRFQKGQDPQHLLYYNSISSTTVVDSRLDPEKYHVYTADRRYKFVLRNVEESDSALYYCATWA
Rattus norvegicus V175 trav AAHX01105266.1 1452 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V176 trav AAHX01105266.1 4798 RSNGDLVTQTEVLVPVTEGLHVVLNCTYQTTYSDISLFWYVQYLNEAPRLLLRSFTDNKRIEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V177 igkv AAHX01105303.1 454 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYKQKPGKSLQLLINDATSLADGVPSKFRGSRSGTQYSLKISRLQDEDFGSYYCQQAHSNP
Rattus norvegicus V178 trav AAHX01105391.1 6904 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIAYPTLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V179 trav AAHX01105631.1 1923 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQHSGKGLELLVSIFSNGQKEEGRFTVHLNIARLQVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V180 trav AAHX01105808.1 3883 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V181 ighv AAHX01108410.1 772 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWMGGIWGDGSTAYNSLLKSRLSISRDTSKSQVFLKMNSQQTEDTAIYFCT
Rattus norvegicus V182 trav AAHX01115641.1 542 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGGSLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDASA
Rattus norvegicus V183 trav AAHX01117154.1 545 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPLGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V184 trdv AAHX01117631.1 151 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V185 trav AAHX01120758.1 809 RSNGDSVTQTEGLVSLTEGSPVVLNCTFQTAYSDISLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSPSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V186 igkv AAHX01126056.1 381 MRCDIQMTQSPSVLSASVGDRVTLNCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCFQHNSW
Rattus norvegicus V187 trav AAHX01127006.1 894 RSNGDSVTQTEGLVSLTEGSPVMLTCTYQTTYSGPTLFWYVQYLSEAPRLLLRSSTDSKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V188 trav AAHX01132148.1 83 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V189 trav AAHX01133565.1 505 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSSSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V190 trav AAHX01136923.1 342 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V191 trav AAHX01138935.1 1045 DGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V192 ighv AAHX01139413.1 161 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSSFAMAWVRQAPTKGLEWVASISYDGGNTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTSTYYCAK
Rattus norvegicus V193 trav AAHX01145162.1 543 ESHGEKVEQVLSTLSVQEGDTAVTNCTYTDSASSYFPWYKQGAGKGLHFVIDIRSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAA
Rattus norvegicus V194 igkv AAHX01146913.1 85 VTSKMTQSPSFLSASVGDRVTINCKASQNINKYLDWYQQKLGEAPKLLIYNTNSLHTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSG
Rattus norvegicus V195 trdv AAHX01151794.1 1102 CNVAQKVTQVQSTASRQEGEDITLDCSYETSYVEYYLFWYKQLLSGEMVFLIHQISSTAEERSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALSEL
Rattus norvegicus V196 trdv AAHX01156281.1 387 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNLYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCVLWEL
Rattus norvegicus V197 igkv AAHX01163417.1 119 STGDTVLTQSPALAVSPGERVTISCRASESVSTLMHWYQQKPGQQPTLLIYLASNLESGVPAMFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNSP
Rattus norvegicus V198 trav AAHX01172476.1 477 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V199 igkv AAHX01176317.1 100 TRCDIRMTQTPASLSASLGESVTITCRASQDIGKSLLWFQQKTGKPPKILIYTASNLVSGISPRFSGSGSGTQFSLKISSLKPEDTANYYCCQGYSLS
Rattus norvegicus V200 trav AAHX01181640.1 645 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYLQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V201 trav AAHX01195384.1 319 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGESLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V202 trav AAHX01196548.1 635 VSRGEQVEQHLSHLSVREGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V203 igkv AAHX01198451.1 497 MRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V204 trav AAHX01205553.1 1373 VAGKTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDTGRGPVSLTVLTNKEEKTSRGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V205 trav AAHX01207813.1 823 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V206 trav AAHX01210551.1 770 VNSQRGEENRLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGRGPALLVLIRSNEREKHSGRLRATLDTSSQSISLSISAAQSADTAVYFCATD
Rattus norvegicus V207 ighv AAHX01210785.1 88 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGVIWSGGNTDYNSALKPRLSISRDTSKSQVFLTMNSLQTEDTGIYYCNR
Rattus norvegicus V208 trav AAHX01211566.1 412 RSNGDSVTQTEGLVSLTEGSPVVLNCTYQTTYSASTLFWYVQYLNKAPELLLRSSTDSKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V209 trav AAHX01215384.1 602 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDRKETQKFTVLMDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V210 trav AAHX01218396.1 106 ANSQRGEENLLGLSTQEGENVTINCTYKTYTAVLQWYRQDSGGGPALLVLIRSNEREKHSGRLRTTLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V211 trav AAHX01220507.1 345 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V212 trav AAHX01225266.1 2176 VSSQQKVQQSPESLSVSEGAIVSLNCTFSDSASQSFWWYQQHLGKGPKMLISVFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V213 ighv AAHX01228568.1 503 KLSCKNSYFSFRRQFLSSYCMSWVKKRPEQGMEWIGYINLYSGDTSYNQKFKEKATLSTDTSSKTAYMQLSSLVSEDSVVYYCARHSVVTTS
Rattus norvegicus V214 trav AAHX01230164.1 246 VSRGEQVEQHLSHLSVLEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V215 trav AAHX01231705.1 102 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASK
Rattus norvegicus V216 trav AAHX01231705.1 2817 MNSQVAEENPWALRILEGENITVNCSYKTSLTALLWYRQNSGQGPALLMLIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V217 ighv AAHX01237203.1 96 VLSQVQLKESGPGLVKPSETLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWMGVIWGDGSTAYNSALKSRLSISRDTSKSQVFLKMSSLKTEDTATYYCAR
Rattus norvegicus V218 trav AAHX01239268.1 352 VAQAQSVTQPDAHVTVSEEASLQLRCKYSSSVSPSLFWYVQYPQQGLLLLLKYYSGNPMVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V219 trav AAHX01242755.1 170 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGESLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V220 trav AAHX01247290.1 288 MNSQVAEENPWALRILEGENVTVNCSYKTSIAALLWYRQKSGQGPALVVLIRSNEREKHSGRLRATLDTSSQSSSLSISAAQSADTAVYFCATD
Rattus norvegicus V221 trav AAHX01247992.1 502 MSQGKQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPRKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V222 trdv AAHX01249061.1 82 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V223 trav AAHX01250418.1 477 VSSQQKVQQSPESLTVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V224 trav AAHX01256088.1 326 TSMAQKVMQTQASISVMETKTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDYYKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V225 trav AAHX01259047.1 723 ESHGEKVEQVLSTLSVQEGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDKKETQRFKILLDKKAKKFSLHITATQAEDSAIYFCSAS
Rattus norvegicus V226 trav AAHX01262983.1 806 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSVQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V227 trav AAHX01264843.1 283 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V228 trav AAHX01266277.1 111 MNSQVAEENPWALRIHEGENVTVNCSYKTSIIALQWYRQDSGGGPALLVLICSNEREKHSGRLRATLDTSSQSSSLFITAAQSADTAVYFCATD
Rattus norvegicus V229 trav AAHX01270376.1 840 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V230 trav AAHX01276861.1 2072 VSSQQKVQQSPESLSVSEGAIASLNCTFSDSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLRASLHITDSQPSDSAVYLCAAS
Rattus norvegicus V231 trav AAHX01280442.1 3381 VRGDNVQQSPSALSLHEGTNPALRCYFSTSMKSVQWFRQIPRGSLISLFFLAPGTKEIGRLKSTFDSKERYSTLHISGAQLEDSGTYFCAAFRK
Rattus norvegicus V232 trav AAHX01280647.1 1370 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLPGKGLELLVSIFSNGEKEEGRFTAHLNIARLHVSLHIRDLGPSDSAVYLCAV
Rattus norvegicus V233 trav AAHX01293337.1 252 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V234 igkv AAHX01295759.1 133 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGNTYVNWYLQKPGKSPQFLIYRMSNLASGVPDRFSGSGSETDFTLKISKVETEDVGVYYCGHGLEYP
