WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ophiophagus hannah AZIM00000000.1 (AZIM01) 131 77 28 0 25 1 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ophiophagus hannah Vs213 ighv AZIM01010330.1 14629 VQSQVQLVESGGDVRRPGGSLRLSCQGSGFTLGNSNIGWVRQAPGKGLEWVALIYTDSSRQFYSDKVKGHFTISRDNAKRQAYLQMNSLKPEDAAVYYCAGWLD
Ophiophagus hannah Vs212 ighv AZIM01010330.1 10899 VQSQVQLVESGGDVRRPGESLRLSCQVSGFTFSNYEMVWVRQYSGKELEYINTNSGTSYSDKVKGRFIISRDNAKSQLYLQMNNLKAEDTAVYYCAR
Ophiophagus hannah Vs211 iglv AZIM01010286.1 17821 IDGQSTWTQPSTSSASPGGTIKLSCTTTQSSYCIAWYQQKPGEAPRYIQCSGYGRGEGIPDRFTATMSGTTGTLTITNVQAGDEAVYYCASWNGA
Ophiophagus hannah Vs210 iglv AZIM01010286.1 15787 SSLQQLQTLKDAEFVAVGGTVTISCQYNGGNLGDGHYPLWTQETAGNQHRGVISYTSNRPSGVPERFSGSRSGNMMSLTITGALVEDEATYYCCVWSGNQ
Ophiophagus hannah Vs217 iglv AZIM01012917.1 1409 IDGQSSWTQPPSSSVSPGGTITLSCTTQSTNTINWYQQKAGEGPRFVHCNSCSRGDGIPNQFTATQSGSTGSLAITNVETGDEADYYCASSSNNV
Ophiophagus hannah Vs215 ighv AZIM01012005.1 5052 IQSQVQPPLVESGGDVRRPGESLRLSCQASGFTFSSYWMGWVRQAPGKGLEWVADISTGSSPSTYHSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAIYYCMR
Ophiophagus hannah Vs219 iglv AZIM01013788.1 2675 IMVEYSLSQEPALSATLGEPATLSCNITGGLFFNYFAWYQHKGGESPRFILHYNTTSRETKFGPEASGHFSASTNTPKKIAFLTINNVQAKDEGDYYCGDA
Ophiophagus hannah Vs359 ighv AZIM01005930.1 33299 MQSAIQLLQSGPEIKRPGELIQLTCKTSGYTFTDYSLKWVKQAPGKGLNWVGSIRTDNFNTFYAEALKGRVIITVDTSISTTFLQLTNLNTEDTAVYYCAR
Ophiophagus hannah Vs180 trav AZIM01006032.1 63185 GSTGQSVKQASGTVAVTEGQAVSLHCSYEAQYSGTINTYWYIQHPGQPLKLLLTEYENYGKGFRATHHKGNKNGTYNLEEEASQLKDSAVYFCAIR
Ophiophagus hannah Vs165 ighv AZIM01005733.1 7431 VQSEVQLVESRGDVRRPGESLHLSCQASGFNFSDYWMIWVRQAPGKGLKWVAHMWTSYINYSDKVKGHFTISRDNAKSQLYLQMNSLKPENTAVYYCAGW
Ophiophagus hannah Vs167 ighv AZIM01005733.1 28524 VRSEDQLVESGGGVRRPGESLRLSCQGSGFTFRSYGMHWVRQYSGKGPEWIAWIYTDSSSIYYSDKVKGCFTISRDNAKSQLYLQMNSLKPEDTAIYYCTRNPV
Ophiophagus hannah Vs166 ighv AZIM01005733.1 18495 PVGGVWRRCEKTGQSLHLTCQASGFTFRGFALFWVRQSPGEGLEWVAYISSGSSSIYYSDKVKGCFTISRDNAKSQLYLQMSSLKPEDTAVYYCAR
Ophiophagus hannah Vs208 iglv AZIM01010286.1 450 AWGQFTMTQPPSLSVSPGGTVRITCTRAGGSITGYYVHWYQQKPGTKPILVIYQYSSRPSGIPERFSGSIDSSSNSATLSISSVQPEDEADYYCSSNDGNAQ
Ophiophagus hannah Vs209 iglv AZIM01010286.1 13189 PSLQQLQTLKDPEFVAAGRTVTISCRYDGGNLGDGNHPWWAQQIPGNKPRMLIYSTSSRPSGIPERFSGSRSGNVMSLTITGALVEDEATYYCCVWTGSQ
Ophiophagus hannah Vs204 trav AZIM01009756.1 3346 ASQSDSVSQTPNNMEILEGENATLPCDFTTLSSSPNLFWYRQYGNQNPERILIAYKSKSSNNHFQEGKFSTTLVLESQNSVPLNIRSVSLMDGAIYFCALN
