WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Latimeria chalumnae AFYH00000000.1 (AFYH01) 563 130 3 25 180 133 58 34
Latimeria chalumnae BAHO00000000.1 (BAHO01) 327 125 0 9 64 59 57 13
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Latimeria chalumnae Vs1599 ighv AFYH01191454.1 4331 IQADVVLTESGGDVKKPGESLRLSCKTSGLDLDSSNIEWIRQPLRKGLEWVAEIDYDGDTYYTQSVQGRFTISREVSSSMVYLQMNSLTVEDTAMYYCAGE
Latimeria chalumnae Vs847 ighv AFYH01269728.1 256 VQSDVVLNQSGAEVKKPGESVKLSCKTSGYDYTDYYLHWIRQRPQKGLEWIVRINTGDGNGDFHQSFQGRFTISEDVSSATAFLQISSLTVEDTAMYYCARE
Latimeria chalumnae Vs860 trbv AFYH01273693.1 2846 RGEIVQVTQTPTSIHPNTGNSMEIQCKQDSNKQYMYWYQQRKQEGLKAIGQILIATKGAKPKYEPGFTSRFEIMGIDSKAGSLKISNLTAEDSAVYFCAVSD
Latimeria chalumnae Vs861 trbv AFYH01273693.1 4897 HGEIVQVTQTPTSLYPNAGNYMEIQCEQHSNKQYMYWYQQRKREGLKAIGQIFIATKGEKPKYEPGFSSRFEITRNDSKAGSLKISNLTAKDSAVYFCAAG
Latimeria chalumnae Vs862 trbv AFYH01273693.1 6212 RGEIVQVTQTPASLHPNTGNSTEIHCKQISNKNTMYWYQQHTREALKCIGQIYLPGTGGDPVYESGFTSGFQITRIDSKAGSLKISNLTAEDSAMYFCAVG
Latimeria chalumnae Vs863 trgv AFYH01274206.1 257 GVVSITLEQPELSVSKSVTETVKLSCRFQGVSIIHWYILKPNEALQRILYYGSAARNGYDEGFNKKSFRAEKKNDECFLFIYNLEMSDTATYYCA
Latimeria chalumnae Vs1318 trbv AFYH01119984.1 3685 LCGGAILVTQLPKSLTGKPGKPVEMNCTHNDTSSASTVYWYQQYRGQGLTLIAYSITAEENGKPETGFEKEFEVKRPDKQKSILKINKLKASDTASYLCAVSK
Latimeria chalumnae Vs1319 trbv AFYH01119984.1 2374 VSGGVIHVTQLPNSLIGTARNTLEINCTHTDTSSAAHRIFWYQQKRGQGLTLIVYTVGAGGNPNFEQDFDKDFNVSRPDNFHSTLKIKELKAADTASYLCAVSK
Latimeria chalumnae Vs592 igkv AFYH01182561.1 3604 SRGDITMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQKPKSLIYDSVKRYTGVSSRFSGSGYDYDFTFTSNNVQAEDAGEYYCQHYENFP
Latimeria chalumnae Vs1314 trbv AFYH01119983.1 875 LCVGNILITQLPKSLIGRTGKAVNLTCTHTDTSASVHNIFWYLQKRGQGLTLIVYTYGARGKENFEKDFEKEFIVRRPTNMESSLEIKQLKALDTASYLCAVSK
Latimeria chalumnae Vs1315 trbv AFYH01119984.1 7548 LYSGVIFVTQLPNSLTGGSGKAIEINCKHNDTINTVHRIFWYQQKRGQGLTLIVYTVGAGGNPTFEQNFHNEFNVSRTDNLHSTLKIKALKAADTARYLCAVSE
Latimeria chalumnae Vs1316 trbv AFYH01119984.1 6333 LCGGAILVTQLPNSLTGRTGKSVNLTCTHDDKSGNAISIRWYQQKRDQGLTLITYSLTDEDKGNPEPGFEKEFEGIRTGREKSILKIKKLKAADTASYLCAVSK
Latimeria chalumnae Vs1317 trbv AFYH01119984.1 5058 LCGGAILVTQLPNSLTGRIGNPVKINCTHNFTGADPYSIFWYQQKRGQGLTLIVYTASAGGEPKFESDFEKEFEVTRPDNRNSALTIKGLKAADAASYLCAASK
Latimeria chalumnae Vs1310 trbv AFYH01119982.1 53583 LCGGVIHVTQLPNSLTGRTGNEVNLTCTQHDKSGSTIYLYWYQQKRDQGLKLIAYTSFDGENPDQETGFEKNFQVTRPNEENSILNIRELKAADTATYLCAAS
Latimeria chalumnae Vs1311 trbv AFYH01119982.1 47562 VVCQQVNKVMQWPSQAAVPWGQSVEVRCSQSLSGNVMSWYQQQNSRGLQLVFYSYYLNSPEPAKGIPGRFNCSRTNQQNAVLLLSKAEPEDTGLYYCSAG
Latimeria chalumnae Vs1312 trav AFYH01119983.1 4214 LCGGAILVTQLPKSLTGRTGSTVNLTCTHDDTSANLIYVFWYQQKRGQGLASISYTSTDGEKGKPEPGFENKFEVTRPDRKESILKIKDLKAADTASYLCAASK
Latimeria chalumnae Vs1313 trbv AFYH01119983.1 2756 LCGGVIPVTQHPNSLTGSAGKEVNLTCTHHDKGGTNIYLYWYQQKRDQGPRFIAYTFLAGEKPDPETGFEKKFEVTRPNKENSILKIKELEAADTASYLCAASK
Latimeria chalumnae Vs1798 iglv AFYH01243275.1 4139 TGCLAELTQPPDKSVMEGKTAEIQCDGVATADIVFWYKQHPRRGPEFLIYEYSVLEEGGQYDLKRNKTSNFCILSIRGVNVRDTALYYCAVS
Latimeria chalumnae Vs1799 trav AFYH01243276.1 18013 KGCLAKLAQPPETVVKEGETAKIQCDDVDTSETIFWYQQYPYQKPKYLISAFKNKKEEKPFKVEINITSNFCTLSIRGVNVGDAALYYCAVS
Latimeria chalumnae Vs1169 trav AFYH01079942.1 2327 QQSFAKFTQTPYETVEEGTVVKIRCDGIDPTDYTFWYKQGFGPTHRSLQLVISEFGDEKNNQFNLTKDTPSKSSTLTIKEVQLGDAALYYCAQS
Latimeria chalumnae Vs1168 trav AFYH01079940.1 404 FCKGDSVTEWDLEKNTIEGETVILRCNYTATSTSNPVLMWYKQHLSRPLEYLLQVDNFNPKANRPGGKLTSELKKEEKSVSLSIPKTELSDSGVYYCALR
Latimeria chalumnae Vs1167 trav AFYH01079940.1 8096 ILFLGKECLGKPSQLPYKIAEEGKTAEILCGAINVNYNILWYKQTPHHSQKRLQLITYGFGNDEKDQFQLTQGMENQTSTLTIRNVHLGDAALYYCAES