Rattus norvegicus V235 trav AAHX01297624.1 115 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V236 trav AAHX01297721.1 306 VSSQQKVQQSPESFTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V237 trbv AAHX01298280.1 779 HMEAAVTQSPRNKVTVTGKNVTFNCHQTDNHNYMYWYRQDMGHGLRLIHYSYGSGSFENGDIPEGYKVSRPNQENFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V238 trav AAHX01301327.1 46 ESHGEKVEQVLSTLSVQEGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDKKETQRFKILLDKKAKKFSLHITATQAEDSAIYFCSAS
Rattus norvegicus V239 igkv AAHX01303147.1 384 TCGDIVMTQTPSSQAVSAGEKVTMSCKSSQSLLYSENKKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCQQYYNFP
Rattus norvegicus V240 trav AAHX01307242.1 2553 VSSQQKVQQSPESLTVPEGARTSLNCTFSDSTSRYFAWYRQDPGKEPKELRSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V241 igkv AAHX01307709.1 471 MRCDIKMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSR
Rattus norvegicus V242 trav AAHX01312587.1 434 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V243 trav AAHX01314922.1 238 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V244 trav AAHX01322903.1 40 RTHGDSVTQTEGQMTISENGFLRINCTYSATSIRYPTLFWYVQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V245 trav AAHX01332539.1 37 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V246 trav AAHX01332857.1 53 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V247 trav AAHX01339237.1 430 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V248 trav AAHX01341044.1 223 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V249 trav AAHX01352202.1 54 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V250 trdv AAHX01356533.1 1140 CNMAQKVTQAHSSASRQEGEEVTLECSYETSYGSYYLFWYKQLLSGEMVFLILQPSFDSQNQRRGRYSVIFQQSLKSISLVISASQPEDSGTYFCALWET
Rattus norvegicus V251 ighv AAHX01367666.1 239 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V252 trav AAHX01384645.1 352 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V253 igkv AAHX01391907.1 644 MRCDIQMTQSPSFLSATVGDRVTINCKASQNINKYLNWYQQKLGEAPKRLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCLQHNSG
Rattus norvegicus V254 trav AAHX01392583.1 70 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLYISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V255 igkv AAHX01422375.1 347 MRCDIQMTQSPPVLSASVGDRVTLSCKASQNINKNLDWYQQKHGEAPKLLIYYTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V256 ighv AAHX01422725.1 167 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V257 trav AAHX01438998.1 119 VKGQQVQQSPVSLVLQEGEKAELQCTFSTAFNSMQWFYQNPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V258 trav AAHX01452278.1 579 VSRGEQVEQHLSHLSVLEGDSAVIICTYTDSLSSYFYWYKHEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V259 igkv AAHX01459607.1 807 ADGNIVMTQSPKSMSISVGDRVTMNCKASQNVYNNIAWYQQKPGQSPKLLIYYASNRYNGVPDRFTGSGYGTDFTLTINSVQAEDAAFYYCQRIYNSP
Rattus norvegicus V260 trav AAHX01464573.1 165 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIRYPTLFWYFQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V261 trav AAHX01467314.1 183 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V262 trav AAHX01468963.1 586 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V263 trav AAHX01472728.1 496 RSNGDSVTQTEGRVLVTEGLHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSSRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V264 igkv AAHX01473159.1 397 MRCDIQMTQSPSLLSASVGDRVTLSCKASQSIYSSLAWYQQKLGEAPKLLIYSANSLQTGIPSRFSGSGYGTDFTLTISSLQPEDVATYFCHQYYSW
Rattus norvegicus V265 igkv AAHX01476055.1 792 STGDIVLTQSPALAVSPGQRATISCRASQSVSISSVNLMNWYQQKPGQQPKLLIYHASNLASGIPTRFSGSGSGTDFTLTIDPVQADDIATYYCQQSRESP
Rattus norvegicus V266 ighv AAHX01477500.1 563 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V267 trav AAHX01488706.1 52 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V268 igkv AAHX01493358.1 158 MRCDIQMTQSPSFLSASVGERVTLSCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCLQRNSW
Rattus norvegicus V269 trav AAHX01498503.1 398 VSSQQKVQQSPESLSVSEGAIASLNCTFSNSASQSFWWYQQHPGKGPKMLISVFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V270 igkv AAHX01021002.1 4178 SNGQITLTQQAESLWVSPGEKVSITCRASQSLLYTDGKHYLSWYQQRPGQTTKALIYHASIRTDGVPTRFIGSGSGTEFTLSIEDVQPEDIALYYCLQTLKKP
Rattus norvegicus V271 igkv AAHX01021003.1 6894 STWNIVLTQSPASLAVILGQKATISCTASESVNKFGINLMHWYQQKPGQLPKILIYNEFSRAPGIPARFSGDEAELNFTLTIEPVEADDVATYYCQQGLTFP
Rattus norvegicus V272 igkv AAHX01021022.1 4447 VYGNTVMTQSPTSMFTSVGDRVTISCKASQNVGINVAWYQQETGQSPKRLINWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHKSYP
Rattus norvegicus V273 igkv AAHX01021027.1 13231 TCGDILINQSPASLTVSAGEKVTMSCKSSQSLLYSENNQDYLAWYQQKPGQFPKLLIYGASNRHTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCEQTYSYP
Rattus norvegicus V274 igkv AAHX01021033.1 8323 TCGDIVMTQSPSSLAVSAGETVTINCKSSQSLLSSGNQKNYLAWYQQKPGQSPKLLIYLASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQHYSYP
Rattus norvegicus V275 igkv AAHX01021037.1 27526 STGDTVLTQSPALAVSPGERVTISCRASESVSTGMHWYQQKPGQQPKLLIYGASNLESGVPARFSGSGSGTDFTLTIDPVEADDTATYFCQQSWNDP
Rattus norvegicus V276 igkv AAHX01021040.1 21498 TCGDIAITQSPSSVAVSVGETVTLSCKSSQSLLYSENNKDYLGWYQQKPGQTPKPLIYWATNRHTGVPDRFTGSGSGTDFTLIISSVQAEDLADYYCEQYFVYP
Rattus norvegicus V277 igkv AAHX01021045.1 886 TCGDIVMTQTPSSQAVSAGEKVTMSCKSSQSLLYSGDQKNYLAWYQQKPGQSPKLLIYLASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQHYSYP
Rattus norvegicus V278 igkv AAHX01021046.1 1733 TCGDIVMTQTPSSQAVSAGEKVTMSCKSSQSLLYSENKKNYLAWYQQKPGQSPKLLISWASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLAVYYCEQYYDTP
Rattus norvegicus V279 igkv AAHX01021052.1 4284 STGDIVLTQSPALAVSLGQRATISCRASESVRSSMHWYQQKSGQQPKLLIYGASNLASGVPARFSGSGSGTDFTFTIDPVEADDIATYYCQQSRNDP
Rattus norvegicus V280 igkv AAHX01021060.1 29946 TKGDVVLTQTPSTLSATIGQSVSISCRSSQSLLDSAGNTYLYWYLQRPGQSPQLLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V281 igkv AAHX01021063.1 3049 TKGDVVLTQTPSILSATIGQSVSISCRSSQSLLDSDGNTYLYWFLQRPGQSPQRLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQATHAP
Rattus norvegicus V282 igkv AAHX01021071.1 14434 SKGDVVLTQSPATLSVTPGERISLSCRASESVDTYLHWYQQKPNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINGVELEDLSIYYCQQGNSLP
Rattus norvegicus V283 igkv AAHX01021075.1 19564 AQCDIHMTQNPVSLSAFIGDKVTITCWASQDISRYLGWYQQKQGQSPKFLMYYASNLLSVVPSRFSGSGSGTEYSLTITGIQPEDAATYFCQQCYSYP
Rattus norvegicus V284 igkv AAHX01021077.1 11128 GICDIQMTQSPASLSASLGETISIECRASEDIYSNLAWYQQKSGKSPQLLIYAANRLQDGVPSRFSGSGSGTQYSLKISGMQPEDEGDYFCLQGSKFP
Rattus norvegicus V285 igkv AAHX01021079.1 22651 AICDIQMTQSPASLSASLGETVTIECRASEDIYNGLAWYQQKPGKSPQLLIYNANSLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQQYYDYP
Rattus norvegicus V286 igkv AAHX01021079.1 3551 TNGDVVLTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRPGQPPQLLIYLVSRLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCVQSTHAP
Rattus norvegicus V287 igkv AAHX01021089.1 460 AICDIQMTQSPASLSASLGETVTIECLASEDIYSNLAWYQQKPGKSPQLLIYYANSLNDGVPSRFSGSGSGTQYSLKINSLQSEDVSIYFCQQNYDSP
Rattus norvegicus V288 igkv AAHX01021096.1 19344 TNGDVVLTQTPPTLLATIGQSVSISCRSSQSLLHSNGNTYLNWLLQRTGQSPQPLIYLVSKLESGVPNRFSGSGSGTDFTLKISGVEAEDLGVYYCMQFTHYP
Rattus norvegicus V289 igkv AAHX01021097.1 29584 SRGDIVLTQSPAMLSVTSGESISLSCRSSQNIGTNIHWYQQKSNESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINRVEPEGFSVYYCQQSNSW
Rattus norvegicus V290 igkv AAHX01021097.1 10861 AICDIQMTQSPHSLSASLGETVSIECLASEGISNYLAWYQQKPGKSPQLLIYYASSLQDGVPSRFSGSGSGTQYSLKISNMQPEDEGVYYCQQGYKYP
Rattus norvegicus V291 igkv AAHX01021102.1 22624 IVSNGEIVLIQSLTTMTASPGEKVTITCSGSSSVRYMYWYQQKSGASPKLCIYDTSNLASGVSDRFSGSGSGTSYYLTISTIEAEDAATYYCQQWSSNQ
Rattus norvegicus V292 igkv AAHX01021102.1 7568 SSGEIILTQSPTIMAASLGEKITITCSASSSLSYMYWYQQKSGASPKLWVHRTSNLASGVPDRFSGSGSGTSYYLTISTMEAEDAATYFCHQWSSSQ
Rattus norvegicus V293 igkv AAHX01021110.1 57990 AICDIQMTQSPASLSASLGETVSIECLASEGISNDLAWYQQKSGKSPQLLIYAASRLQDGVPSRFSGSGSGTRYSLKISGMQPEDEADYFCQQSYKYP