Ophiophagus hannah Vs205 trav AZIM01009756.1 7196 NLLCHAKNPVQEPLLEAFNGRKTDLFCTHPNIQTNEYIFWYQQFPSQPPYFIVKGYQEPTKSILGERVSLVVAHNRKNSSLSFTNVAFEDQALYFCALG
Ophiophagus hannah Vs206 ighv AZIM01009827.1 8282 AKSQIQLVESGGDLRKPGESLRLSCHGSGFIMRNYWMNWVRQYPGKGLEWLSRMGTTEIYYSDKVKGCFTISRDDSLSQLYLQMNNLKPEDTAVYYCAR
Ophiophagus hannah Vs200 trav AZIM01009217.1 1146 RSTGQSVDQTPGILIVTEGQPVSLNCSYEAEFPVTNYLYWYIQRPGQPLKIWLTKLDNKAQGFQATHYEDKKKGTFNMRKPAIQLKDSSVYFCALT
Ophiophagus hannah Vs168 ighv AZIM01005733.1 42314 AKSQVQLVESGGDLRRSGESIRISCHGSGFTMRSYWIHWVRQYPGKGLEWVAGMGTTIIQYSDNIKGRFTISRDDAKSQLYLQMNNLKLEDTAVYYCAR
Ophiophagus hannah Vs202 trav AZIM01009217.1 13896 TSQSDSVSQKQNHMEILEGEDATLPCNFTTISTTPYIFWYRQYENQIPERILSADKFSSVDKHFQEGKFSTILVLGNQNSVPLNIRRVSLIDEAVYFCALN
Ophiophagus hannah Vs191 ighv AZIM01007660.1 25275 VFPNVQLSQSLFKTQSLGQMVKLECAVSGVEVGDWYWGWSRKCQGKGLEWLGGIKSINGGGEAYYNPCFNNQIVITKDIAKNEFYLELRSVTIGDSAVYFCV
Ophiophagus hannah Vs192 iglv AZIM01007677.1 1413 ANSQYTLTQPAAQSFPMGQPGKISCTMSRDSQVDSYIISWYQQKAGDSPKYLLYDDNTNGRFSGTIDSSANAAYLTITNLQAEDEADYYCGGDYSSG
Ophiophagus hannah Vs194 ighv AZIM01008281.1 8567 VQSQTHLVESGGDMRKPGESIHLSCQASGFTFSGYWLHWVRKAPEKGLEWVLSINPSSSNTFYSDKVKGRFTSSTNNARRQLYLQMNSLKPEDTAVYYCTR
Ophiophagus hannah Vs196 ighv AZIM01008840.1 1830 VQSQVQLVESGGDVRRPGESLRLSCQGSGSYSMSWVRQSPGKGLEWVAHIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCAE
Ophiophagus hannah Vs197 ighv AZIM01008840.1 16323 VKSQVQLVESGGDLRRPGESLCLSCQASGFTFSSYEMHWVRQASEKRVEWVAEISTSSSPIRYSDKVKGRFSISRDDSLSQLYLQMNNLKPEDTGVYYCVRE
Ophiophagus hannah Vs114 trav AZIM01003151.1 62686 VLHLACSQVFQPKQLILREKEEIVLKCTYNITVINNLFWYKQTGRVLAFLGANYNGKSDLPDGFTMNVEQKSRSSKLTRGVARLKDAGVYFCAVR
Ophiophagus hannah Vs440 ighv AZIM01031570.1 824 SLSEVQLVSSGPGTVRPGENLNLLCKVTGVSISRIRYVWSWVRQPPGKGLEWIASISPKDGRKWFSPSLQSRTTISSDNSKNEYSLQLNSMSASDTAVYYCARD
Ophiophagus hannah Vs176 trav AZIM01006032.1 11647 SLGRAKTIEQPLSATALEGKPYRLSCHLSSVTTEMIQWYQQFSGQKPWHLDGTYPNYEDEIENPKGKLPFSKDKTSSTLVIKEATLADTAVYFCVLS
Ophiophagus hannah Vs177 trav AZIM01006032.1 49779 GGTGQSVDQISGIVIVTEGQSLFLRCAYEAQFSGMKFPFWYIQHPGQPLEFLLSEIYMKTQGFQATHHKNKQKGTFNMQKQAIQLKDSAVYFCAFQE
Ophiophagus hannah Vs175 trav AZIM01006032.1 9605 VSGQATVTQKHQFLSVKEGDSTLLNCSYQGTQYSLQWYKQYPGGQPEFIVSLSTSGIKEKDNFKMTLDTVEKSTSLCLKTTQLKDSAVYFCAI
Ophiophagus hannah Vs274 trbv AZIM01000398.1 283902 CSDAKIIQTQSMMLEEGQDVRLVCIQDYGHHNMLWFRQHKQQQDLQLLYNFYNGNIVQKIQSLHHLNADQPTLDHCFLSISVVKPEDSAVYFCASSK
Ophiophagus hannah Vs178 trav AZIM01006032.1 52896 GSTGQSVKQTTGIMTVTEGQLVSLHCSYEAQFKGTYYLFWYIQPPGQPPKFLLASYSKQAQQAQGFQATYIPHENKQKGTFNMQKPAIQLKDSAVYFCAFQE