Latimeria chalumnae Vs1166 trav AFYH01079938.1 393 KECQAKLSQPAYETVEEGKSVQILCKEIDTSSLTLWYKQTPLHNQKGLQLIIHGYESTQEKQFNLTVDKQNKFITLTIKEAHLGDAGLYYCAES
Latimeria chalumnae Vs1419 trgv AFYH01131029.1 8896 GVMSITMEQTQLSITKSVTRTAKLSCRFQGSSYIHWYRLRPNEALQRILYYESEAKSEYDAGFSNMKFRAEKNNDECFLYIHSLEMSDTAMYYCAGWD
Latimeria chalumnae Vs1793 ighv AFYH01243044.1 344 IQSQVNLTESGGDVKKPGESLKLSCKASGFTFSSYTMCWIRQPPGKGLEWIAYITGSGSTGYFQSVQGRFTASRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs1163 trav AFYH01079935.1 5636 FCKGDKVTEWDLVKAATEGDTVTLQCNYTATTISSPNLMWYKQKLNRPLEYLLQVHEYKTTDNTTGEKFLTSELKSKDNSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae Vs1162 trav AFYH01079934.1 541 REGASKPEQPSSMEAAEGKEVNLSCTYNLPTNYYIQWYKQTKESLKYLIQTLKNPENDGRYTLTIVEDRKNNTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae Vs590 igkv AFYH01182555.1 12676 SIGQIVLDQSPTSKSVLLGESVTINCKASRGISNDLHWYQQKPGQAPELLIRFATTRHTGVSNQFTGRYSGTDFTLTIGGVQAEDAADYYCQQSNSFP
Latimeria chalumnae Vs1710 trgv AFYH01221033.1 4373 GIVAVTSDKIVSVTKGEGKTAEIICRVSASSSYIHWYRQEDGKAPERYVFYEKTSGDSGTTLKSASSKTVEVRNLGDNKFSLKIFSTTESDTGMYYCASWD
Latimeria chalumnae Vs1711 trgv AFYH01221037.1 9971 RVSAVPLEQSELSITKPPGKVARFTCYVSNSFNEQVAVAIIHWYRARKPDQGLERVLYYSYEVKHDPGFKKDKFTATKTANSFTPMIDNVAEDDNGDYYCAYWQ
Latimeria chalumnae Vs1712 ighv AFYH01221037.1 2214 RCSGFSLRQPDQYKLVRASRNARIECRMEGGSIQDKYIHWYWQQEGKELEWILYFKSQTERDTLAGLPARFTVGKNTRNNACVLTVSNTKEEDSATYYCAAWEA
Latimeria chalumnae Vs1713 trgv AFYH01221039.1 1819 GVGTVTLEQPEASITKTLGKIVRLTCRVSGVSVVDAAIHWYRDRPSEGMKRILYYSTQVNHDSGFTKDRFAAEKDGGSCSLIIPSVIEDDSGDYYCAYWD
Latimeria chalumnae Vs1714 trgv AFYH01221041.1 350 NLTAVTLNQLEPSITKTPERTAKFTCSVSGVANLDNAIIHWYRARADQAPERILYYSSGRAVHDEGFSKAKYSAEKDNNFILRLSNVAEEDNGYYYCAYWD
Latimeria chalumnae Vs1715 trgv AFYH01221042.1 7202 GVVSITLEQTQQSVTKSVNSIARLPCKFQGVSYIHWYILRPNEALQRILYYESEAKGENDQGFSNVRFQAEKISDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae Vs1716 trgv AFYH01221042.1 4219 GVVSITLEQTQLSVTKSVNSIARLRCKFQGVSYIHWYRLRPNEALQWILYYESATKKEYVEGFSNMRFKADKSGDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae Vs1844 ighv AFYH01257135.1 2265 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYYMNWVRQPPGKGLEWVAIIYTGSSSIYYTPSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCAGD
Latimeria chalumnae Vs1845 ighv AFYH01257139.1 1613 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYYMHWIRQPPGKGLEWIAYISGSGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs1846 ighv AFYH01257141.1 1799 VHSAIELTQSDPQVGKPGESLKLKCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHSSSSNYYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARL
Latimeria chalumnae Vs1847 ighv AFYH01257144.1 1201 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYWMAWIRQPPGKGLEWIAYINTDGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs412 ighv AFYH01118926.1 5771 VESAVVITYSDPEVKKTGESVRIWCKTSGFTFGDYSMLWYQQLPGKGPRWIAFITYWAGSNIQYIPSVQGRFVISRDNPNSLLYLQMNNLRVEDTAIYYCER
Latimeria chalumnae Vs1842 iglv AFYH01256522.1 1509 TFRQTTPVMSVSPANKVTLECSVSNGNVEEIGMSWIRQTPGKAPEGVLYFKKDQTVYRAPNITERFVPSRDSSVSKFFLTISDVCETDDSVYFCFIYYTDG
Latimeria chalumnae Vs1156 trav AFYH01079931.1 9937 REGASKPEQPPSMEAAEGKEVNLSCTYTLPLTDYIHWYKQTKESLKHLIQAHSGAPNDGRYTLTIAADRKNSTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae Vs411 ighv AFYH01118925.1 8272 VESDIVLTQSEAEAKKAGDFLTISCKASGFDFSNYYMSWYRQLPGEGLEWLGYISTTGNTKYFQSNQGRFKISRDNPSSMLYLKLNGLIVKDTGTYFCVRNQA
Latimeria chalumnae Vs1157 trav AFYH01079931.1 3945 REGLAKLSQLPYKTTKEGESVQILCKDIDTSEIVQWYKQTPQHSQKGLQLMISGYSDENERFNLTTEKKNQSSTLTVKEVQLGDAALYYCAQS
Latimeria chalumnae Vs403 ighv AFYH01118919.1 9726 IQFTAVLTQDGTEVRKAGESIKLKCDLSGFDVNSYWMYWYRQAPGKELEWLVTYDTSSNNAHSPSIQGRFTASKENSNFYLQMNNLGVGDTATYYCARSD