Rattus norvegicus V294 igkv AAHX01021115.1 15291 IVSSGEIVLTQSPTTTAASPGEKVTITCLASSSVSNMYWYQQKSGASPKLLIYSTSSLASGVPDRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSN
Rattus norvegicus V295 igkv AAHX01021118.1 11970 IVSNGEIVLTQSPTTMATSPGKKVTITCRASSSVSYMHWYQKSGTAPKLWIYGTSNRASGVPDRFSGSGSGTSYSLTISSMEAEDAATYYCQQWDSI
Rattus norvegicus V296 igkv AAHX01021128.1 10933 LVSSREIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQMSNASPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCST
Rattus norvegicus V297 igkv AAHX01021135.1 3877 TVSSGEIVLTQSPTTMAASPGEKVTITCHASSSVSYMHWYQQKPGASPKPWIYATSTLASGVPDRFSGSGSGTSYSLTINNVEAEDAATYYCQQWNY
Rattus norvegicus V298 igkv AAHX01021137.1 23935 LVSSGDNVLPQSPTTMAASPGEKVTITCHASSSGIYMNWHQQKSGTSPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCSTP
Rattus norvegicus V299 igkv AAHX01021137.1 3021 TVSSGEIVLTQSPTTMAASPGEKVTITCRASSSVSYMYWYQQKSGASPKPWIYETSKLASGVPDRFSGSGSGTSYSFTISSMETEDAATYYCHQWSST
Rattus norvegicus V300 igkv AAHX01021142.1 21624 SKGEIVLTQSPVSITASQGEKVTITCRASSSISSNYLHWYQQKAGSYPKLLIYRTSILASGFPDSFSGSGSDTSYTLTISCMQDEVAASYYCQQGSSS
Rattus norvegicus V301 igkv AAHX01021142.1 5453 VSCDIQMTHATSFLSTSLGDHLTINCRSNKDINKYLAWVQQKPGKAPRMLIHFASTLLPGVPAKFEGSGSGTDFSLTVRNIESQDIAMYYCLQYSEHP
Rattus norvegicus V302 igkv AAHX01021147.1 2292 SRGDVVLVTQTPSSLPVSLGDQASISCKSSKSLVHNNGITYLAWFLQKPGQLPQSLIHTVSNRFSGVPDRFSGSGSVSDFTLKISRVEPEDLGVYYCLQYVHYP
Rattus norvegicus V303 igkv AAHX01021151.1 5197 ARCDIQLTQSPSTLPASLGERVTISCRASQSISNSLNWYQQKPDGTVKRLIYSTSTLESGVPSRFSGSGSGTDYSLSISSLESEDFAMYYCLQYATY
Rattus norvegicus V304 igkv AAHX01021152.1 9239 STGDVVMTQTPVSLSVSLGNQASISCRSSQSLFHSDGNTYLSWYLQKPGQSPQLLIYLASNRFSGVSNRFSGSGSGTDFTLKISRVEPEDLGVYYCFQH
Rattus norvegicus V305 igkv AAHX01021169.1 895 ARCDIQMTQTPSSMPASLGERVTISCRASQGISNYLNWYQQKPDGTIKPLIYYTSNLQSGVPSRFSGSGSGTDYSLTISSLEPEDFAMYYCQQYDSSP
Rattus norvegicus V306 igkv AAHX01021176.1 65032 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLSWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCLQAYSAP
Rattus norvegicus V307 igkv AAHX01021176.1 42585 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDPGIYYCLQGYSAP
Rattus norvegicus V308 igkv AAHX01021176.1 4259 GKCDIQMTQSPASLSASPEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYSATSLADGIPSRFSGSRSGTQYSLKISRLQVEDTGIYYCLQRYSNP
Rattus norvegicus V309 igkv AAHX01021177.1 17857 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKISRLQVEDIGIYYCQQASSAP
Rattus norvegicus V310 igkv AAHX01021178.1 47085 GKCDIQMTQSPASLSASLEEIVTITCQPSQGIGNYLSWYQQKLGKSPQLLIHSATSLEDGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQISSTP
Rattus norvegicus V311 igkv AAHX01021178.1 20997 GKCDIQMTQSPASLSASLEEIVTITCQASQDIGNYLSWYQQKPGKSPQLLIHSATSLADGVPSRFSGSRSGTQYSLKINRLQVEDTGIYYCLQHYSAP
Rattus norvegicus V312 igkv AAHX01021178.1 1535 GKCDIQMTQSPASLSASLDEIVTITCQASLDIGNWLAWYQQKPGKSPQLLIYGATSLADGVPSRFSGSRSGTQYSLKICKLQVEDTGIYYCLQHYSAP
Rattus norvegicus V313 igkv AAHX01021182.1 853 MRCDIQMTQSPSLLSASVGDRVTLSCKASQSIYNSLAWYQQKLGEAPKLLIYKTNSLQTGIPSSFSGSGSGTDYTLTISSLQPEDVATYFCQKYNSG
Rattus norvegicus V314 igkv AAHX01021187.1 8817 MRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V315 trbv AAHX01029745.1 24052 PLETAVFQTPKHRVAQVGSEVFFKCDQTLGHDTMYWYKQDSKQLLKVMFSYNNKQRILNETASSRFLPQSSDKAHLNLRIKSVEPGDSAVYLCASS
Rattus norvegicus V316 trbv AAHX01029747.1 2387 PANSGVVQSPRHIIKEKGGRSILKCIPISGHRSVAWYQQTQGQELTFLIQKYEQMDRGKGNLPSRFSVQQFSDYHSEMNMSALELEDSAVYFCASS
Rattus norvegicus V317 trbv AAHX01029748.1 29468 SAHSGVVQSPRHIIKEKGGRSILKCIPISEHNNVAWYQQTHGQELKFLIRHYEKSEREKGNLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Rattus norvegicus V318 trbv AAHX01029748.1 26834 HMEAAVTQSPRNKVTLKGGKVTLSCKQNNNHNNMFWYRQDMGHGLRLIHYSYDVNSTEKGDVPNGYKVSRPSQGDFFLTLESASPSQTSVYFCASSE
Rattus norvegicus V319 trbv AAHX01029748.1 23228 SAHSGVVQSPRHIIKEKGGRSILKCIPISEHNNVAWYQQTHGQELKFLIRHYEKSEREKGNLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Rattus norvegicus V320 trbv AAHX01029748.1 13255 HVEAAVTQSPRNRVAVTGGEVTLSCRQTNNHDYMYWYRQNMGDELRLIHYSYDVNRTEKGDVSSGYKASRPSQEDFSLILESASLSQTAVYFCASSD
Rattus norvegicus V321 trbv AAHX01029748.1 6645 LSETGVTQSPRYAIIQESQTVSFWCDPVSGHERLYWYQQHRAQGPRLLVYFQNEVDIDKSQLPKDRFFAVRTEGVNSTLKIQSAKQSDSATYLCASSL
Rattus norvegicus V322 trbv AAHX01029748.1 1595 NADAGVTQTPRHEVAEKGQTIILTCEPVSGHNDLFWYRQTKIKGLELLSYFLNKSPMEDAGALKDRFTAEIQDSSISTLKIQPTEPQDSAVYLCASSL
Rattus norvegicus V323 trbv AAHX01029750.1 3049 PTNAGVIQTPRHKVTGKGQEVTLRCEPISGHSAVFWYRQSTVKGLELLIYFNNQAPIDDSGMPKERFSAQMPNQRLSTLKIQTTQPQDSAVYLCASSL
Rattus norvegicus V324 trbv AAHX01029751.1 42227 FVDTMVMQNPRYKVARVGKPVNLICSQTMDHDSMFWYQQKPNQGPKLLLYYYDSNLNRETDTSDNFQSSRHNTSFCSLNITSAGLGDSAMYLCASSR
Rattus norvegicus V325 trbv AAHX01029751.1 28950 TTHGGAITQTPKFLIGHEGQELTLKCKQNFNHDSMFWYRQDPGKGLRLIYYSITESDLQKGDLSEGYDASRKEKASFSLTVKSAQKRQMAVYLCASSI
Rattus norvegicus V327 trbv AAHX01029751.1 9141 SMDSGVIQSPRHLVKGKEQKARMQCTPIKEHSYVYWYYKKLGEDLKFLVYFQNTDIMDKTDMIKKIISAECFTNKTCTIEIKSSKLTDSAVYYCASSQ
Rattus norvegicus V328 trbv AAHX01029752.1 11671 SLDCQVIQTPQHLLRGKGQKAKMTCIAEKGHTFVYWYQQKQNKELKFLIYFQRQEPRDSIDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Rattus norvegicus V329 trbv AAHX01029752.1 8361 SFDAAVIQTPRHLIKMKGQQVEMNCNPEKDHPAVFWYQQKQSKELKFLIYFQNQRPVDQIDMVKERFSAEWPSNSLCSLKISTSEVEDSALYLCSSSQ
Rattus norvegicus V330 trbv AAHX01029752.1 6205 SFVAEVTQTPRYLIKEKGQRVNMSCSPEKAHTAFYWYQQNQKKELTFLINFRKVDIIDQTDLVKKRFSAQCVPDLHCTLEIPSSEEGDSALYFCASSL
Rattus norvegicus V331 trbv AAHX01029758.1 3194 LVDMNVTQMPRNLIKRVGKNVLLECVQDMKHERMYWYRQDPDLGLRLIYLSYDVDSNSEGDIHKGYKVSRKKRENFSLILESAKTNHTSVYFCASSL
Rattus norvegicus V332 trbv AAHX01029759.1 1153 SVFSVFLYQKPNRDICQSGTSLKIQCVVDSQVALMFWYQQFQGQNLMLMATANEGSEATYESGFSREKFPISRPNLTFSTLTVNNARPEDSSVYFCSSG
Rattus norvegicus V333 trbv AAHX01029771.1 23335 VSAQTIHQWPAVKVQAVGSPLSLECTVKGTSNPNLYWYWQAPGGTLQQLFYSFNVGQSELVVQRNLSASRPKSEQFILSTEKLLLTHSGFYLCAWS
Rattus norvegicus V334 igkv AAHX01030723.1 19805 SRAETTVTQSPASLSMAVGEKVSISCKTSTDIDDDMNWYQQKSGEAPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTINNVLLGDEGIYYCQQSDNVP
Rattus norvegicus V335 igkv AAHX01030729.1 13446 ADGDIVMTQSPTSMSISVGDRVTMNCKASQNVGSNVDWYQQKTGQSPKLLIYKASNRYTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQSNSYP
Rattus norvegicus V336 ighv AAHX01046806.1 36547 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYNMAWVRQAPKKGLEWVATISYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V337 ighv AAHX01046811.1 3540 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVSWVRQPPEKGREWIGAIWTGGSTDYNSALKSRLSISRDTSKSQVLLKMNSLQTEDTAMYFCAR
Rattus norvegicus V338 ighv AAHX01046813.1 10369 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYFCTR
Rattus norvegicus V339 ighv AAHX01046815.1 79970 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMHWIRQAPTKGLEWVASISPSGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCAT
Rattus norvegicus V340 ighv AAHX01046815.1 49618 VQCEVQLVESGGGLVQPGRSLKFSCAASGFTFSDYAMAWVRQAPKKGLEWVATIIYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V341 ighv AAHX01046817.1 4992 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYYMAWVRQAPTKGLEWVASISYDGGSTYYRDSVKGRFTISRDNAKSSLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V342 ighv AAHX01046819.1 56476 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYNSALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCAR
Rattus norvegicus V343 ighv AAHX01046819.1 48620 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVCQAPKKGLEWVATISPSGGSNYYRDSMKGRFTISKDNAKSTLYLQMDTWRSEDTATYYCTT
Rattus norvegicus V344 ighv AAHX01046819.1 28080 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPTGKGLEWMGVIWTGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDIATYYCAR
Rattus norvegicus V345 ighv AAHX01046819.1 19802 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSDYYMAWVRQAPKKGLEWVASISYEGSSTYYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCA
Rattus norvegicus V346 ighv AAHX01046821.1 76015 VLSQVQLKESGPGLVQPSQTLSLTCTVAGFSLTSYNVHWVRQPPGKGLEWMGVIWNTGGTRYNSALKSRLSISKDTSKSQVFLKMNSLQTEDTATYYCAR