Ophiophagus hannah Vs179 trav AZIM01006032.1 61025 GSTGQSVIQTSGILTVTEGQPVSLNCFFEAQSGSINFPFWYIQHAGQPPELLLNEIDNKTQGFQAIHHKNGKKGTFNTKKQAIQLKDSAVYFCAFR
Ophiophagus hannah Vs367 ighv AZIM01005992.1 34565 QLVESGGDVRRPGESLRLSCQASGXCQASGFTFSNYWMGWVRQAPGKGLEWVASMGTTTTYYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCAK
Ophiophagus hannah Vs366 ighv AZIM01005992.1 38325 IQSEVQLVESGGDVRRPGQSLHLSCQASGFTFGSYSMDWMRHAAGKGLEWVAYINYPSSAIYYSNKVKGLFTISRDNAKSQLYLQMNSLKPEDTVVYYCTR
Ophiophagus hannah Vs363 ighv AZIM01005930.1 631 ALSQITLTQSSLVRKKRGESVQLKCSITGFDIIHHYMNWLMKRPWKPLEWLVYYRTPKYSGYFPGIQGNFTASKDSSNFYLQMNDLKMEDTAVYYCT
Ophiophagus hannah Vs362 ighv AZIM01005930.1 11108 VLSQITLTQSSPVIKNQGESLQLKCSITGFDIYNHYMQWLMKKPGYPLKWLVHYRILKYSAYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Ophiophagus hannah Vs361 ighv AZIM01005930.1 14099 ITSEITIIQSAAQVKRPGERLWLTCTVSGFSLTSCGISWIRQVSGKELEWIGDIWHNGGTAYSTIFQSRTSITKDNSKSQVYLQLNTVKAEDTAVYYCV
Ophiophagus hannah Vs360 ighv AZIM01005930.1 22850 VLADVSITESGGGVKRPGDSLRLTCTCSGFNIDSYWMHWVHQADGKGLEWISEINKGTTYYDSSFKGRFTISKDSSRNLVYLDMNGLKSEDTAKYYCAR
Ophiophagus hannah Vs369 ighv AZIM01005992.1 12990 QLVEPGGAVRTPGDCLHVTCQASGFTFRNHWMHWMRQAPGKGLEWISNIHPSSSTIFYTGKVKGRFTTSRDNAKSQLYLQMNSLKAEDTAVYYCVRE
Ophiophagus hannah Vs368 ighv AZIM01005992.1 14234 VQSEVQLVESGGDMRRPGESLHLTCQGSGYNFGAYNMNWMKQAPGKRLEWVSWILHDGRETYYSDKVKGHFTISRDNAKSQLYLQMNSPKPEDMAVYYCSR
Ophiophagus hannah Vs402 ighv AZIM01008638.1 25602 GLSQIVLTQSDPVLKKPGESHKLTCAVTGFNVNSYYMSWIRQKPGQGLEWLVSYHIPSSSNYYLPTIQGRFTASKDSSNFYLQMNNLKADDTAVYYCAR
Ophiophagus hannah Vs403 ighv AZIM01008638.1 18728 VFPDIQLVESGPGMARPGSQISLVCKVTGFSIATSSSYAWHWVRQPPGKCFEWLSAINVNNGGKWYATSVKNHVTISADQSRNEFSLQVNSIIAADSSVYFCF
Ophiophagus hannah Vs401 ighv AZIM01008638.1 28340 VFPNIQLVESGPGMARPGSQLNLVCKVTGFSIATSSSYAWHWVRQPPGKRLEWLSAINVNNGGKWYATSVKSRITISADQSRNEFSLQVNSIIAADSSVYFCFR
Ophiophagus hannah Vs406 ighv AZIM01008896.1 17218 VQSQVQLVESGGDVRTPGESLCLSCQASGFSFSNSYMGWVRQTSRESLTWVSYINPSSTSIYYSDKVKGHFTTSRDNAKSQLYLQMNSLKAEDTAVYYCTR
Ophiophagus hannah Vs370 ighv AZIM01005992.1 1477 VRSEVQLVESGEDVRRPGESLHLSCQASGFTFSNYWMTWVRQAPWKAPEWVGDVGTSSTPIHYSDKVKGRFTISRDDSRSQLYLQMNNLKPEDTAIYFCA
Ophiophagus hannah Vs390 iglv AZIM01007612.1 1089 VLSQAQVTQSGPVSVAIAGRTIINCTLQGVEFISSTNPSWYHQKEEQPPKLLFYKSRERASGIPDRLSGDTYANNAQLTISNVEVGDEGDYYCAVWHNER
Ophiophagus hannah Vs376 ighv AZIM01006455.1 5893 VQSEVQLVESGGDVRRPGESLHLSCQASGFTFSSYWMSWVRQAPGKGLEYVARIHFDAAYIYYSDKVKGRFTTSRDNAKSQLYLQMNSLKPEDTSVYYCVR