Latimeria chalumnae Vs1303 trav AFYH01118963.1 5969 ADARRTLCPRQSTMELSEGKDLKLNCTYELEFANNNFGLFWYRQYPGKPLEYLLRADSYGTHEREITDQRFNVSLEKEKKAVYLLISTVEIADSAVYFCALS
Latimeria chalumnae Vs1302 trav AFYH01118961.1 502 TVSPVASTLKASEEESLTLNCTYETSNPNGAALFWYRQAVSQYLEYLLRITTYGNTVEEISTDGRLKIILEKEKKTVLLNISTAELTDSGMYFCALS
Latimeria chalumnae Vs1301 trav AFYH01118959.1 6901 KANGDEVFQEDRKVSVQEKQNVTLFCNYTTSDPDPYLFWYFQYPGHSPKYILQRSKHINNKGSGFSGFDARLERNKLFSLNIESAEIKDGAVYYCALR
Latimeria chalumnae Vs1300 trav AFYH01118959.1 9380 LCTVGQKDEVFQPTRVLKIAEGENVTMNCNYTTSVSDVYLFWYQKPLKYLFQVNFFNKVSREEITGDHYIGKLDLVNNNASFSIVAAKIWHTGVYFCALR
Latimeria chalumnae Vs1304 trav AFYH01118963.1 3263 SAIQPVSTIKASEEEKLTINCTYNTAYPNSVALHWYRQYAGGSLEYLLHADAYNKIYRGESTEQCFNTSLEKEKKHVFLYINPLQVADSAVYYCALR
Latimeria chalumnae Vs1268 trdv AFYH01118934.1 1919 AVSNPAMVQRELLETIAGNKVSFECSLKDGNMGSYFMYWYRKRPQNSLEWIYREGDYYGDGFKDRFFGKVISSDNKFILEIKTAERGDAAVYYCAA
Latimeria chalumnae Vs1269 trdv AFYH01118935.1 791 LTEEDNVTNVQDTLFALEGESAKISCTYSKSISSFSSYWYKQHPGGNLIILCRKDDDDFEINKAGNRFAVNLHKSDNALSLIIKGLQLYDSALYYCALTK
Latimeria chalumnae Vs1118 trav AFYH01079901.1 5608 EVFGDSVQQDQTVQPQKEGGSVTLTCTYSTTNSNIYLHWYRKYPNGVPDYILKRGAKSYSSYQHTAEFAKGKFESNADSSTTRLTINNLQLSDTALYYCALEI
Latimeria chalumnae Vs1119 trav AFYH01079902.1 3815 EVFGDAVQQDQSVHSPKEGNSVTLTCTYSTTENDIYLNWYRKYPNGVPKFILYKGAKWNSGTDQTAEFAQERFDSRADSITTTLRINNVQLSDAALYYCALCID
Latimeria chalumnae Vs811 ighv AFYH01256697.1 4872 VQSAIVLTQSGAEVKKPGESVKLSCTPSGYSYTSYNLYWIRQIPGKGLEYIGYQSTGSGSAGYHPSFQGRFTISEQVSLTTTYLQISSLRIEDTAMYYCARQ
Latimeria chalumnae Vs810 ighv AFYH01256692.1 6055 VQSAIVLTQSGAEAKKPGESVKLSCTPSGYSYTSYNLQWIRQVSGKGLEYIGYQSTGSGSAGYHPSFQGRFTISEEISLTTTYLQISSLKVEDTAMYYCARQ
Latimeria chalumnae Vs813 ighv AFYH01256699.1 1906 IQSQIILTESGGDAKKPGESLSLSCKTSGFTISSYYMHWIRQPPGKGLEWVSRLDTGSGKLYSQSVQGRFTISRDNANSMLYLQMNNLRVEDTAMYYCAGD
Latimeria chalumnae Vs595 igkv AFYH01182567.1 6769 SSSQTTMEQSPLTSSVIPGETVTIKCKASSGIGDNIAWYQQKSGQKPKLLIYETTARASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYCQQYNSWP
Latimeria chalumnae Vs1113 trav AFYH01079900.1 105927 FGNSIQSEKLLLSQKDGNPVTFTCTYSTSASWIYLFWYRKYPNGAPEYILRRGAKSNSGDDHTAEFAKDEFNSRADSSTTTLTIKNVQLSDAALYYCALWIDS
Latimeria chalumnae Vs1263 trdv AFYH01118930.1 18041 HSFGNSVSQDDQPLTVNEGSASSIINCKYSTSYSSYYLFWYRQYPQKPLEFLIRKYSDGSEHKSNSADRRFSSDLNTSQKKFTLTIKDLQLSDSAVYYCGLWE
Latimeria chalumnae Vs1264 trdv AFYH01118930.1 15504 NSLGNSVSQDISPLSAIKGSTVTIKCSYSTSYSNFVLPWYRHKPQESLEFLLLKYWDDDGYNLAGDRFSLDLKTNQKSITLTIKDLQLSDSAVYYCGLWD
Latimeria chalumnae Vs1265 trdv AFYH01118933.1 2560 AGSNPVVDQFQKNLETFAGNEVNFECSLNGGSMNDYYMSWYRLQPKKSLELIYSERGNKYGDGFQGGFVGKVESSNNKCTLKIKAAELGDAAMYYCAAAR
Latimeria chalumnae Vs1266 trdv AFYH01118934.1 16239 AASNQVVQLNDKLDTVAGNSVTFECSLKDGSMGSYYMFWYRQRPKNSLEWIYKEGGKYGDRFGDRFVGTVDGSNNKCTLEINAAELGDAAVYYCAAS
Latimeria chalumnae Vs1267 trdv AFYH01118934.1 4154 AGSNPIILQLERLETPAGNKVNFECSLKDGGMGSYWMNWYRQRPKNSLELVYSQYGSKYGDGLADRFVGKVESSNNKFTLEIKAAELGDAATYYCAAW
Latimeria chalumnae Vs1910 ighv AFYH01282515.1 3510 VQSDVVLTQSGAEVKKPGESIKLSCKTSGYSYTSSYLHWIRQHPQNGLEGIVRIDTGEGKGDFHQSFQGRFTISEDVSSATAFLQISSLRVEDTAMYYCARE
Latimeria chalumnae Vs597 igkv AFYH01182575.1 2512 SSSQITMEQSPLTSSVIPGETVTIKCKASSDIDDYIAWYQQKSGQKPKLLIYAASTRASGISSRFSGSGSGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae Vs1598 ighv AFYH01191453.1 2407 IQSDVILTESGGDVKKPGESLKLSCKASGFDFSSYWMYWFRQPPGKGLERVAGISSPSGSTTHYSQSVQGRFTISRDNSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs1708 trgv AFYH01221033.1 13655 GVDAVPFHQPLSVIKPETKTAEISCSEASSSYIHWYRHRDGEAPTRILYLDSSNDNVNRDSGFSAAKYESLKPGNNKYILKIHTAEESDSGMYYCARWD
Latimeria chalumnae Vs1707 trgv AFYH01221031.1 798 GIVAVTSGKKMSETKIEGKTAEVTCEVEDTSYNYIHWYRQLDGKALERILYYEKDSKDSGATRDPGFKKTVEVDNLPNKTYSLKIHAAEESDTGMYYCARWD