Rattus norvegicus V347 ighv AAHX01046821.1 65626 VLSQVQWKESGPDLVQPSQTLSLTCTLSGFSLAGYDLQWVQQLPGKGLKWMGGIWGDGSTAYNSLLKSQLSISRDTSKSLVFLKMNSLKTEGTAMYYCAREGS
Rattus norvegicus V348 ighv AAHX01046821.1 41514 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSCGVHWVRQPPGKGLEWIAAIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLKTEDTVMYYCTR
Rattus norvegicus V349 ighv AAHX01046821.1 791 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYYMAWVRQAPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V350 ighv AAHX01046822.1 19358 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVRQAPTKGLEWVAYISTGGGSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V351 ighv AAHX01046827.1 38000 VLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQPPGKGLEWMGIIWRNGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTR
Rattus norvegicus V352 ighv AAHX01046827.1 21636 VQYEVKLVESGEGLVQPGRSLKLSCAGSGFTFDDYRMAWVCQAPKKGLEWLAAINRNGGSTYYPDTVKGQFTICRDNDKSALYLQMNDLISEDTSMYYCA
Rattus norvegicus V353 ighv AAHX01046827.1 12108 VQCEVKLVESGGGLVQPGSPLKLSCAASGFTFSSNWLNWIRQAPGKGLEWVASINPDGSSTLYPDTVKGRFVVSKDNAKNTRYLQMNNLRSEDTAMYYCAR
Rattus norvegicus V354 ighv AAHX01046831.1 7657 VQCEVQLVESGGGLVQPGSSLKVSCVASGFTFSSYVMHWFRQAPENGIEWLAFINTDSSNTHYAETVKGRVTISRDNAKNTVDMQLSSLRSEDTAMYYCARE
Rattus norvegicus V355 ighv AAHX01046832.1 2018 VLSQVQLKESGPGLLLSSETLSLTCTVSGFSLTSYDVSWVRQLPGKGLEWMGGVWIGGNTEYNSDLKSRLSISRDTSKSQVFLKMSNLKTEDTGTYYCAR
Rattus norvegicus V356 ighv AAHX01046835.1 104090 VWCEVQLVESGGGLVQPGSSLKLSCVASGFTFSSYNMHWIRQAPKKGLEWIALIYYDSSNKYYADSVKGRFTISRDNSKNTLYLEMNSLRSEDTAMYYCA
Rattus norvegicus V357 ighv AAHX01046835.1 57726 VLSQVQLKETGPGLVQPTQTLSITCTVSGFSLTSYYMQWVRQTPGKGLEWMGFIRSGGSTEYNSEFKSRLSISRDTSKNQVFLKMNSLKTEDTGVYYCAR
Rattus norvegicus V359 ighv AAHX01046835.1 24600 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGRMRYNGDTSYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTR
Rattus norvegicus V360 ighv AAHX01046835.1 16354 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSSFPMAWVRQAPTKGLEWVATISTSGGSTYYRDSVKGRFTISRDNAKSTLYLQMNSLRSEDTATYYCTR
Rattus norvegicus V361 ighv AAHX01046838.1 12912 ALSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVNWVRQPPGKGLEWMGTIWNDGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYLCAR
Rattus norvegicus V362 ighv AAHX01046844.1 3488 IHCEVKLLESGGGLVQSGASLRLSCVASGFTFSDFFMDWVRQAPGKGLEWIAASRNKARDYSAVYSASVNGRFTISRDISQSILYLQMNTLKAEDTATYYCVRN
Rattus norvegicus V363 ighv AAHX01046845.1 64456 VQCEVKLVESGGGLVQPGRSLKLSCAASGFNFNDYWMGWVRQAPGKGLEWIGEINKDSSTINYTPSLKDKFTISRDNAQNTLYLQMSKLGSEDTAIYYCAR
Rattus norvegicus V364 ighv AAHX01046853.1 9839 VKGEVKLVESGGGLLKPGGSLKLSCVASGFTFSNYWMHWVRQAPGKGLEWIGEIEYDGTETNYAPSIKDRFTISRDNAKNTLYLQMSSVRSEDTATYFCTT
Rattus norvegicus V365 ighv AAHX01046858.1 59348 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSNYWGWIRKFPGNKMEWIGHISYSGSTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Rattus norvegicus V366 ighv AAHX01046858.1 22945 VQCEVQLVESGGGLVKPGASLKLSCVASGFTFSDYWMSWVRQTPGKTMEWIGDIKYDGSYTNYAPSLKNRFTISRDNAKSTLYLQMSNVRSEDTATYYCTR
Rattus norvegicus V367 ighv AAHX01046858.1 8192 VYAEVQLQQSGPELRRPGSSVKLSCKASGYSITDYLMHWVKHRPEHGLEWIGWIDPEDGETKYAQKFQSKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V368 ighv AAHX01046866.1 40977 IQCEVKLLESGGGLVQPGGSMRLSCAASGFTFTDFYMNWIRQPAGKAPEWLGFIRNKANGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCA
Rattus norvegicus V369 ighv AAHX01046866.1 11402 GAQAQIQLVQSGPELKKPGESVKISCKASGYTFTDYAMHWVKQAPGKGLKWMGWINTYTGKPTYADDFKGRFVFSLEASASTANLQISNLKNEDTATYFCA
Rattus norvegicus V370 ighv AAHX01046880.1 34279 VYSEVQLQQSGPEVGRPGSSVKISCKASGYTFTDYVMNWVKQSPGQGLEWIGWIDPEYGSTDYAEKFKKKATLTADTSSSTAYIQLSSLTSEDTATYFCA
Rattus norvegicus V371 ighv AAHX01046880.1 902 TQAQIQLVQSGPELKKPGESVKISCKASGYTFTNYGMYWVKQAPGQGLQYMGWINTETGKPTYADDFKGRFVFFLETSASTAYLQINNLKNEDMATYFCA
Rattus norvegicus V372 ighv AAHX01046882.1 52588 TQSQIQLKESGPAVIEPSQSLFLICTVSRFSITSGYCWHWTRQILGKRLEWMGRICYEGSTYYSPSFKSRSTLSSDTSLNKFYILLNSVTAEDTAMYYCFRE
Rattus norvegicus V374 ighv AAHX01046886.1 7117 IQCEVKLVEYGGGLVQPGASLRLSCEASGFTFSDFYMEWIRQAPGKGLEWIAASRNKANDYSTVYSASVKDRFTISRDTYKSILYLQMNTLKPEDTAIYYCARD
Rattus norvegicus V375 ighv AAHX01046887.1 9692 VQCEVQLVESGGGLVQPGGSLKLSCVASGFTFRDYWMNWVRQAPGKTMEWIGDIKPDGSNTNYAPSVKNRFTISRDNAKSILYLQMSNMRSDYTATYYCVR
Rattus norvegicus V376 ighv AAHX01046888.1 58568 VQCEVQVLESGGGLVQPGNSLKLSCATSGFTFSTAWMYWYRQFPEKRLEWVARIKAKSNNYATDYTESVKGRFTISRDDSKSSIYLQMNNLKEEDTAIYYCA
Rattus norvegicus V377 ighv AAHX01046888.1 45581 IQCEVQLVETGGGLVRPGSSLKLSCATSGFTFSNTWMNWVRQAPGKGLEWVALIKDKYSNYEANYAESVKGRFTISRDDSKSRVYLQMNTLRDQDTATYYCT
Rattus norvegicus V378 ighv AAHX01046888.1 21326 AQAQIQLVQSGPEVKKPGESVKISCKASGYTFTQAGMQWLKQAQGKSLKWMGWINTNTGKTTYAADFTGRFVFSLETSASTAYLQITNLKNEDMATYFCA
Rattus norvegicus V379 ighv AAHX01046888.1 4242 VNSEVQLQQSGPELQRPGASVKLSCKASGYTFTEYYMYWVKQRPKQGLELIGRIDPEDGSTDYVEKFKNKATLTADTSSNTAYMQLSSLTSEDTATYFCA
Rattus norvegicus V380 ighv AAHX01046892.1 23660 AHCEVQLMETGGGLVQPGKSLKLTCATSGFTFSTAWMNWVRQSPEKGLEWIARIKPKSTNYATEYAESVKGRFTISRDDSKSSIYLQMNSLKEEDTATYYCT
Rattus norvegicus V381 ighv AAHX01046892.1 5810 VHCEMQLVESGGGLVQPNGSLKLSCAASGFTFNTYDMSWVSQSPGKGLELVAGISIKSYNYATFYADSVKGRFTISRDDSQSMVYLQMNNLKTEDTALYYCTA
Rattus norvegicus V382 ighv AAHX01046903.1 31288 VLCEVKLEESGGGLVQPGVSLKLSCATSGFTFSNYWMEWVRQSPGKGLEWVAEIRTKANNYATYYGESMKGRFTISRDDSKSMVYLQMNSIRSEDTGIYYCT
Rattus norvegicus V383 ighv AAHX01046905.1 59866 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGKGLDWVASISIKTHNYATLYADSVKERFTISRDDSQSMVYLQMNNLKTEDTALYYCTV
Rattus norvegicus V384 ighv AAHX01046905.1 24290 VLSQVTLKESGPGMLQPSQTLSLTCTFSGTSLSTSNMGLSWLRQPSGKGLEWLASIWNNDNYYNPSLRSRLTISKETSKNQVLLKFTSMEPADTATYYCAWR
Rattus norvegicus V385 ighv AAHX01046906.1 79410 LVESAGGLVQTKGSLKLSCAASGFTFDTYAMNWVRQAPGKGLEWVASIRSKSDNYATYYADSVKGRFTISRDDSRSMLCLQMDNVKTEDTAIYYCTR
Rattus norvegicus V386 ighv AAHX01046906.1 65855 LHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNSYGMSWVRQAPGKGLDLVADISSKSYNYATYYADSVKDRFTISRDDSQSMVYLQMDNLKTEDTALYYCTV
Rattus norvegicus V387 ighv AAHX01046906.1 46434 VHCEVQLVESGGGLVQPKGSLKISCAASGFTFDTYSMNWVRQAPGKGLEWVAHIRSKSYNYARYYADSVKGRFTISRDDSRSMVYLQMYNLKTEDTAIYYCTR
Rattus norvegicus V388 ighv AAHX01046906.1 31887 VHCEVQLVESGGGLVQPKGSLKLSCAASGFDFNTYAMSWVRQAPGNGLDWVASISIKTYNYATVYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAWYYCTV
Rattus norvegicus V389 ighv AAHX01046906.1 12083 VHCAVQLVESGGGLVQPKESLKISCAASGFTFSNAAMYWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSKSMVYLQMDNLKTEDTAMYYCTA
Rattus norvegicus V390 ighv AAHX01046908.1 5057 VHSQVHLQQSGSDLVKPGASVKLSCKASGYTFSTSYMNWLKQVPGQSIEWIGYIYAGNGDINYNQKYKGKAKLTVDTSFSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V391 ighv AAHX01046910.1 143780 VHSEVQLQQSGAELVKPGASVKLSCKTSGYTFSNYYMSWLKQMPGQNIEWIGNIYGGNGGTGYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDSAVYFCA
Rattus norvegicus V392 ighv AAHX01046910.1 106689 VHSQVKLLQSGAELVKPGASVKLSCKTSGFTFSTSYMSWLKQVPGPSIEWIGWIYAGDGGTNYNQKFKGKATLTVDKSSSTAYMDLSSLTSEDAAVYFCA
Rattus norvegicus V393 ighv AAHX01046910.1 73398 VHSQVQLQQSGAELVKPGSSVKISCKASGYTFTSYDMHWIKQQPGNGLEWIGWIYPGNGNTKYNQKFNGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V394 ighv AAHX01046910.1 39679 VYSQVKLQQSGAELVKPGASVKLSCKTSGYTFSTSYMSWFKQIPGQSIEWIGMIYAGDGGTGYNQKFKGKATLTVDTSSSTAYMDLSSLTTEDSAVYFCA
Rattus norvegicus V395 ighv AAHX01046910.1 21123 VHSQVQLQQSGTELVKPASSVKISCKASGYTFTSNYMHWIRQQPGNGLEWIGWIYPGNGNTKYNQKFDGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Rattus norvegicus V396 ighv AAHX01046916.1 18662 VHSQVQLQQSGAELAKPGTSVKLSCKASGYTFTSYYIYWVKQRPGQGLEWIGYIYPGNGGTYYSEKFKGKATFTADTSSSTAYMLLGSLTPEDSAYYFCA
Rattus norvegicus V397 ighv AAHX01046917.1 99583 VLSQVSLKESGPGILQPFQTLSLTCSFSGFSLGTSNMGVGWIRQTSGKGLEYLATIWWDDDKYFNPSLNSRLTVSKDTSNNQAFLKITSVDTADTGTYYCTQR
Rattus norvegicus V398 ighv AAHX01046917.1 37556 VHSQVNLLQSRAALVKPGASVKLSCKASGYTFTDYYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKSKATLTVDKSTNTAYMELSRLTSEDSATYYCT