Ophiophagus hannah Vs377 ighv AZIM01006455.1 979 FFLGVQSEVHLVESGGDVRRPGKSLRLCCQASGFTFSDYYMGWVRQSPGKGLEWVARTWASYIYYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCVRE
Ophiophagus hannah Vs378 ighv AZIM01006853.1 62011 SLAEVQLVSLGPGTVRPGQNLNLLCKVTGVSISDGSYAWHWVRQPPGKGLEWIGSIYPYDGTKRFSSSLQSRTTIASDNSKNEYSLQLNSMSASDTAVYYCARD
Ophiophagus hannah Vs379 ighv AZIM01006853.1 60754 SFSEVQLVSSGPGTVRPGENLNLLCKVTGVSITDSSYTWHRVHLPPGKDFKWIARIHPTDGKKWFSSSLQSHTTISSDKSKNEYSLQLNSMSVSDTAVYYCAR
Ophiophagus hannah Vs158 ighv AZIM01004814.1 12631 IKSQGQMEESGGGLKRPGESLRLSCTGSGFDFGNAGLHWVRQAPGKGLQWIAVIWFDSSKQLYAESVKGRFTVSRDNVNRQLYLQMNNLKPEDTAIYYCTA
Ophiophagus hannah Vs159 ighv AZIM01004814.1 46398 CHSEIQMIQSGGGIKTPGSSITIICKTSGFGFTNYYMSWVRKQPQKGLEWLCRMPSLGTNPWYNPTIVGRFIQTRDNAKASTSLQLNNLELEDSAVYYCTR
Ophiophagus hannah Vs156 ighv AZIM01004814.1 927 VQMEVQLVESGGDVRRPGESLHLSCQASGFTFSSYDMVWVRQFPGKGLEWVAWIDNSGDGSRHSYTNSVKGRFTISRRDASSMLYLQMNSLKPEDTAVYYCARE
Ophiophagus hannah Vs157 ighv AZIM01004814.1 3898 VRSEAQLVESGGNVRRPGESLHLSCQGSGLIFRSKWMIWVRQAPGKGLEWVSYIQPSSASIYYSNKVKGCFTISRDNAKSQQYLQMNSLKPEDTAVYYCS
Ophiophagus hannah Vs334 ighv AZIM01003536.1 121679 GLSQVVLTQSDPVLKKPGESHKLTCAVTGFNINSYNMYWIRQKPGQGLEWIVYYYSSSDNSYSPTIQGRFTASKDSSNLYLQMNNLKPEDTAVYYCAR
Ophiophagus hannah Vs414 ighv AZIM01009584.1 21447 VEMEVQLVESGGDVRRPGESLRLSCQASGFTFSSFEMSWVRQAPGKGLEWVVWIDNNGDGSTQYYANSVKGHFTISRRDASSMLYLQMNSLKPEDTAVYYCARD
Ophiophagus hannah Vs335 ighv AZIM01003536.1 83773 GFSQIVLTQSDPVLKAPGEAHKLTCAVTGFNVNSYWMGWVRQKPGQGLEWLVYYYSESSKYYSPTIQGRFTASKDSSNFYLQMNNLKAEDTAVYYCAR
Ophiophagus hannah Vs411 ighv AZIM01009298.1 12055 ISSQITLTESGDDLKKPGDTLLLICTVSGFAITSYGVSWIRQPTGKAIEWNGIIWGGGSTNYNSGLQNRISITRDTSKNQVFLVLTGLKTEDTGTYYCAG
Ophiophagus hannah Vs384 trav AZIM01006972.1 3422 VQCQDRVDQKPVEVIKEGEDSIISCQFTSNNFYSMHWYRQYPGKEPVLLLTVTSAVLKKHEHFSASFEKQKESRLNIMKVQMKDAVVYFCMAQD
Ophiophagus hannah Vs413 ighv AZIM01009584.1 26647 VQSEVQLVESGGDVKRPGESLRLSCQGSGYNFDDYSMDWVRQAPGKGLEWVSYISYDSSTIYYTDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCA
Ophiophagus hannah Vs412 ighv AZIM01009584.1 28005 VQMEVQLVESGGDVRRPGESLCLSCQASGFTFSSYEMSWVRQAPGKGLEWVAGIENDGDGSTQYYANSVKGHFTISWEDASSMLYLQMNSLKPEDTTVYYCARD
Ophiophagus hannah Vs381 trav AZIM01006972.1 23436 FSMDAQIFQKPAKLEVQEGISFVLKCNYSMQYRTYFWYHQLPGEPPSLTLSISSEEYQNSKGFVAKYLENGKESQLHRPKAQFQDSGSYFCAVD
Ophiophagus hannah Vs336 ighv AZIM01003536.1 71124 CYSQVQLVETGGGIVTPGGSLSLSCKASGFTFTCCEMHWVRQAPEKGLEWVAGVSSSGSNKWYNSKVNGRFTVSRDNSKSSFHLQMNSLKIEDSALYYCAR
Ophiophagus hannah Vs383 trav AZIM01006972.1 17881 VQCQDQVDQKPIEVVKEGEGSTIACQFNSSNVYFMLWYRHTGERPEFLLTVTSVRLEKHKHFSASFDKQKKESWLNIAKVQMKDAAIYFCRAGD