Latimeria chalumnae Vs864 trgv AFYH01274207.1 877 GVVSITLKQPQVSVTKSVTKTVKLNCKFQGVSYIHWYRLRPNEAPQRILYYESEAKSEYDQGFRNTKFKSQKKNDECFLYINSLEMSDTAMYYCAGWE
Latimeria chalumnae Vs1918 ighv AFYH01289472.1 931 VQSAVVLTQSGAEVKKPGESLKMSCETSGYDYTSSYIHWIRQPPRKGLEWIGRIDCGSGSSVYQQSFQGRFTISEDVSLSTAYLQINRLTVEDTAMYYCARA
Latimeria chalumnae Vs1919 trav AFYH01289906.1 333 YGEDVQVTQTPTLLHPNAGNSMEIHCEQTLKKQTMFWYQQHKEEGLKFISSVNVLTKGDATQYEPGFTSRFHIRSKGNYAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs812 ighv AFYH01256698.1 6149 VHSAIELTQSDPQVGKPGESLKLQCAVSGFNVNSYWMAWVRQAAGKGLEWLVSYYSSSNNYYSSSIQGRFTASKDSSNFYLQMNSLRIEDTAMYYCA
Latimeria chalumnae Vs591 igkv AFYH01182560.1 1461 SVGDIIMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQEPKLLIYAVNTRHTGVSSRFSGSGYDYDFTFTINNVQAEDTGVYYCQQDDSYP
Latimeria chalumnae Vs399 ighv AFYH01118918.1 1993 FQFTAVLTQAGTEVTKAGESIKLQCDLSGFDVNSYWYQQAPGKGLDWLVSYSSSSNNEHATSIRGRFTASKENSNFYLQMNNLGVEDTAMYYCARLD
Latimeria chalumnae Vs1899 ighv AFYH01278194.1 2885 IQSDVILTESGGDVIKPGESLRLSCKASGFTFSSNWMAWVRQPPGKGLEWVLGIDTDGSRAYYSQSVQGRFTISRDNSNSMLYLQMNNLRAEDTAMYYCAKD
Latimeria chalumnae Vs1116 trav AFYH01079901.1 15722 VSLGDLIQQDQRSRFQRQGDSVTLICSYSTSSIAVYLHWYRKYHNGAPEWILYRGAKSTNRHQHTAPFAEERFESRADSISTRLTIKNIQPSDTALYYCA
Latimeria chalumnae Vs401 ighv AFYH01118919.1 1390 FQFTAVLTQAGTEVAKAGESIKLQCDLSGFDVNSYRMYWYRQAPGKGLDWLVNYWSSSVNHYSPSIRGQFTASKENSNFYLQMSNLEIEDTAIYYCARLD
Latimeria chalumnae Vs1117 trdv AFYH01079901.1 11710 GGFADEVQNSDTHLEKHLGETVNFKCTYSTSSTYVALYWYRGYQNHPLQYISYCDSSNNYHRANSFTRFSSTLDTNAHFTTLSVSKVDLGDNAVYYCGSTT
Latimeria chalumnae Vs1277 trav AFYH01118942.1 6770 GVHCDDEVIQIINSFRASEGRNVTMNCTYKAVSFYNLQWYQQFPSQNPENLFILRSDGVEPKPPVTASLNKNEKLSILTITNVKLTYSATYFCAVE
Latimeria chalumnae Vs1276 trav AFYH01118941.1 3846 KNKENSVNQSEDELVDFEGNAIIIKCNYTATDPFPYLYWYVQYVNEAPQYLLRRDRNSEDNAPRFKDRFSATLDNEKKTVPLLINNAQIFDSAVYYCALR
Latimeria chalumnae Vs1274 trav AFYH01118939.1 15675 QTKGGTDFKQDYMVAVKEKETVKLNCNYNTTEALRTFFWYRGIPGRALQLVLRNDTYGNGYFEPGFSRFNAQVRTSNNAFHLHVESVEMRDAAMYYCALS
Latimeria chalumnae Vs1273 trav AFYH01118938.1 6357 VNCSDEVIQIIQSLRVSEGQNVTMNCTYKLLNFYSLQWYKQSPNQNPENLFVFRLDGEEGKLPFTASFNEKEKLSILTITNPKLIESATYFCAVE
Latimeria chalumnae Vs1114 trav AFYH01079900.1 101083 GLLGDSIQPQELEVHSKEGDTVTLTCTYSTSDTYIWLHWFRKYPNRAPEFILLRGAKGSSASYDADFAKQRYDSSADSSSTKLIIKQLRFSDTALYLCAWSPE
Latimeria chalumnae Vs1271 trav AFYH01118936.1 5224 VGSSSEVHQPPRIESVEGDLVEILCKHDISSYNYLYWYKQISNKAFESIIYGYDSAAEPNGRFRMTFRRNIKETSLIISKTNIEDAVTYFCGVE
Latimeria chalumnae Vs1270 trav AFYH01118936.1 7244 VHCDDEVQQFITSVTENEGQRVSLNCTYKDATINNLQWYKQLPNKKPENLFFLSLDGEQNESSCTASLNRKEKLSTLKIRSMKLSDSATYFCAVE
Latimeria chalumnae Vs1115 trav AFYH01079901.1 23573 EVFGNSVQQDQSVHSPKVEDSVTLTCTYSTTESNIYLNWYRKYPKGALKFILYRGAKSQSGTDHTAEFARGRFDSSADSSTTTLTISNVQLSDATLYYCALEI
Latimeria chalumnae Vs1279 trav AFYH01118944.1 6320 KSKEDSVNQSEVELVVFEGKTTIINCSYSTADTYPYLFWYVQYVNKAPQYILQRDPSTVQNAPRFKERFSATLDKEKKTTLLFIENTGMSDSAVYYCALR
Latimeria chalumnae Vs1278 trav AFYH01118943.1 1717 VIHCNDKVEQVTSLSSSEGRSVTMNCTFTANIRALQWYKQSPSKTPENLFVLVLDGEENTTSYTASLNMKEKLSILKIRNVKLAYSATYFCAVE
Latimeria chalumnae Vs1379 trbv AFYH01120032.1 2697 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNYIYWYRQTLTRGFQLMGMYFRATKELTPEDGFNKTEYEVMEPQSKLIVLRIVSVKPEDTVRYFCAAS
Latimeria chalumnae Vs1376 trbv AFYH01120029.1 1051 VCSGVLISQWPTSVTERVGASVKIQCYQNETDHDYIYWYRQTPTRGFQLMTYYNRLSKQLTPEDGFNKTEYEVTEPQNKLVVLRIVSVKPEDMARYFCAAS
Latimeria chalumnae Vs1377 trbv AFYH01120030.1 731 VCSGVLVSQWPSSITERVGASVKIHCYQNETDHDWIYWYRQTLTQGFQLMGRYTRASKELTPEDGFNKTEYEVTEPQNKLIVLQIVSVKPKDTARYFCAAS
Latimeria chalumnae Vs1374 trbv AFYH01120026.1 1148 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNFIYWYRQMPTRGFQLMGMYYRATKELTPEDGFNKTEYEVTEPQSKLIVLRIVRVKPEDMARYFCAAS