Rattus norvegicus V399 ighv AAHX01046917.1 7975 VHSQVKLLQSGAALVKPGASVKMSCKASGYTFTDYWVSWVKQSHGKSLEWIGEIYPNSGATNFNEKFKGKATLTVDKSTSTAYMELSRLTSEDSAIYYCT
Rattus norvegicus V400 ighv AAHX01046929.1 56298 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQAVEWIGVINPESGGTDYNGKFRGKVTLTVDKSSSTAFMQLGSLTPEDTAVYYCA
Rattus norvegicus V401 ighv AAHX01046929.1 46989 VYSEVKLQQSGDELVRPGASVKISCKASGYTFTNYAMYWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V402 ighv AAHX01046929.1 36284 VLSQVTLKESGPGILQPSQTLSLTCTFSGFSLSTYGMGVGWIRQPSGKGLEWLANIWWDDDKYYNPSLKNRLTISKDTSNNQAFLKITNVDTADTATYYCARI
Rattus norvegicus V403 ighv AAHX01046930.1 42627 VFSQVQLQQSGAELVKPGSSVKLSCKASGYTFTEYYIDWVKQRPGQGLEWIGDIDPENGDTAYNEKFKGRATMTADTSSNTAYMELSRLTSEDSAVYYCASVV
Rattus norvegicus V404 ighv AAHX01046930.1 30590 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKDTSNTQVFLKITSVDTADTATYYCARR
Rattus norvegicus V405 ighv AAHX01046934.1 15581 VLSQVTLKESGPGILQPSQALSLTCTFSGFSLSTYGMRVSWIRQPSGKGLEWLATIDWDDDKYYNPSLKSRLTVSKDTSNNQAFLKITSMDSADTATYYCAWR
Rattus norvegicus V406 ighv AAHX01046947.1 7807 VLSQVTLKESGPGILQPSQTLSLTCTFSGFSLSTSGTGVSWICQPSGKGLEWLANIWWNDDKGYNPSLKSRLTVSKDTSNTRAFLKITSVDTADTATYYCARR
Rattus norvegicus V407 ighv AAHX01046948.1 641 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMCVGWIRQSSGKGLEWLANIWWNDDKYYNPSLKNRLTISKDTSNNQAFLKITNMDTADTATYYCARR
Rattus norvegicus V408 ighv AAHX01046950.1 11146 VNSEVQLHQSGAELVKPGVSVKISCKASGYSFTSYNMHWVKQRPGQVLEWIGAINPGSGGTGYNEKFKGKATLTEGKSSSTAFMQLSSLTPEDTAVYYCA
Rattus norvegicus V409 ighv AAHX01046950.1 1856 VHSEVKLQQSGDELVRPGASVKMSCKASGYTFTDYAMHWVKQSPGQGLEWIGTIIPLIDTTSYNQKFKGKATLTADKSSNTAYMELSRLTSEDSAVYYCA
Rattus norvegicus V410 ighv AAHX01046959.1 20788 VLAQVTLKESGPGILQPSQTLSLTCSFSGFLLSASSVGVGWIRQPSGKGLEWLATIGWEDVKHYNPSLKSRLTVSKDTSNNQVFLKITSVDTADTGTYYCAHS
Rattus norvegicus V411 ighv AAHX01046960.1 3586 IHREAHQVQSGGGFIQPGGSLTLCCEGSGFTFSDHYMHWHRQAPGKSLERVGFIRDKLRHHTTEYAASVKERFIISRDDSKNTVYLQMSRLRTEDTAMYYCARE
Rattus norvegicus V412 iglv AAHX01070329.1 6713 SYGQFTLTQPKSVSGSLRSTITIPCERSSGDIGDSYVSWYQQHLGRPPINVIYADDQRPSEVSDRFSGSIDSSSNSASLTITNLQMDDEADYFCQSYDSNIDI
Rattus norvegicus V413 iglv AAHX01070331.1 9768 SCAQAVLTQPNSVSTSLGSTVKLSCTLSSGNIENNYVHWYQQYEGRSPTTMIYNDDKRPDGVPDRFSGSIDSSSNSAFLTINNVEIEDEAIYFCHSYVSSI
Rattus norvegicus V414 iglv AAHX01070332.1 5577 SCAQFVLTQPNSVSTNLGSTVKLSCKRSTGNIGSNYVNWYQQHEGRSPTTMIYRDDKRPDGVPDRFSGSIDRSSNSALLTINNVQTEDEADYFCQSYSSGI
Rattus norvegicus V415 iglv AAHX01070337.1 15211 SVTSYELIQPPSASVTLGNTVSITCSGDELPKKYAQWYQQKPDQSIVTVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCQSAYSDDNL
Rattus norvegicus V416 iglv AAHX01070337.1 2692 YVTSYELIQPPSASVTLGNTVSLTCVGDELSKRYAQWYQQKPDKTIVSVIYKDSERPSGISDRFSGSSSGTTATLTIHGTLAEDEADYYCLSTYSDDNL
Rattus norvegicus V417 iglv AAHX01070339.1 32678 SCAQVVLTQPKSVSTSLESTVKLSCKLNSGNIGSYYIHWYQQHEGRSPTTMIYRDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQTEDEAIYFCHSYDSSI
Rattus norvegicus V418 iglv AAHX01070339.1 18218 SWAQVVLTQPNTVSTSLGITVKLSCKCSSGNIGSYSVHWYQQHEGRSPTTMIYKDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQTEDEAVYFCHSYDSNI
Rattus norvegicus V419 iglv AAHX01070342.1 13697 SVTSYELIQPPSASVTLGNTVSLTCVGDELPKRYAYWYQQKPDQSIVRVIYEDSKRPSGISDRFSGSSSGTTATLTIRDAQAEDEADYYCHSTYSDDKL
Rattus norvegicus V420 iglv AAHX01070350.1 9172 SVTSYELIQPPSASVTLGNTVSITCSGDELPKRYAYWYQQKPDKSIVRVIYKDSERPSGISDRFSGSSSGTTATLTIRDTQAEDEADYYCHSTYSDDKL
Rattus norvegicus V421 iglv AAHX01070354.1 2897 SVTSYELIQPPSASVTLENTVSITCSGDELSNKYAHWYQQKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILTIRDAQAEDEADYYCLSTYSDDDL
Rattus norvegicus V422 trav AAHX01082948.1 17690 SWSLAKTTQPLSRDSYEGQAVNVSCSHTNIATSEYIYWYRQASHQGPQFIIQGYKDYVANEVASLFISADRKLSTLSLPRVSLRDTAVYYCIVA
Rattus norvegicus V423 trav AAHX01082948.1 4218 VSRGEQVEQRPSHLSVLEGDSAAIVCTYTDSNNDYFFWYKQEFGAGLQLLMSVLSNVNRKEEQGLTVLLNKKDKHLSLNITAAHLGDSAMYFCAVS
Rattus norvegicus V424 trav AAHX01082949.1 5041 ESQGEQVKQHPSSLSVQEGATALINCSYTDSASVYFPWYKQEPGRRPQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLNITATEPGDSAVYFCTAS
Rattus norvegicus V425 trav AAHX01082961.1 17506 ESHGEKVEQVLSTLSVQEGDTAVINCTYTDGGSSYFPWYKQEAGKGLHFVIDILSNVDRKENQRFKILLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V426 trav AAHX01082961.1 6492 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIAYPTLFWYFQYPGESLQLLLKVITAGEKGSSRGFEATYNKGTRSFHLQKASVQESDSVMYYCALG
Rattus norvegicus V427 trav AAHX01082961.1 4291 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRGPVSLTVLAYKKETTSSGRYSATLDEDAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V428 trdv AAHX01082963.1 12465 FNVAQEVTQVQSTASRQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V429 trdv AAHX01082965.1 4848 FNVAQKVTQVKSTASRQEGEEVTLDCSYETSQNLYYLFWYKQLQSGDIIFLIRQASSDSQNQRSSRYSVIFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V430 trav AAHX01082965.1 390 DAEAQSVTQPDVHVTVSEESSLWLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V431 trav AAHX01082973.1 9299 ANSQRGEENLLALSTQEGENVTMNCTYKTFATAVQWYRQDSGRGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V432 trav AAHX01082973.1 3313 TSMAQKVMQTQTSISVMETKTVTMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDYYKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V433 trav AAHX01082975.1 27788 VKGQQVQQSPVSLVLQEGEEAELQCNFSTSATRLQWFFQRPEGSLVSLLYNPSGTKKSGRLTSTTVTREQRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V435 trav AAHX01082981.1 6120 VSGQANTVVQSPSVLSVWEKETAIINCTYTNTATNYFPWYKKEERKGFTLLTDIRSNVNRKKEGRFEVILDTNVKRVSLHITASRTEDSALYLCAP
Rattus norvegicus V436 trav AAHX01082983.1 13547 IAGDAKTTQPDSVESTEEETVHLPCSHATISGNEYIHWYRQVPLQSPEYVIHGLQQNTSNSMAFLAIASDRKSSTLILPRVSLRDAAVYHCILRV
Rattus norvegicus V437 trav AAHX01082983.1 5566 VNTQKLQQSPQSLTIQEGDELTMSCNSSSSLYALHWYRQGRDGGPIFLVTLQKGGDEKRKDKITAKLDKKMRQSFLSIQASQPSYAGTYLCAGS
Rattus norvegicus V439 trav AAHX01082985.1 22214 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRGQVTLIIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQLGDAATYFCALMG
Rattus norvegicus V440 trav AAHX01082985.1 10172 TSMAQTVSQPQRERSVQETQSATLDCTYDTSDTNYYLFWYKQQRRQVTLVIRQEAYKQHNATESRFSVNFQKAAKSFSLEISDSQPGDAATYFCALME
Rattus norvegicus V441 trav AAHX01082986.1 39139 LRGEKTVQQNPLFLGTWEGRNSTIFCNYSSSATDRLLWYRQVVGESLEFLFALLSNGAVKRDRRLTASLDQKARISTLHFSGLQHSHSAIYFCAVG
Rattus norvegicus V442 trdv AAHX01082992.1 21443 KNALCVTLTQSSLDQAVVSGSKVTLLCTFDGSSPNPDLFWYRKRPDGSFQFILYRDNSRSHDADFVQGRFSVKHSKADGTFHLVIAPVRLEDSATYYCALG
Rattus norvegicus V444 igkv AAHX01102359.1 14819 ARCDIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRPMIYYATNLANGVPSRFSGSRSGSDYSLTISSLESEDMADYHCLQYKQYP
Rattus norvegicus V445 igkv AAHX01102359.1 10073 TSGDVVMTQTPVSLSLAIGQPASISCKSSQSLLGTSGKTFLNWILQRPGQSPKRLIYQVSKLYSEVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQG
Rattus norvegicus V446 igkv AAHX01102366.1 29201 ARCDIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWFQQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDYSLTINSLESEDMAIYYCLQHNEYP
Rattus norvegicus V447 igkv AAHX01102366.1 14604 ARCDIQMTQSPSSMSVSLGDRVTITCRASQDIGNYLSWYQQKPEKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLESEDTGIYFCLQHKQYP
Rattus norvegicus V448 igkv AAHX01102370.1 17551 ARCDIQLTQSPSSMSASLGDRVSLTCQSSQGIGNYLSWYQHKPGKPPKPMIYYATNLADGVPSRFSGSRSGSDYSLTISSLESEDTAIYYCLQYDEYP
Rattus norvegicus V449 igkv AAHX01102374.1 17770 ARCDIQMTQSPSSMSASLGDTVTINCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V450 igkv AAHX01102375.1 2373 TDSDIVMTQTPLSLSVAIGQSAFICCKSSQSLLYSNGKKYLNWFLQRPGQSPKCLIYLVSKLDFGVPDRFTGSGSETNFTLEISRVEAENLGVYYCMQGSYL
Rattus norvegicus V451 igkv AAHX01102376.1 51909 ARCDIQMTQSPSSMSVSLGDTVTITCRASQDVGIYVNWFQQKPGKSPRHMIYRATNLADGVPSRFSGSRSGSDYSLTISSLESEDVADYHCLQYDEYP
Rattus norvegicus V452 igkv AAHX01102376.1 23894 THSDIVMTQTPLSLSVAIGQSASISCKSSQSLKYSDGKTYLNWVFQSPGQSPKRLIYQVSKLDSGVPDRFSGTGSETDFTLKISRVEAEDLGVYYCCQVHIL
Rattus norvegicus V453 igkv AAHX01102378.1 3067 TRGDVVMTHTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGQSPKLLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCVQATHFP
Rattus norvegicus V455 igkv AAHX01102391.1 6339 ARGDVVMTQTPPSLSVAIGQSVSISCKSSQSLVYSDGKTYLHWLLQSPGRSPKRLIYQVSNLGSGVPDRFSGTGSQKDFTLKISRVEAEDLGVYYCAQT
Rattus norvegicus V456 igkv AAHX01102394.1 7701 ARCDVHMTQSPSSMSASLGDKVTPTCWASQNISRYLSWLQQQPRKSPKVLIYGATILEDWVPSKFSGSGSRADYSFTISNLVSEDFGTYYCLQYLHF
Rattus norvegicus V457 igkv AAHX01102395.1 45378 ARCDIQVTQSPSSLLASLGERVTITCQTSQSISNNLNWYQQKPGQAPMLLIYYATSLQTGMPSRFSGQYSGRSFTLTITSLEPEDIANYFCLQHYSA
Rattus norvegicus V458 igkv AAHX01102395.1 12866 MRCNIQLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNG
Rattus norvegicus V459 igkv AAHX01102398.1 33855 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLHSNGITYVYWYLQKPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGIYYCGQLLENP
Rattus norvegicus V460 igkv AAHX01102398.1 4685 SRSDVVLTQTLVAQPVRLGDQASISCRSSQSLVLTDGHTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGSDFTLKISRVEPEDLGVYYCFEG
Rattus norvegicus V461 igkv AAHX01102404.1 3610 IQCDVQMTQSPYNLAASPGESVSINCKASKSISKYLAWYQQKPGKANKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRSLEPEDFGLYYCQQHNEY
Rattus norvegicus V462 igkv AAHX01102408.1 23088 SRSDVVLTQTPVAMPVTLGDQASISCRSSQSLVYSDGNTYLEWYLQKPGQSPQLLIYEVSNQFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V463 igkv AAHX01102409.1 1502 YRGDVVLTQTPVTLLISIGGQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPQLLIYQVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR
Rattus norvegicus V464 igkv AAHX01102415.1 9331 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSFVHSDGNTYLNWYLQKPGQSPQLLIYKVSNRLSGVPDRFSGSGSGTDFTLKISRVEHDDLGVYYCGQASKIP
Rattus norvegicus V465 igkv AAHX01102418.1 1895 ATGDIVMTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYRMSNLASGVPDRFSGSGSETDFTLKISRVEAEDVGVYYCGHRLEYP
Rattus norvegicus V466 igkv AAHX01102742.1 5661 ARCDIEMTQSPSSLSASLGDRVSISCRASENINNYLSWYQKKEDGSVKLLIYHTSRLQPGAPSRFSGSGSGKDYSLRISGLESEDITTYYCQQGYN
Rattus norvegicus V467 igkv AAHX01102744.1 3815 AQCDVQMTQSPSYLAASPGESVSISCKASKSISNYLAWYQQKPGEANKLLIYSGSTLQSGTPSRFSGSGSGTDFTLTIRNLEPEDFAVYYCQQYYEK
Rattus norvegicus V468 igkv AAHX01102757.1 883 MRCDIQMTQSPSFLSASVGDRVTLSCKASQNINKYLAWYQQKLGEAPKLLIYNANSLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHNSW
Rattus norvegicus V469 igkv AAHX01102759.1 10926 MRCDIQMTQSPSVLSASVGDRVTLNCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDFATYFCFQHNSW
Rattus norvegicus V470 igkv AAHX01102763.1 12341 ARCDIKMTQSPSSLSASLGERVTISCRASENINNILAWYQKKEDGSVKLLIYYTSNLQSGVPSRFSGSGSGKDYSLTISGLESEDIATYYCQQGYT
Rattus norvegicus V471 igkv AAHX01102764.1 8620 AQCVVQMTQSPSYLAASPGESVSISCKASKSISNNLAWYQEKPGKANKLLIHSGSTLQSGTPSRFSGSGSGTDFTLTIRSLESEDFAVYYCQQYNEY
Rattus norvegicus V472 igkv AAHX01102772.1 9870 SRGDVVMTQTPVSLSVSLGGQVSISCRSSQSLVHNNGNTYLSWYLQKPGQSPQLLIYKVSNRFSGISDRFSGSGSGTDLTLKISRVEPDDLGVYYCGQG
Rattus norvegicus V473 igkv AAHX01102773.1 16437 SRGDVVMTQTPVSLPVSLGGQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGDYYCLQS
Rattus norvegicus V474 igkv AAHX01102989.1 18507 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCLQHSSR
Rattus norvegicus V475 trgv AAHX01102995.1 16197 GLGQLKQTKMSVTRATDQSAQIPCIVSVPDFGTTPIHWYRQKTNQQIEYLIFVRSSYNQRPLDGKNKKIEARKDFQTSTSTLTLNYLKKEDEATYYCALWA
Rattus norvegicus V476 ighv AAHX01103198.1 18195 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLSSYGVIWVRQPPGKGLEWMGVIWGNGNTNYNSALKSRLSISRDTSKSQVFLKMNNLQTEDTAMYFCA
Rattus norvegicus V477 ighv AAHX01103198.1 13067 VLSEVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGVMWSGGSTAYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V478 ighv AAHX01103200.1 16139 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYGMAWVRQAPKKGLEWVAYISYDGGSTYYRDPVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V479 ighv AAHX01103200.1 5363 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVSWVHQPPGKGLEWIAAISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAMYFCA
Rattus norvegicus V480 ighv AAHX01103201.1 6084 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVNWVHQPPGKGLEWIGGISSGGSTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYFCT
Rattus norvegicus V481 ighv AAHX01103475.1 2848 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVCQPPGKGLEWMGRIQSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V482 ighv AAHX01103476.1 15326 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMAWVRQTPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKNTQYLQMDSLRSEDTATYYCA
Rattus norvegicus V483 ighv AAHX01103568.1 8616 SLSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSYSVHWVRQHSGKSLEWMGRMWSDGDTSYNSAFTSRLSISRDTSKSQVFLKMNSLQTEDTGTYYCAR
Rattus norvegicus V484 ighv AAHX01103568.1 607 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSDYNMAWVRQAPKKGLEWVATIIYDGSRTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCA
Rattus norvegicus V485 trav AAHX01103658.1 24087 RTHGDSVTQTEGQVTISENGFLRINCTYSATRIVYPNLFWYVQYPGEGLQLLLKVITAGEKGSSRGFEATYNKETTSFHLEKASVQESDSAVYYCALG
Rattus norvegicus V486 trav AAHX01103658.1 20601 VAGRTQVEQSPQSLVVHEGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDADAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V487 trav AAHX01103658.1 17079 RSNGDSVTQTEGLVTLTEGSHVMLTCTYQTTYSGPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSRRSFSLQKPSAQLSDSALYYCAVE
Rattus norvegicus V488 trav AAHX01103658.1 10279 VKGQQVQQSPVSLVLQEGENSELQCNFSISTNQLQWFFQRPGGSLVSLFFNPSGTKKSGRLTSMTVPKERRSSLHISSSQTTDSGTYFCAMDPQCS
Rattus norvegicus V489 trdv AAHX01103767.1 11466 CNVAQEVTQVQSTASRQEGEEVTLDCSYETSYVAYYLSWYKQHLSGDIIFLIHQISSSTAEERSGRYSLVFQKSLKSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V490 igkv AAHX01103833.1 3959 MRCDIQMTQSPSFLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKRLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDFATYFCLQHNSF
Rattus norvegicus V491 trav AAHX01103834.1 7256 MSQGEQVKQLPSILRVQEGSSAIINCTYVDSASLYFPWYEQKPGKHPKLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V492 trav AAHX01104063.1 14532 VSSQEKVQQSPESLIVPEGSIASLNCTYSDPNFLYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAHFSKASLHVSLHIRDSKPSDSALYFCAASE
Rattus norvegicus V493 trav AAHX01104063.1 7049 MNSQVVEENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLGQDPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V494 ighv AAHX01104119.1 325 VQCEVQLVESGGGLVQPGRSMKLSCAASGFTFSNYDMAWVRQAPKKGLEWVATISYDGSSTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTT
Rattus norvegicus V495 trav AAHX01104186.1 7590 VSRGEQVEQRPSHLSVREGDSAVIICTYTDSLSSYFYWYKHEPGAGLQLLMEVFSSTEIKGQGFIVLLNKKDKRLSLNITAVHLGDSATYFCPVR
Rattus norvegicus V496 trav AAHX01104401.1 5150 RTHGDSVIQTEGQVTISENGYLRINCTYSATSIGYPYLFWYVQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V497 trav AAHX01104401.1 1289 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLKNKEEKTSRGRYSATLDADAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V498 trdv AAHX01104436.1 11571 CNVAQKVTQVQSTASRQEGEDITLDCSYDTSYVTYYLFWYKQLLSGEMVFLIHQISSSTAEKRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALKEL
Rattus norvegicus V499 trav AAHX01104806.1 3488 TSMAQKVVQTQASISVMETKTVAMDCVYETRDSSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQMSKSSIGLIIRATQIEDSAVYFCAMSE
Rattus norvegicus V500 trav AAHX01104807.1 2182 ANSQRGEENLLALSTQEGDNVTMNCTYKTYTTAVQWYRQDSGGGPVLLMLIRSNEREKHIGRLRATLDTSSQSSSLSITAAQSADTAVYFCATN
Rattus norvegicus V501 trav AAHX01105080.1 3784 RTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V502 trav AAHX01105080.1 371 VAGRTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDEGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V503 igkv AAHX01105375.1 624 VNGDIVMTQGALPNPVPSGESASITCQSSKSLLHSNGKTYLNWYLQRPGQSPQLLIYWMSTRASGVSDRFSGSGSGTDFTLKISSVEAEDVGVYYCQQFLEYP
Rattus norvegicus V504 trav AAHX01105474.1 2550 VAQAQSVTQPDTHVTVSEEDSLQLRCTYSSSVPPSLFWDVQYPQQGLEMLLRYYSGNPMVQGMNGFVAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V505 trav AAHX01105500.1 3881 VAQAQSVTQPDAHVTVSEEDSLQLKCKYSTPWSTYLFWYVQYPQQRLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V506 trav AAHX01105736.1 5286 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDPNNYYFYWYKQEPGAGLQLLMEVFSSTEIKEGQGFIVLLNKNDKRLLLNITAAHLGDSAKYFCAVR