Ophiophagus hannah Vs382 trav AZIM01006972.1 18437 VSGQATVTQKHQFLSVKEGDSILLDCSYQGTEYSLQWYKQYPGGQPEFMVLRTSPGTEAKDHFEMTLDTNNKTTSLYLKNTQLKDSAVYFCAW
Ophiophagus hannah Vs129 iglv AZIM01003619.1 36992 LSLQQLQSLRDPESVPLGGTVTISCRYSTVIADGNYPWWAQQHPGKPPRLLFYNTNIKISDVPARFSVSKSGNVMSLTITGALAEDEAIYYCCLNPGSS
Ophiophagus hannah Vs128 iglv AZIM01003619.1 35052 LADLSLQQLQSLKDPESVPLGGMVTISCRYSTGIIADGNYPWWAQKLPGKPPRLLVYQTSVKPSDVPVRFSGSKSGNVMSLTITGALAEDEAIYYCCLNPGGL
Ophiophagus hannah Vs337 ighv AZIM01003536.1 62452 CQSQVQLVETGGDVVAPGDALHMTCKASGFTFTSYHINWFHLSQNKELKWVAGVDDSGSRLWYNSKVSGRFTISRDNSQSSVYLQMNSLKAEVSALYYCARE
Ophiophagus hannah Vs123 iglv AZIM01003619.1 5433 IDGQSTWTQPPSISVSPGGTITISCTTTQSSHSIYWYQQKSGTAPRFVHCDGCNRGEGIPNRFTATRSGSTGTLTITNAQVEDEAVYYCDSWNSAVSQ
Ophiophagus hannah Vs122 iglv AZIM01003619.1 2360 IDGQSSWTQPPTSSVTPGGTIRLSCTTTHSSYCIAWYQQKPGEAPRYIQCSGYGRGEGIPDRFTATSSGTTGTLTITNVQAGDEAVYYCGNWNSAGNA
Ophiophagus hannah Vs125 iglv AZIM01003619.1 14557 SSLQQLQTLKGPEFVAAGRTITLSCRYDGGNLGDGNYPWWSQQIPGHQPRTLIYHTSSRPSGVPERFSGSRSGNVMSLTITGALVEDEATYYCCVWTGSQ
Ophiophagus hannah Vs124 iglv AZIM01003619.1 11499 IDGQAPWTQPLSRSVSPGGTIAISCTTTQSTKSIYWFQQKPGEVPRYVHCSGCSNRGEGIPDRFTATRSGNTGTLTITNAQDGDEADYYCGSWNSADTM
Ophiophagus hannah Vs127 iglv AZIM01003619.1 19929 IEGQSTWTQPPSISVSPGGTITISCTTTQSSYSIDWYQQKSGTAPRFVHCDGCSRGEGIPDRFTATRSGSTGSLAITNAQVEDEADYYCGSWNSAVTQ
Ophiophagus hannah Vs126 iglv AZIM01003619.1 17345 IDCQSTWIQRPSISMLLGGTITPSCTKQSSYRIYWFQQKPEDAPCFVHTDGNDGRGEGIPDRFTATRSGNTGSLTITDVQAEDEADYYCGSWNSADTV
Ophiophagus hannah Vs333 ighv AZIM01003536.1 128248 LTQSDPVLKKPGESHKLTCAVSGFDLNSYYMNWVHQKDGQRLEWLVYYYSSNSGYYSPTIQGRFIASKDSSNCYLQMNNLKAEDTAVYYCAR
Ophiophagus hannah Vs74 trav AZIM01001663.1 138385 WISISQVIQAPVYHDLQEGDRVTITCKSNTAYSYFHWYRQGPRMPLSYLLSITSSQNVTKEGWTAEYLDTGQRSCLHLPSSLLQDSGTYFCGVS
Ophiophagus hannah Vs75 trav AZIM01001663.1 148949 VSGQATVSQKHRFLSVKEGDSILLNCSYQGMEFSLQWYKQYPGGQPEFMVLLSTSGIKEKDNFKMTLDTNNKMTSLYLNNTQLKDSSVYFCAL
Ophiophagus hannah Vs76 trav AZIM01001663.1 149509 VQCQDRVDQTAVEVIKEGGDSNITCHFNSSTVYGMHWYRQYAEEGPEFLLMVTSVNWEKVDNFRASFDKQKKESHFSIAKVQMKDAAVYFCRT
Ophiophagus hannah Vs415 ighv AZIM01009584.1 13164 AQSEVQLTESGGDVRRPGESLHLVCQASGFTFSDYSMHWMRQVHGKGLVWVAHIRYDSTSFHYSDEVKGRFTISKDNAKDQLHLQMNSLKHEDTAVYYCAR
Ophiophagus hannah Vs380 ighv AZIM01006853.1 55183 SLSEVQLVSSGPGTVKPGQNLNLLCKVTGYSITDGSYAWSWVRQPPGKGLEWIARIYPKDGRKWFSSSLQSRTTIASDNSKNEYSLQLNSMLAADTAVYYCARD
Ophiophagus hannah Vs408 ighv AZIM01009147.1 14097 VQSQVQLVESGGDARKPGESLHLSCQGSGFTFGSYDMSWVRQAPGKGLEWVAGIYTDSSGKFYSGKVKGRFTISRDNAKSQVYLQMNSLKPEDTAVYYCAG