Latimeria chalumnae Vs1375 trbv AFYH01120028.1 480 VCSGVLISQWPTSITERVGASVEIHCYQNETDHDYIYWYRQMLTRGFQLMVWYHRATKKLTPEGGFNKTEHEVMEPQSKLVVLRIVSVKPEDTARYFCAAS
Latimeria chalumnae Vs1372 trbv AFYH01120024.1 3909 YSDALHVEQSPRASYILVSGHIELHCTQSGSQSGMYWYQQRRGEGLKLIGHNTNTGEPTLDKNFPSSRFQILRKETIGKGSLKISNLTAADTAVYFCAFG
Latimeria chalumnae Vs1373 trbv AFYH01120024.1 1231 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSYMYWYRQDRQEGLRLLFYSVAQGNVEKSDDPPSRFSAQRPSTKSFPLNVTKVESEDTAVYLCASSL
Latimeria chalumnae Vs1370 trbv AFYH01120015.1 521 HGAIEQVTQTPTSLHPNAGGSMEIQCKQDSNKQFMYWYQQHKREGLKLISYVSVVSEGDATQYEPGFTSRFHIRSKKNMAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1371 trbv AFYH01120018.1 1247 VADATTIEQNSTTLWVKGSTASLYCRQSSDDMNMFWYRQYRNAGLDLIFHSVTGSNIQQFNNISARFSPSRPNPETLTLTITDLQPEDTAVYFCASS
Latimeria chalumnae Vs1901 ighv AFYH01278532.1 1704 IQSAVILTESGGDVKKPGESLRLSCKASGFDFSGYYMGWVQQPPGKGLEWVSTISGPSGSDKYYLQSVQGRFTISRENSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs1905 ighv AFYH01280065.1 680 VQPVILLTQSAAEVKKPGETIRLSCKPSGYTLTCCSVHWVRKIPGKGLEWIGYQIFKGGSGYHQSFQGIFTISEDVSLTTTYLQINSLRAEDTAMYYCTRGVQG
Latimeria chalumnae Vs1791 ighv AFYH01243040.1 5922 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYAMNWVRQPPGKGLEWVAFIHTSSSSRYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs410 ighv AFYH01118925.1 6794 AQSASILTPSATMEVKNPGESLRLSCKGSGFVFADYAFHWFRQPIGKGLEWVAFISGPEGTTKKYLQSVEGRFTVSRDNANSTFYLQMNSLRFVDAATYYCAAQ
Latimeria chalumnae Vs1808 trav AFYH01245173.1 6902 KGCLAELTQPPKKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLLHEYNEDVEQKQYTLKINKTSQFCTLSIRGVNVGDAALYYCAVS
Latimeria chalumnae Vs1809 trav AFYH01245177.1 12941 LCLGDSITEEHKVLQVTEGQVANFTCRYNMSAAVSETLQWYIQPFNGALKNILQRFKSSSEDLKADGIGDRFSSSLDPTKRLTTLTITDAQMSDAGTYYCALS
Latimeria chalumnae Vs268 ighv AFYH01079853.1 10204 MKSVVLLTESGGDIKKPGESLMLSCKASDVNFNSYHMEWVRQHSGKGLEWIAEVENDGDIYYAPSVQGRFAISRDVSSSMLYLQMNNLKVEDTATYYCARN
Latimeria chalumnae Vs261 ighv AFYH01079847.1 5994 IQSDVILTESGGEVKKPGESVKMSCKASGFTFSSYEMNWIRQAPGKGLEWIAYISGSGGSTVYLQSVQGRFTISRENSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs398 ighv AFYH01118918.1 295 LHFPAVLTQAETEVKKSGESINLKCDLSGFNINEYWMFWYRQTPGKELDWLFSYWDVNSKKQSPSTKGRFTALKENSNFYLQMNSLRIEDTAVYYCARR
Latimeria chalumnae Vs407 ighv AFYH01118923.1 4578 VHSEVVLTQSSQEVKKADESLRLSCKGSGSTLNNYYIHWYRQPAGQGLDWLGVIWYDGSRTEYNQAVKDRFIITRDNSNSMAYLQMNSLRLEDTAVYYCAAE
Latimeria chalumnae Vs262 ighv AFYH01079848.1 3960 VYSDIVLTQFGPEARKLGESLKLKCAISGLDVNSNWMDWIRQTPRKGLEWLARIGSRSDTEYHSQPIQGRFRASKDFSNNVFYLQMNSLTVEDTAMYYCTRH
Latimeria chalumnae Vs263 ighv AFYH01079849.1 9160 IQSQVILTESGGDVKKPGESLRLSCKASGFTFSSYYMHWFRQPPGKGLERIAYISADGSSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCTTD
Latimeria chalumnae Vs260 ighv AFYH01079845.1 5733 IQSQVNLTESGGDFKKPGESLKLSCKASGFTYSSYYMHWIRQPPGKGLEWVSATNTAGSSKWYSQSVQGRFTISRDNSNNMLYLQMNSLRVEDTAMYYCAKD
Latimeria chalumnae Vs1915 trgv AFYH01287628.1 799 GVVSITLKQPQVSVTKSVTRTAKLHCKFQGVSYIHWYRLRPNEAPQRILYYESEAKSEYDQGFRNTRFIFQIKNDECFLYIYSLEMSDTAIYYCAGWE
Latimeria chalumnae Vs266 ighv AFYH01079852.1 5192 VQSAVVLTQSGAEAKKPGESLRLSCEASGFTFGDYWMSWIRQAPGKGLEWLARISYWAGSTINYAQPVQGRFIISRDNSNNILYLQMNSLRVEDTAIYYCARD
Latimeria chalumnae Vs1797 trav AFYH01243273.1 18869 KGCLAKLTQPPESTVREGETAEIQCDGVASNDNIFWYKQHPHKRPEFLISGYSDMEKRDQYTLKINKTKQFCSLSISGVNAGDASLYYCAVS
Latimeria chalumnae Vs1806 trav AFYH01245173.1 18323 KGCLAELTQPPEKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLIQGYNTDVEQKQYTLKINKTSQFCTLSIRGVNVGDTALYYCAVS
Latimeria chalumnae Vs1807 trdv AFYH01245173.1 13064 LCLGDSITEEHTDLQVTGGQAANVTCRYNISAGYDETLQWYIQPFNGAPKYILQRFKSSSEDLKADGIGAQFSSSLDTAKRLTTLTITDAQMADSATYYCAL