Rattus norvegicus V507 igkv AAHX01105820.1 1298 SRSDVVLTQTPGSLSVTLGDQASISCRSSQSLEYSDGYTYLEWYLQKPGQSPQLLIYEVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDLGVYYCFQA
Rattus norvegicus V508 trav AAHX01106703.1 2297 ESHGEKVEQVLSTLSVREGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDKKETQRFKILLDKEAKKFSLHITATQAQDSAIYFCSAS
Rattus norvegicus V509 igkv AAHX01107448.1 1480 SRGDVVMTQTPVSLPVSLGGQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVESEDLGVYYCLQG
Rattus norvegicus V510 trav AAHX01107781.1 769 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V511 trav AAHX01116185.1 734 RSNGDSVTQTEGRVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHATLHKNNRSFHLQKPSAQLSDSALYYCALS
Rattus norvegicus V512 ighv AAHX01118068.1 371 ALSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSNSVHWVRQPPGKGLEWMGIIRSGGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCT
Rattus norvegicus V513 trav AAHX01118375.1 472 RSNGDSVTQTEGRVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDSKRTEHEGFHAALHKNNRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V514 trav AAHX01119271.1 343 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V515 trav AAHX01120380.1 843 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V516 trdv AAHX01123090.1 1304 FNVAQVQSTASMQEGEEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V517 trav AAHX01132462.1 329 ESHGEKVEQVLSTLSVQEGDTAVINCTYTDSTSSYFPWYKQGAGKGLHFVIDIRSNVDKKETQRFKILLDKKAKKFSLHITATQAEDSAIYFCSAS
Rattus norvegicus V518 trav AAHX01135221.1 1818 GSNGDSVTQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYDKETTSFHLQKASVQSSESAVYYCALN
Rattus norvegicus V520 trav AAHX01140037.1 1645 QSVTQPDAHVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLQLLLKYYSGDPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCALSLQCLSL
Rattus norvegicus V521 igkv AAHX01140064.1 390 AICDIQMTQSPASLSASLGETVTIECRASEDIYSNLAWYQQKPGNSPQLLIYDANSLADGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQQYNNYP
Rattus norvegicus V522 trav AAHX01142753.1 551 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V523 trav AAHX01153023.1 325 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V524 ighv AAHX01154153.1 622 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYSVHWVRQPPGKGLEWMGGIWGNGNTNYNSALKSRLSICRDTSKSLVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V525 igkv AAHX01159967.1 634 MRCDIQMTQSPSLLSASVGDRVTINCKASQNINKYLNWYQQKLGEAPKLLIYNTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDFGTYFCFQHNSW
Rattus norvegicus V526 trav AAHX01161877.1 812 DGQAQSVTQPDVHVTISEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLRYYSGDPVVQGENSFEAEFNKSESSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V527 trav AAHX01162031.1 347 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V528 trav AAHX01163010.1 375 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALG
Rattus norvegicus V529 trav AAHX01167386.1 799 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V530 trav AAHX01168587.1 860 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPVVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V531 trav AAHX01172951.1 971 ESHGEKVEQVLSTLSVVEGDTAVINCTYTDSASSYFPWYKQEAGKSLHFVIDIRSNVDRKETQKFTVLLDKKAKKFSLHITATQAEDSAIYFCAAS
Rattus norvegicus V532 trav AAHX01173434.1 1394 VAGKTQVEQSPQSLVVHQGESCVLQCNYTVTPFNNLRWYKQDRGRAPVSLTVLTNKEEKTSRGRYSATLDAGAKHSTLHITASLLDDAATYICVVA
Rattus norvegicus V533 trav AAHX01173540.1 589 VKGQQVQQSPVSLVLQEGENAELQCKFSTSATGLQWFFQRPGRSLVSLLNNPSGTKKSGRLTSTTVTRERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V534 trav AAHX01187300.1 476 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V535 trav AAHX01192900.1 908 DGQAQSVTQPDVHVTVSEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLGYYSGDPVVQGENGFETEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V536 trav AAHX01194265.1 3341 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDSKRTEHAGFHAALHKSSRSFRLQKPSAQLSDSALYYCTVE
Rattus norvegicus V537 ighv AAHX01196618.1 392 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYNVHWVRQPPGKGLEWMGVIWSGGNTDYNSALKPRLSISRDTSKSQVFLTMNSLQTEDTGIYYCNR
Rattus norvegicus V538 trav AAHX01212000.1 1426 VSSQEKVQQSPESLIVPEGSIASLNCTYSDPNFLYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSKPSDSALYFCAASE
Rattus norvegicus V539 trav AAHX01221460.1 2451 VSSQEKVQQSPESLIVPEGSIASLNCTSSDPNFQYFWWYRQHSGEGPKALMSVFSNGEKEEGRFTAHFNKASLHVSLHIRDSKPSDSALYFCAV
Rattus norvegicus V540 trav AAHX01222669.1 1177 VSSQQKVQQSPESLSVSEGAIASLNCTFSNSASQSFWWYQQHPGKGPKMLISIFSNGNKKEGRFTAHLNRASLHVSLHITDSQPSDSAVYLCAVS
Rattus norvegicus V541 ighv AAHX01223907.1 1087 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLMDYSVHWVRQPPGKGLEWMGRMKYDGDTYYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYYCTR
Rattus norvegicus V542 trav AAHX01224198.1 579 GVQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V543 trav AAHX01227007.1 1511 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPEGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTIDSGTYFCAVDAQCS
Rattus norvegicus V544 trav AAHX01232159.1 726 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSVQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V545 trav AAHX01232715.1 687 VSRGEQVEQRPSHLSVWEGDSAVIICTYRDSLSSYFYWYKHEPGAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V546 trdv AAHX01232930.1 505 CIVAQEVTQVQSTASRQEGEEVTLDCSYETSYVVYYLSWYKQLLSGDIIFLTRQISSSTAEERSGRYSVVFQKSLMSISLVISASQPEDSGKYFCALSDL
Rattus norvegicus V547 trav AAHX01233441.1 446 RSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQYLNEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V548 igkv AAHX01236864.1 836 LVSSGDNVLPQSPTTMAASPGEKVTITCHASSSGIYMNWHQQKSGTSPKLWIYDTSKLASGVPDRFSGSGSGTSYSLTINTMETEDAATYYCQQCCSTPP
Rattus norvegicus V549 igkv AAHX01237294.1 974 GKCDIQVTQSPASLSASPEEIVTITCQASQDIGSSLLWYQQKPGKSPQLLIYSATILADGVPSRFSGSRSGTQYSLKISRLQVEDIGTYYCLQVSSSP
Rattus norvegicus V550 trav AAHX01238438.1 615 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTTVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V551 trav AAHX01238497.1 1772 RSNGDSVTQTEGLVTLTEGSPVMLNCTFQTAYSDISLFWYVQYLNKAPELLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V553 ighv AAHX01253564.1 352 VLSQVTLKESGPGMLQPSKTLSLTCSFSGFSLSTSGMVVSWIRQPSGKSLEWLAAIDWDGDKYYNPSLKSRLTVSKNTSNTQVFLKITSVDIADTATYYCARR
Rattus norvegicus V554 trav AAHX01253808.1 464 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V555 trav AAHX01258571.1 798 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATRLQWFYQRPPGSLVSLFYNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V556 trav AAHX01259644.1 302 VAQAQSVTQPDAHVTVSEEASLQLRCKYSSSVSPSLFWYVQYPQQGLLLLLKYYSGNPMVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V557 trav AAHX01260068.1 631 VKGQQVQQSPVSLVLQEGEKAELQCTFSTAFNSMQWFYQNPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V558 trav AAHX01260983.1 425 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V559 trav AAHX01262057.1 991 RSNGDSVTQTEGLVLVTEGSHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSNSSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V560 trdv AAHX01269169.1 715 FNVAQEVTQVQSTASWQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V561 trdv AAHX01270521.1 1865 CNMAQKVTQVQSTASRQEGEEVTLDCSYETSQNFYHLFWYKQLLSGDIIFLIRQPSFDSQNQRSGCYSVVFQKSLKSISLVISASRPEDSGKYFCALWES
Rattus norvegicus V562 trav AAHX01272761.1 547 MNSQVAEENPWALRIHEGENVTVNCSYKTSIIALQWYRQDSGGGPALLVLICSNEREKHSGRLRATLDTSSQSSSLFITAAQSADTAVYFCATD
Rattus norvegicus V563 trav AAHX01277773.1 870 DAEAQSVTQPDVHVTVSEESSLWLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V564 trav AAHX01277872.1 855 VSRGEQVEQRLSHLSVREGDSAVIICTYRDSLSSYFYWYKQEPRAGLQLLIMQDFWSTEIKEGQGIIVLLNKKDKRLSLNITSAHIGDSATYFCAVS