Ophiophagus hannah Vs409 ighv AZIM01009147.1 2466 IQSQVLLVDSGGDVRRPGESLPHSCQASGYSCSGYRMHWMRQPSGKGLEWVSHISYNPGPLTYSDKVKGCLTTSRDNAKSQLYLQMNSLKPKDTAIYYCVKE
Ophiophagus hannah Vs398 ighv AZIM01008249.1 13837 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYEMNWVRQAPGKGLEWVALITSASSTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Ophiophagus hannah Vs399 ighv AZIM01008638.1 39708 GLSQIVLTQSDPVLKKPGESHKLTCAVTGFNVNSYYMDWIRQKSGQGLEWLVHYYSTSTNYYSPTIQGRFTASKDSSNFYLQMNNLKADDTAVYYCAR
Ophiophagus hannah Vs396 iglv AZIM01008052.1 7796 SFAQYVLTQPASVSVPLRQNARITCSANNIASKNVHWYQQKPGDPPVLIIYNDNQRPTGISDQFSGTNSGNTATLSISRAQAQDEAVYYCQVFDSNQ
Ophiophagus hannah Vs397 ighv AZIM01008249.1 17884 VHSEAKLVATGGGVRRPGESLRLSCQASGFSFSSYSMYWVRQASEKGLEWISEIHPSSSNLYYVNKVKGRFTISRDDAKNQLYLQMNSLKAEDMAVYYCA
Ophiophagus hannah Vs394 iglv AZIM01008052.1 20468 ITSQPTLTQPVSQSGSPGGTVKLSCAISSNPNNVRWVQQKSGEAPRFVHCDACSSRGDGIPDRFMATRSGNNGYLTITNLQAEDEADYFCCMWYSSGNM
Ophiophagus hannah Vs395 iglv AZIM01008052.1 16262 VTSEPTLTQSVSQSGPLRGTIKLSCAISSDEMAISWLQQRSGGAPHFVHCDGCNRGPGIPGRFTGTRSGNNGYLTITTLQAEDKANYYCYMWYSSGGR
Ophiophagus hannah Vs392 ighv AZIM01007888.1 22668 VQSEVQLVESGGDVRRPGASFHLSCQGSGFTFSGAYMHWMRQAAGKGLEWVAFIDTSSNTYYSDKVKGCFTISRDNAKSQLYRQMNSLKPEDTSVYYCAG
Ophiophagus hannah Vs393 ighv AZIM01007888.1 9289 VQSEVQLVESGGDVRRPGASFHLSCQGSGFTFSGAYMHWMRQAAGKGLEWVAFIDTSSNTYYSDKVKGCFTISRDNAKSQLYRQMNSLKPEDTSVYYCAG
Ophiophagus hannah Vs404 trav AZIM01008735.1 17958 DSQSDSVLQTQSNMEILEGGDATLPCDFETTSYNPNLYWYRQYGNQNPERILTAYKSKSSNNHFQEGKFSTTLVLESQNSVPLNIRSVSLLDAAVYFCALN
Ophiophagus hannah Vs405 trav AZIM01008735.1 9846 KVSGQTMTQTEGRVTITEGQPIFLNCTYAKSIDYQPSPFWYIQYPGQSPKLFKSTFLTPNVDISLPQNFTAIHNKAGMSFHMKKSVSQLNDSAIYFCAVR
Ophiophagus hannah Vs237 ighv AZIM01054652.1 415 VQMEVQLVESGGDVRRPGESLRLSCQASGFTFSIYEMSWVRQAPGKGLEWVASIEDDGDESTQYYADSVKGRFTISQRDASSMIYLQMNSLKPEDTAVYYCAGD
Ophiophagus hannah Vs236 ighv AZIM01042745.1 32 VQSEVQLVESGGDVRRPEESLRLSCQASGFTFSSYGMSWVRQAPGKGLEWVAWISGSSTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Ophiophagus hannah Vs338 ighv AZIM01003536.1 33125 VESVVQLVASGGDVRKPGESLHLSCQASGFTFSDHWMTWMRQAPGKGLEWVLYIGTSSPIYYSDKVKGHFTISRDDSRSQINLQMNSLKPEDTAVYYCGR
Ophiophagus hannah Vs233 ighv AZIM01030177.1 653 VQSQVQLMESGGDVRRPGESLRLSCQASGFTFSNYYMWWVRQAPGKGLEWLAYINSASSDINYSDKVKGRFTVSRDNAKSQLYLQMNSLKAEDTAVYYCAR
Ophiophagus hannah Vs132 iglv AZIM01003619.1 46358 TFSQVVLTQLESVSGSPGATIRITCAKNSGTLDTGDSSWYQQKPGNTPKLLIYRDSSRASGIPERFSGFIENSKTSAVLTISNLQAEDEAYYYCLYYIGSDG