Latimeria chalumnae Vs1134 trav AFYH01079912.1 6049 RGLGNELKQSVEPQEKEYGSSVKLECTYKTSYTYYFLFWYKLNTDKSLQFISRYNSYDSTSYTDASYQDRFTSTWDTSSSSVTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae Vs396 trav AFYH01118913.1 12038 NNITQLPGSLTAKEGEETTLNCSNSSPLATGDSLQWYYQPFNGAPSYFIQSYKTLSGSEEKKAEGVEDRFSVSLDASNKVSTLTIREVQMADSGLYHCALK
Latimeria chalumnae Vs1137 trav AFYH01079916.1 12138 RGLGNKVQQSVDPLEKENGSSVKLECTYSTSYTYYYLQWYKLNPDKTLQFISSYYSSSSSSYTDALFQNRFTQTLDKSSSRTTLSIRNLELRDTAVYYCALSD
Latimeria chalumnae Vs1130 trav AFYH01079909.1 2354 SVYGDSVEQPDVELSVKEGESIALKCTFPSGSGYVFWYRKYPNQALQYILQQGVGGNRFTNKAEFARKRFSIHPAGNTGGMIVSDLSFSDSALYYCVFSDS
Latimeria chalumnae Vs1885 trgv AFYH01271169.1 686 GVVSMTLKQPQVSVTKSVTKTVKLHCKFQGVSYIHWYRQRPNEALQRILYYESEAKSEYDQGFSNTRFKSKKKDDECFLYIYSLEISDTAIYYCAGWD
Latimeria chalumnae Vs1886 trgv AFYH01271172.1 837 GVVSITLEQTQLSVTKIVNRNVRLQCKFQGVSKIHWYRLRPNEALQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYIYSLEMNDTDTYYCAGWD
Latimeria chalumnae Vs1133 trav AFYH01079910.1 5097 RGHGNEVQQSARSMEKVYGSSVKLECTYSTTYGSYLLYWYKLNLDKSLQYISYRSSWGTDDTHALFRNRFTSALDTSSSLTTLSIKNLELKDTAVYYCALSD
Latimeria chalumnae Vs1604 ighv AFYH01191460.1 398 VHSDIVLTQSGPEVRKSGESLKLKCAVSGFDINSYVLAWIRQDPQKGLEWLVSYKSSSDNVYSCLIQGRFISSKDSSNFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs265 ighv AFYH01079851.1 12558 IQSQVILTESGGDAKKSGESLKLSCKASGSTFSSYYMHWIRQPPGKGLEWLAEIRPDASKTWHSQSVEGRFSISRDNANSMLYLQMNSLRVEDTAMYYCARN
Latimeria chalumnae Vs1138 trav AFYH01079916.1 5855 NIRASDVLFQQKELIRTEEGLNVTVECNYTESNPTLFWYRQMQHGKLEYILGRNEYNYKDNAEGFDSFSANVNKNDGTLKMFHLVITGVQVTDSAVYYCALS
Latimeria chalumnae Vs394 trav AFYH01118912.1 1370 NNVTQLPGSLTAKEGEETTLNCSNSSPLTTGYSLQWYYQSFNGAPNYFIQSYKSFSGSEEKKAEGVEDHFSVSLDASNKVSTLTIREVQMADSGLYHCALS
Latimeria chalumnae Vs1880 ighv AFYH01268357.1 587 IQSEVILKESGGDIKKPGESLRLSCKGSGFTFSGYALSWVRQPPGKGLEWVAFIHTASSPIYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARR
Latimeria chalumnae Vs395 trav AFYH01118913.1 5476 SVSHISRSVAEEESQAVTITCSYNASRSDVYLYWYRQFKQGSLTYLLQKYTFGTGTVEGSKAEGIDNRFEGFLDPITKVTNLTISDLKLSDTAVYYCALR
Latimeria chalumnae Vs1369 trbv AFYH01120015.1 1875 HGAIEQVTQTPTSLHLNTGNSTLIHCKQDSTKPNMYWYQQRKREGLKLISYVSVVSKGDATQYEPGFTSRFHIRSQGNMEGSLKISSLTAEDSAVYFCAAG
Latimeria chalumnae Vs1368 trbv AFYH01120014.1 1433 DVQAVEVTQTPASLYRRVRESSKMQCQHNDSTKFYMLWYQQNPGAGPNLIGYASGTSEATNENEFPKEKFKIAKETATKGSLTIKELTAADSAVYFCAAS
Latimeria chalumnae Vs1135 trav AFYH01079912.1 3178 RGFGNEVKQSVHSQKKEDGSSVILECTYKTSYTSYYFFWYKLNPDKALQFISRYHNYGSASNTDTSFQHRFTTTLDTSGSRTTLSIKNLELRDTAVYYCALSE
Latimeria chalumnae Vs1365 ighv AFYH01120012.1 4990 RGEIVEVTQTPTSLHLNVGNSTEIHCKQDSNKDYMYWYQQRKREALKYIGYIDVLVASGDAQYEPEFSSRFEITRGESKAAYLKISNLTAEDSAVYFCAVR
Latimeria chalumnae Vs1364 trbv AFYH01120012.1 6444 HGEIVQVTQTPTSLYLNASDSTLIQCKQDSNKLNMFWYQQHKREGLKLISYVSVASEGNATKYEPGFTSRFHIRSQGNYAGSLKISNLIAEDSAVYFCAVG
Latimeria chalumnae Vs1367 trbv AFYH01120013.1 831 HGAIEQVTQTPTSLYPNAGDSTEIHCKQDSNKDTMYWYRQRKREGLKFISYVSVVSEGDATKYEPGFSSRFHIRSKGNFAGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae Vs1366 ighv AFYH01120012.1 1288 RGEIVEVTQTPASLHLNVGNSMEIHCKQDSNKEYMYWYQQRKREALKYIGRIDVSVASGDAQYEPEYSSRFEITRGESKAAYLKISNLTAEDSAVYFCAAS
Latimeria chalumnae Vs1361 trbv AFYH01120012.1 17878 DVQAVKVTQTPASLYKRVGDSSEMQCQHNDSSKDTMLWYQQNPGTGLKLIGYSVVTNKAITESDFPEEKFQIVKETVQKGSLTVDNLQAADSAVYFCAVS
Latimeria chalumnae Vs1360 trbv AFYH01120012.1 19052 HGEIVQVTQTPTSLYLNVGGSTEIHCEQDSSKQNMYWYQQCKREALKSIGYIDVLATSGDARNEPGFTSRFEITRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1363 trbv AFYH01120012.1 9176 DVQAVEVTQTPTSLYKRVGDSSEMQCQHGDSNKNNMLWYQQNPGTGPKLIRYAIATSKATNEKDFPEHKFEIVKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae Vs1362 trav AFYH01120012.1 10542 RGEVVQVTQTPTSSHLNTGESTEIQCEQKVNKNTMYWYQQRKREGLKFISYVNVLTKGNATQYEPGFTSRFHIWSRKNKAGSLKISNLTAEDSAMYFCAVG