Rattus norvegicus V565 trav AAHX01281776.1 1440 VSSQEKVQQSPESLIVPEGSTASLNCTYSDPNFLYFWWYRQHSGEGPKALMSISSNGEKKEGRFTAHFSKASLHVSLHIRDSEPSDSALYFCAASE
Rattus norvegicus V566 trav AAHX01283140.1 1066 GSNGDSVTQTEGLVTLSEGASLTVNCSYETTQYPALFWYVQYPGEGPQLLLRASKANEKGSSRGFEATYEKETTSFHLQKASVQESDSAVYYCALS
Rattus norvegicus V567 trav AAHX01292981.1 473 VKGQQVQQSPVSLVLQEGEKAELQCTFSTTFNSMQWFYQRPGGSLVSLFFNPSGTKQSGRLTSTTVPKERSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V568 trav AAHX01298259.1 397 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V569 trav AAHX01298298.1 869 VKGDSVEQSPSALSLHEGTSSVLRCNFSITITTVQWFRQNPRSSLINLFYLASGTKENGRLNSTFSSKERYSTLHISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V570 trav AAHX01301456.1 367 VAQAQSVTQPDAHVTVSEEASLQLRCKYSTPGAPSLFWYVQYPQQGLLLLLKYYSGNPMVQGLNDFKAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V571 trdv AAHX01303442.1 570 FNVAQEVTQVQSTASRQEREEVTLDCSYETSQNIYHLFWYKQLLSGDIIFLIRQTSFDSQNQRSGRYSVVFQKSLKSISLVISASQPEDSGKYFCALWEL
Rattus norvegicus V572 igkv AAHX01303671.1 983 GKCDIQVTQSPASLSASSEEIVTITCQASQDIGSSLLWYQQKPGKSPQLLIYSATILADGVPSRFSGSRSGTQYSLKISRLQFEDIGTYYCLQVSSSP
Rattus norvegicus V573 trav AAHX01304384.1 631 VKGQQVQQSPVSLVLQQGETAELQCSFSTGLNSMQWFYQSPGGSLVSLFYNPSGTKKSGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V574 trav AAHX01310406.1 347 DGQAQSVTQPDVHVTISEEASLQLRCKYSSSVPPSLFWYVQYPQQGLQLLLRYYSGDPVVQGENSFEAEFNKSESSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V575 trav AAHX01312893.1 442 VRGDGVEQSPSALSLHEGTSSVLRCNFSITTTIVQWFRQNPRGSLINLFYLVPGTKENGRLNSTFSSKERYSTLYISNAQLEDSGTYLCAGQAQCSQ
Rattus norvegicus V576 igkv AAHX01325153.1 477 MRCDIQMNQTPSTLSMSIGERVIINCHASEIINTWLSWHQQKPENAPQLLISKASNFHTEVPSRFSGSGSGTDYSLSSSSLEPEDIATYYCVQAKSLP
Rattus norvegicus V577 trav AAHX01325250.1 583 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSFSSYFCWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVS
Rattus norvegicus V578 trav AAHX01334536.1 764 MNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLDQGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Rattus norvegicus V579 trav AAHX01334630.1 463 RSNGDSVTQTEGLVTLTEGSPVMLNCTYQTTYSAPTLFWYVQYLSEAPRLLLRSSTDNKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V580 igkv AAHX01343018.1 788 TCGDIVMTQSPSSLAVSAGETVTINCKSSQSLFGSVRQKNYLAWYQQKPGQSPKLLIYLASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLANYYCQQYYDTP
Rattus norvegicus V581 trav AAHX01345636.1 828 TSMAQKVMQTQASISVMETKTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDSYNKENATEGRYSLNFQKSESSIGLIIRATQIEDSAVYFCAMRE
Rattus norvegicus V582 trav AAHX01356959.1 554 DVEAQSVTQPDVHVTVSEESSLRLRCTYSSSVSPYLFWYVQYPQQGLQLLLKYYSGDSVVQGENGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVS
Rattus norvegicus V583 ighv AAHX01371592.1 529 VQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMAWVRQTPTKGLEWVASISTGGGNTYYRDSVKGRFTISRDNAKNTQYLQMDSLRSEDTATYYCA
Rattus norvegicus V584 trav AAHX01375844.1 657 RSNGDSVTQTEGLVSLTEGSPVVLNCTYQTTYSTVTLFWYVQYLNEAPRLLLRSSTDSKRTEHEGFHAALHKSSRSFRLQKPSAQLSDSALYYCAVE
Rattus norvegicus V585 igkv AAHX01387354.1 608 MRCDIQMTQSPPVLSASVGDRVTLSCKASQNINKNLDWYQQKHGEAPKLLIYYTNNLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSG
Rattus norvegicus V586 trav AAHX01391984.1 845 RSNGDSVTQTEGRVLVTEGLHVVLNCTYQTTYSNPSVFWYVQYLNEAPRILLWSFTDNKRTEHEGFHAALHKSSRSFHLQKPSAQLSDSSLYYCALS
Rattus norvegicus V587 trav AAHX01392629.1 605 VSSQEKVQQSPESLIVPEGSIASLNCTSSDRNFQYFWWYRQHSGEGPKALMSILSNGEKKEGRFTAHFNKANLHVSLHIRDFKSSDSALYFCAASK
Rattus norvegicus V588 trav AAHX01408148.1 312 VAQAQSVTQPDTHVTVSEESSLQLRCTYSSSVPPSLFWYVQYPQQGLEMLLRYYSGNPMVQGVNGFVAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V589 trav AAHX01414007.1 1693 VSSQQKVQQNPESLTVPEGGRTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNKASLHVFLHIRDSQPSDSALYLCAV
Rattus norvegicus V590 ighv AAHX01421356.1 864 VLSEVQLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNNGGTIYNQKFKGKATLTVDKSSSTAYMELRSLTSEDTAVYYCA
Rattus norvegicus V591 ighv AAHX01424542.1 656 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLSSYGVIWVHQPPGKGLEWMGGIWGDGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYFCT
Rattus norvegicus V593 trav AAHX01429197.1 1547 VAQAQSVTQPDAHVTVSEEASLQLKCKYSYPGTPSLFWYVQYPQQGLQLLLKYYSGNPVVQGLNDFEAEFNKSDSSFHLRKASVHWSDSAVYFCAL
Rattus norvegicus V594 trav AAHX01429879.1 516 VAQAQSVTQPDANVTVSEEASLQLKCKYSTPGAPSLFWYVQYPQQGLKMLLKYYSGDPVVQGLNDFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V595 trav AAHX01434913.1 3196 VSSQQKVQQSPESLIVPEGAMTSLNCTFSDRASNDFRWYRQLSGKGLELLVSIFSDGEKEEGRFTAHLNIARLQVSLHMRDLGPSDSAVYLCAV
Rattus norvegicus V596 trav AAHX01437721.1 818 GVQTQTVSQSDAHITVFEGDSVELRCKYSYGRTPYLFWYIQHHGHGLQFLLKYYTGDPVVHGMNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALG
Rattus norvegicus V597 trav AAHX01442164.1 5996 VSSQEKVQQSQESLIVPEGSIASLNCTSSDRNFEYFWWYRQHSGEGPKALMSIFSNGEKKEGRFTAQFSKASLHVSLHIRDSEHSDSALYFCAVS
Rattus norvegicus V598 igkv AAHX01443732.1 523 ATGDIVLTQAPLSVSVTPGESASISCRSSKSLLSSKGITSLYWYLQRPGKSPQLLIYQMSNLASGVPDRFSSSGSETDFTLKISKVETEDVGVYYCGHRLEYP
Rattus norvegicus V599 trav AAHX01444701.1 1085 VSSQQKVQQSPESLTVPEGAMTSLNCTFSDRAANNFRWYRQHSGKGLELLVSIFSDGEKEEGRFTAHLNKARLQVSLHIRDIWPSDSAVYLCAVS
Rattus norvegicus V600 ighv AAHX01446174.1 515 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVSWVRQPPGKGLEWMGVIWTGGSTAYNSLLKSRLSISRDISKSQVFLKMNSLQTEDTATYYCAR
Rattus norvegicus V601 trav AAHX01455803.1 406 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYLQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALN
Rattus norvegicus V602 igkv AAHX01456590.1 1228 STGDIVLTQSPALAVSLGQRATISCRASQSVSISSYNLMQWYQQKPGQQPKLLIYDASNLASGIPARFSGSGSGTDFTLTIDPVQADDIATYYCQQSKDDP
Rattus norvegicus V603 trav AAHX01459783.1 3995 MSQGEQVKQFPSILRVQGGSNAILNCTYVDSASLYFPWYKQEPGMHPQLLIDIRSNMERKQTQRLILLLNEKAKHFSLHITDTQPGDSAMYFCAAS
Rattus norvegicus V604 igkv AAHX01463369.1 1306 VYGNTVMTQSPTSMFTSVGDRVTISCKASQNVGINVAWYQQETGQSPKRLINWASNRDTGVPDRFTGSGSGTDFTLTISNMQAEDPAIYYCLQHKSYP
Rattus norvegicus V605 trav AAHX01467524.1 2718 VKGQQVQQSPVSLVLQEGENAELQCKFSTTATELQWFFQRPGGSLVSLLNNPSGTKQSGRLTSTTVVKEQSSSLHISSSQTTDSGTYFCAMNPQCS
Rattus norvegicus V606 trav AAHX01468440.1 1013 VSSQQKVQQNPESLTVPEGARTSLNCTFSDSTSRYFAWYRQHPGKEPKELMSIISTGEKEEGRFTIQLNTASLHVFLHIRDSQPGDSALYLCAV
Rattus norvegicus V607 igkv AAHX01470700.1 1337 TRCDTRMSQTPASLSASLGKSITITCRASQDTGKSLLWFQQKTGKPPKILIYTASNLISGISPRFSGSGSGTQFSLKISNLKPEDTAIYYCCQGYWLS
Rattus norvegicus V608 trav AAHX01471890.1 979 VSRGEQVEQRPSHLSVREGDSAAIVCTYTDSFSSYFYWYKHEPGAGLQLLMEIFSSTEVKEGQGFIVLLNKKDKQLSLNITAAHLGDSATYFCAVRAQCSS
Rattus norvegicus V609 trav AAHX01472054.1 419 GVQTQTVSQSDAHVTVLEGDSVELRCKYSYSRTPYLFWYIQHHGHGLQFLLKYYSGDPVVRGTNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V610 trav AAHX01473187.1 614 VKGQQVQQSPVSLVLQEGEKAELQCNFSTSANQMQWFYQSPGGSLVRLFYNPSGTKQSGRLTSTTVAKERQSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V611 trav AAHX01478274.1 461 VKGQQVQQSPVSLVMQEGENAELQCNFSTSATQLQWFYQRPRGSLVSLFYNPSGTKKSGRLTSTTLTMERRSSLHISSSQTTDSGTYFCAMDAQCS
Rattus norvegicus V612 trav AAHX01484333.1 1684 VKGQQVQQSPVSLVLQEGEKAELQCSFSTSTTQLQWFYQRPRGSLVSLFFNPSGTKKSGRLTSTTVTTERRSSLHISSSQTTDSGTYFCAVDAQCS
Rattus norvegicus V613 igkv AAHX01485203.1 1553 ARCDIQMTQSPSSMSASLGDTVTITCLASQDIGNYLSWYQQKPGKSPKLMIYGATNLEDGVPSRFSGSRSGSDYSLTINSLGYDDEGIYHCHQYYEYP
Rattus norvegicus V614 trav AAHX01491587.1 3930 RAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGDPALFWYVQYPGEGLQLLFRVLRANEKGSNRGFEATYDKETTSFHLQKASVQASDSAMYYCALN
Rattus norvegicus V615 igkv AAHX01493201.1 837 GKCDIQMTQSPASLSASLEEIVTITCKASQGIDDYLSWYQQKPGKSPQLLIYDATSLADGVPSRFSGSRSGTQYSLKISRPQVDDSGIYYCLQSYSTP
Rattus norvegicus V616 trav AAHX01494586.1 504 RTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Rattus norvegicus V617 trav AAHX01498221.1 1275 VQTQTVSQSDAHVTVFEGDSVELRCKYSYGATPYLFWYIQHHGRGLQFLLKYYTGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCALS
Rattus norvegicus V618 trdv AAHX01501846.1 1121 CNVAQKVTQVQSTASRQEGEDVTLECSYKTSYGAYYLFWYKQLLSGEMVFLFRQFSFDSQNQRSGRYSVVFQKSLKSISLVISASRPEDSGKYFCAVSDL