Ophiophagus hannah Vs133 iglv AZIM01003619.1 52958 ASAQFVLTQPAFVLTHLEGTVQISCTRSSGAMSGYYVSWYQQKSIEPSKLLIYQHVYRPADVPDRFSGATDSSRAILTITGVQPEDEAKYYCQSYDGNWM
Ophiophagus hannah Vs130 iglv AZIM01003619.1 38141 LSLQQLHSLKDPEWVSLGGTVTISCRYSTGIISDNNYPWWAQQQPGKSPRLLVHHTSVKPSDIPARFSGSRSGNVMSLTITGALAEDEALYYCC
Ophiophagus hannah Vs131 iglv AZIM01003619.1 40556 ASMQQLQSLKNSESVAVGGTITMSCSYSGGTISDNNYLRWLQQKPGKVLRLLVATSNTRPSGVPARFTGTTSGNTMSLTIAGTLGEDEATYYCTVWTGSG
Ophiophagus hannah Vs135 iglv AZIM01003619.1 71196 VVSQVGLIQPPFQSVALGNNIRLSCYLMIGYEDYEVSWYQQRPGQAPRLVLTPSYSRGHGIPNRFSGFKSDNTYYLTITDVQPEDEATYYCGGSYGFE
Ophiophagus hannah Vs437 ighv AZIM01020357.1 936 VHSQVQLVESGGDVRRPGESLRLSCQASGFTFRNHEMSWVRQAPGKGLEWVAMVYIWSSDIYYSDKVKGRFTISKDIAKSQLYLQMISLKREDTAVYYCA
Ophiophagus hannah Vs434 ighv AZIM01016772.1 2059 VRSESQLVESGRDVRRPGESLCFSCQASGFTFSDYYMDWVRHAPGKGLERVATIHPSSSSIYYSNKVNGHFTISRDNAQSQLYLQMNSLKAEDMAVYYCLPE
Ophiophagus hannah Vs433 trav AZIM01016298.1 1065 GSTGQSVKQTSGIAAVAEEQTISLNCSYEVQYSGMNYPFWYTQYPGQPPKLLLTKFNKSAQGFQSTQLENDKKGTFNMLKQAIQLDDSAVYFCA
Ophiophagus hannah Vs432 iglv AZIM01015871.1 806 ASIQQLQSLKNSDFVALGGTITMSCRYDGGTITDNNYLRWIQQKAEETPRLLIHGSSSRPSGVPARFSGSRSGNTMSLTIQGALVDDEATYYCAVWTGSG
Ophiophagus hannah Vs375 ighv AZIM01006455.1 13535 VHSTIQLVESGPGTVNPGGSFKLTCKVTGDSIKNVYWEWIRQATGKGLGWVGQIDWSSDNWRTYYASSLQSRTTLTADESRNEYYLTMRSLTAADSATYYCARR
Ophiophagus hannah Vs226 ighv AZIM01020616.1 482 VQSEGQLVESGGDVRRPGESLHLSCQASGFTFRSYWMAWMRQYPGKGLEWICHIHPSSSSIYYSDKVEGRFTTSRDNAKSQLYLQMNSLKAEDAAIYYCTK
Ophiophagus hannah Vs227 iglv AZIM01020624.1 308 INGQSTWTQPPSLSVSPGETITIPCRTESTNPISWYQQKAGEAPRFVHCDGCNRGEGIPNRFTATRSGSTGTLSITNTQVGDEADYYCGSWNSAGNQ
Ophiophagus hannah Vs224 ighv AZIM01017309.1 77 VQCDVQLVESGGDVKTPGGSLSLLCQTSGFNFNVFWMNWLRQYPGKGLEWIARITTGSPPSVYYQDKFKGRFTVSRDDSHTQVYLQMNNLKAEDTAIYHCAR
Ophiophagus hannah Vs225 ighv AZIM01017425.1 1742 SLAEVQLVSSGPGTVRPGQNLNLLCKVTGVSITDSSYAWHWVRQPPGKGLEWIASIYPYDGRKWFSSSLQSRTTIASDNSKNEYSLQLNSMSASDTAMYYCARD
Ophiophagus hannah Vs221 ighv AZIM01015449.1 1603 VQMEVQLVESGGDVRRPGESLRLSCQASGFTFSSYEMSWVRQAPGKGLEWVAWIDNNGDGSTQYYANSVKGRFTISRRDASSMVYLQMNSLKPEDTAVYYCAGE
Ophiophagus hannah Vs169 ighv AZIM01005733.1 44470 VRSQVQLVESGGDLRRPGGSLHLSCQGSGFSFGGYNMNWVRQAPWEGLEWVAWVRYDGGETYYSGKVKGCFTTTRDNAKSHLYRQINSLKAEVYYCAR
Ophiophagus hannah Vs345 ighv AZIM01004238.1 29745 VSATVTLTQPPEALALPGRSITLTCTVSGYNIGDHHLSWIRQSNGKKLVFITSFRTGYATYTANEFKGRVSSSTHGSTAQLRIDALKVEDTATYYCAR
Ophiophagus hannah Vs228 ighv AZIM01022329.1 695 GQSQVQLVESGGDVRRPGESLSLSCQASGFTFSSYDMGWVRQAPGKGLEWVTYITPTSGTIRYSEKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCA
Ophiophagus hannah Vs229 ighv AZIM01024587.1 466 VQSEVQLVESGGDLRRPGESLRLSCQASGFTCSSYYMGWVRQTPGKGLEWVVDIGRSSSPTRYSDKVKGRFTISRDDSRSQFYLQMNSLKEEDTAVYYCVRE
Ophiophagus hannah Vs420 trav AZIM01011019.1 5543 RSRGQSVDQTSGIVTATEGQPIFLYCSYEAQIGGSHYPYWYIQHSGQPLKLFLGWHKNNVQGFQATTHKGKTNGTFNLQKDASQLKDSAAYFCAFS
Ophiophagus hannah Vs421 trav AZIM01011019.1 3645 QSTGQSVDQTSGRVTLTEGQTVSLSCSYEAQYRGEFDTYWYIQHPGQPLKYLLDSSVNEAQGFQATHIPHGNKHEGTFNMQKPAIQLNDSAAYFCAFR
Ophiophagus hannah Vs422 ighv AZIM01011142.1 5229 VKCQVQLVESGGDVRKPGESLHLSCQASGFTFSNYYMYWVRQAPGKGLEWVARIGTSSSPISYSDKVKGRFTISRDDSRSQLHLQMNNLKVEDTAVYYCAR
Ophiophagus hannah Vs423 ighv AZIM01011142.1 2313 IKCSVQLEQSGVYVKRPGESLLISCKGSGFNFGSYGMNWVRQASGKGLEWVAVIWYDASRQEYAESVKGRFTITRDNAKSQLYLQMNNLKAEDTATYYCAR
Ophiophagus hannah Vs424 ighv AZIM01011155.1 2807 VQSQVQLVESGGDARRPGGSLRLFCQGSGFTFRSYHMSWVRQAPGKGLEWVAGIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCAG
Ophiophagus hannah Vs425 ighv AZIM01011155.1 1061 VQSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYWMSWVRQAPGKGLEWVSYISDGSGTISYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Ophiophagus hannah Vs427 trav AZIM01012407.1 675 VSGQAIVTQEHQFLSIKEGDSIRLKCSYSEAASSLQWYKQYPGGQPELMIILYSTRTETNDNFEMTLNTNNKTTSLYLKNTQLKDSAVYFCAW
Ophiophagus hannah Vs428 ighv AZIM01012896.1 1937 VQSEVQLVESGGDVRRPGESLRLSCQASGFSFSSYAMHWARQAPGKGLEWVAYINADSSDINYSDKVKGRFTISRDNAKSQLYLQMNSLKPEDTAVYYCAR
Ophiophagus hannah Vs429 ighv AZIM01012896.1 867 VQSEVQLVESGGDVRRPEESLRLSCQASGFTFSGFGMHWVRQAPGKGLEWVAYISTGSSPSTYYLDKVKGRFTISRDDSRSQLYLQMNNLKPEDTAVYYCAR
Ophiophagus hannah Vs218 iglv AZIM01012917.1 3899 PSLQQLQNLKDPEFVASGGTVTISCQYDGGNLGDGNYPWWSQQIPGNPPRALIYRTSTRLSGVPERFSGSRSGNVMSLTITGALLEDEATYYCCVWTTNQR
Ophiophagus hannah Vs365 ighv AZIM01005992.1 39445 VQSQVQLVESGGDVRRPGESLCLSCQSSGFTFSSYGMNWVRQAPGKGLEWVAYIWSSNLYYSDKVKGHFTISRDNAKGQLYLQMNGLKPEDTAVYYCVR
Ophiophagus hannah Vs400 ighv AZIM01008638.1 30558 CHAEVKLVETGGSVVVPGGSLRLTCKASGFTFTNHAMHWIRQSPGKGLEWVAGVSQPEGTKQWYNSKVEGRFTISRDNSQTSAYLQMNNLKPEDSALYYCAR
Ophiophagus hannah Vs410 ighv AZIM01009298.1 23259 SSSSPTIIESGGDIKRPGESIRLTCTMSGFSVAESYIDWIRQRPGEGLEWIGRIAKSGSVYYNSILQNRLTFTTDTSKNQGFVQVNGLKPEDTALYYCAN
Ophiophagus hannah Vs77 trav AZIM01001663.1 152504 CSLDTQIIQTPAKLEVQEGGSFTVKCNYSIQYQPYFWYHQLPGEPPSLILSISSQGSEEKKGFVAKYLDKGEESQLHRPTAQFQDSGNYFCAVR
Ophiophagus hannah Vs134 iglv AZIM01003619.1 68588 VNSQTPWTQPTSMSVSRGQTVKISCTVTGSLYIISWYQQSSGQAPRYVHYSGGNRGDGIPDRFTASVSGSTGYLTITGTQAEDEAVYYCLMWHSSASS