Latimeria chalumnae Vs1606 ighv AFYH01191464.1 830 VHSDIVLTRSGPEVRKPGESLKLECAVRGFDVNSYWMAWICQAPGKGLEWLASIGGRSSTKYHSQSIQGRFHASKDFSNHIFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs1790 ighv AFYH01243034.1 575 VNKPGESLKLSCKASGFTFSSYTMCWIRQPPGKALEWIAYISGSGGSTGYLQSVQGRFTISRENSNNMLHLQMNSLRVEDTAMYYCAKDPE
Latimeria chalumnae Vs1288 trav AFYH01118945.1 1459 KIQGDTVFQQDSILTVKEKEDVKLHCNFTTADLSPYLFWYQQYPGDSLKYILRKNKNGIDDKATGFNRFDAQLERDNTIILKIESVEVKDAAVYYCALS
Latimeria chalumnae Vs874 trbv AFYH01282963.1 796 RGQDVQVTQTPTSLHLNAGDSTLMHCKQDSNKNTMYWYQQRKREGLKFISSVVVLTEGDATKYEPGFTSRFHIRSQGNNAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1602 ighv AFYH01191456.1 7241 IQSAVNLIESGGDVKKPGESLKLSCKGSGFTFRSSYLHWLRQPPGKGPEWVAYISTDSSPIHYAQSVQGRFTISRDDSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs404 ighv AFYH01118922.1 376 VHFNVVLSQSSEEVKKAEESLKLKCILSGFDVNSYDMYWYRKAPGKGLEWLVRYYSSSSNHYSPSIQGRFTASKDSSNFYLQMNSLRVEDMAMYYCARRE
Latimeria chalumnae Vs1600 ighv AFYH01191455.1 19481 IQATVNLTESGGDVKKPGESLKLSCKASGFSFSSHWMHWVRQPPGKGLEWLAYISGPSGSTKRYSQSVNGRFTISRENSKKMLHLQMDSLRVEDTAMYYCARE
Latimeria chalumnae Vs1294 trav AFYH01118952.1 1486 GEFSSQVQQLPNVEYVEGHQVEIFCNHSISSYENMYWYQQLPNKPAEVIVYGYSSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae Vs1282 trav AFYH01118945.1 39118 GEPSSEVQQLPDMEFVEGNLVEIHCNHSISSYNNMYWYQQLPNKPPEVILYGYDSADPKGRFSMSFNRNKRETSLIINGTEITDAATYYCAVD
Latimeria chalumnae Vs1283 trav AFYH01118945.1 28471 GDSSSQVDQLPAIESVEGYPVKIPCNHSISNYNNMIWYQHLPNKPPKVIVYGYNSAAPNGRFNMSFNRDNPKMFLIISGTEISDAATYYCAVS
Latimeria chalumnae Vs677 ighv AFYH01213578.1 13933 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYHMHWVRQPPGKGLEWVAFIHTGSSSRYYTPSVQGRFTISREDSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs1161 trav AFYH01079934.1 5676 FCKGDKVTEWDLEKTAIEGDAVTLRCNYTATSTSSPALMWYKQHLSQPLEYLLQVATFNTKANSTGEKFLTSELKSKENSVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae Vs1287 trav AFYH01118945.1 6358 VHCSVKVDQSASFTVNEGSFASLKCNYSTSNFRGLQWYKQNQNQGPEYLFALYQDGKEPKEGYTASLNTNQNLGILEITSMKLIDSVTYFCTVV
Latimeria chalumnae Vs1284 trav AFYH01118945.1 27173 KIKGNVVHQEDSLVYVKEKASIKLACNYTTSNASPYLYWYQQYPGDSLKFILHKNKHSSLDSAPGFSRFDAELGKDDTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae Vs1131 trav AFYH01079910.1 21558 KVRSKDVLFQDKELIGVEGQNVTVECNYTESIQYLFWYRQMQHGKLEYILGRNEYSYKDNAEGFGSFSANVNKNDGTLKMFHLVITGVQVTDSAVYYCALS
Latimeria chalumnae Vs405 ighv AFYH01118922.1 4153 FHFYAVLTQAGTEVKKAGEPIKLKCDLSGFNVNSYWMYWYRQAPGKGLDWLVYYYTSPSYSSSIQGRFTASKESSNFYLQTNSLRIEDTAMYYCARR
Latimeria chalumnae Vs676 ighv AFYH01213578.1 3114 VHSDIILTESGGDVKKPGESIKLSCKISGFTGHYMEWVRQPPGKGLEWLAQISASSSTVYSKSLQGRFTISRDDSNNMVYLQMSSLREEDTALYYCARL
Latimeria chalumnae Vs809 ighv AFYH01256692.1 900 IQSQIILTESGGDVKKLGESLKLSCKASGFTFSSYGMHWVRQPTGKGLEWVGVIWYDASRTEYSQNVKGRFTISRDNSNSFLYLQMNSLRVEDTAMYYCTRD
Latimeria chalumnae Vs1281 trav AFYH01118944.1 1001 QTRGDTEFKQDAVVSVKEKEIAKLHCDYNTSEVNLYFFWYRRIPGYALQYILRNSSYGAADTASGFSGFNAKVENKAFHLNINSVEMRDAAVYYCTLS
Latimeria chalumnae Vs264 ighv AFYH01079850.1 1455 IQSEVTLIESGGDVKKPGESLTLSCEASGFSLSSYYMSWVRQPPGKGLEWLSAADTAGSSKWYSQSVQGRFTITKDNSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae Vs1794 ighv AFYH01243050.1 663 IHSQVNLTESGGDVKKPGETLRLSCKASGFTFSSYYMSWIRQPPGKGLEWIASISSGGGSTGYLQSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs870 trav AFYH01279323.1 1031 KSKEDSMNQSVAKLPVVEGENTVINCSYSTTVTFSYLFWYVQYANEAPQYLLERDPSTAANASRFQERFSATLDNEKKTIPLFIENTGVSDSAVYYCALR
Latimeria chalumnae Vs1795 ighv AFYH01243053.1 5810 LTQYGQEVRNLGESMKLKCTISGFKPDSYWMAWICQAAGKELEWLIYYLRAADANHYFCSNQGRFTASKDSSSFYLQMNSLKVEDMAMYYCARA
Latimeria chalumnae Vs1123 trav AFYH01079903.1 5596 GLLGDSIQSQELEVPSKEGDTVTLTCTYSTSDTYIRLHWFRKYPNKAPEFILLRGAKGSSASYDADFVKQRFDSNTDSSSTRLTVKNLELRDTALYYCALHL
Latimeria chalumnae Vs1122 trav AFYH01079903.1 7026 SLLGDSIQPQESTVPSLEGDTATLTCTYSTSSTDIWLHWYRKYPNGAPKFILYRGARSRSNEYYTAEFAKDRFESTADSNTTTLTINNVELSDTAFYYCALD
Latimeria chalumnae Vs1121 trav AFYH01079903.1 8859 EVFGDSVQQDQPVHSEKEGNSVTLTCTYSTSFDWIYLNWYRKYPNKAPEFILYRGAKSRSGTDYTAEFARGKFDSSADSSTTKLAINNVQLNDAALYYCALWK
Latimeria chalumnae Vs1120 trav AFYH01079903.1 11092 AVFGDSVQQDQPVHSEKEGDSVNLTCTYSTSSSYINLHWYRKHPNGAPEYILQRGAKSNSGDDHTAEFAKNKFDSRTDSSTTTLTIKTVQLSDTALYYCALWI
Latimeria chalumnae Vs1127 trav AFYH01079906.1 5323 GLLGDSIQSQELAVPSKEGDTVTLVCTHSTSSSNIWLHWYRKFPNEAPEFILSRGAKSASGDDYTADFAKDKFDSSADSSTTKLIIKNVQQSDAPLYYCALQM
Latimeria chalumnae Vs1126 trav AFYH01079906.1 9484 EVFGDSVQQDQSAHSQKEGDSVTLTCTYSTTENYVYLYWYRKNRNGALEYILYRGAKSRSGYDHTAEFAKDKFDSRADSSTTTLTIKTVQLSDAALYYCALRID
Latimeria chalumnae Vs1125 trav AFYH01079905.1 4255 GLLGDSIQPQELTVPSEEGETVTLTCTYSTSTSNIFLHWYRKYPKTAPEFIHYRGAKGYTGTHTADFAKQRFDSKTDSSSTRLTVKNLELRDTALYYCA
Latimeria chalumnae Vs1124 trav AFYH01079904.1 2818 GLLGDSIQSQELAVPSKEGDTVTLVCTHSTSSSNIWLHWYCKFLNEAPQFIFFRGVESASGGVYTEQFVKGKFDSSADSSTIRLIIKNVQLTDAALYYCALQM
Latimeria chalumnae Vs1129 trav AFYH01079906.1 504 AVFGDSVQQDQPEHTEKEGFSVSLTCTYSTSSSYIYLHWYHSYPNRASEYILQRGAKSRSGNVHTAEFAKGKFDSRVDSSTTTLTINNVQLSDAALYYCALQV
Latimeria chalumnae Vs1128 trav AFYH01079906.1 1228 RLLGDTIQPQELIVSSEEGEIATLTCTFSTSETWINLHWFRKYPNRAPEFILLRGAKGSSDRYNANFVKQKFDSSTDSSSTRLAVKNLELRDTALYYCALHL
Latimeria chalumnae Vs1893 trbv AFYH01274082.1 903 GGCQSLHQSPSSICQSEGGEAKLKCVLKGSSNPNLYWYRQLPSREIQLIAYSVTKGSIAENNLPHFTVARPEDTEFTLETQHLQLNDTAVYYCAWS
Latimeria chalumnae Vs1892 trbv AFYH01274081.1 693 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSYMYWYRQDRQKGPWLLFYSLAQGNVEKSDDSPTRFSAQRPSTKSFPLNMTKVESGDTAVYLCASRL
Latimeria chalumnae Vs598 igkv AFYH01182577.1 3763 SSSEIVMAQSPLTSSVIPGETITIKCKASSGITDDIAWYQQKSGQKPKLLIYEANTRASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYCQQYNSWP
Latimeria chalumnae Vs1358 trbv AFYH01120011.1 981 DVHTLEVTQTPTSLCKRVGDLSEMQCQHGDSNKDTMLWYQQNPGTGPKLIGYASGTSEAINEKDFPEDKFQIVKETDVKGSMIIQNLTAADSAVYFCAAS
Latimeria chalumnae Vs1359 trbv AFYH01120012.1 21351 DVQAVEVTQTPASLYKRVGELSKMQCQHYDSSKINMLWYQQNSGAGPKLIGYASGTSEATNENEFPKEKFEIAKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae Vs1597 ighv AFYH01191453.1 7556 VHSDIVLTQSGPEVRKPGESLKLECAVRGFDVNSHWMDWIHQAPGKGLEWLASIGSRSDTEDHAQSIQGRFQASKDFSNHIFYLQMNSLKVEDTAMYYCAGE
Latimeria chalumnae Vs1350 trbv AFYH01120006.1 1272 NCRTLLADQSPPSVYNSTGGSVEVRCEPTDKSYLNMFWYQQQAEGPKLIGYTLSSQSATYEDKDSFNSPKFEIRKRDSDLKGSMKISDLKIEDSGVYFCAVN
Latimeria chalumnae Vs1351 trbv AFYH01120007.1 378 RGEILQVTQTPASLHPKAGDSTEIHCKQKLNKDYIYWYQQRKREALKSIGYINVLATSGDARNEPGFTSRFEIMRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1352 trav AFYH01120008.1 333 RGEVVQVTQTPTSLHPKAGDSTEIHCEQKLNKDNMYWYQQRKQEGLKFISSVLLASIGEATQYEPGFTSRFHIRSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1353 trbv AFYH01120009.1 1800 DVQAVELTQTPASLYKRVRDASKMQCQHNDNTKNTMLWYQQKSGTGPKLIGHAIGTSEATNEKDFSKDKFQIVKETDVKGSLTITELTAADSAVYFCAVS
Latimeria chalumnae Vs1354 trav AFYH01120010.1 8116 YGEDVQVTQTPTLLHPNAGNSMEIHCEQTLKKQTMFWYQQHKEEGLKFISSVNVLTKGDATQYEPGFTSRFHIRSKGNYAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1355 trbv AFYH01120010.1 6882 NVHTLEVTQTPTSLHKRVGGSSEMQCQHGDSNKNNMLWYQQNPRTGPKLIGYAIATSKATNEKDFPEDKFQIVKETAMKGSLTIKELTAADSAVYFCAAS
Latimeria chalumnae Vs1356 trbv AFYH01120010.1 436 RGEDVLVTQTPTSLYLNASDSMEIHCKQDSSKTKMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGKYEGSLKISKLTAEDSAVYFCAVG
Latimeria chalumnae Vs1357 igkv AFYH01120011.1 2819 HGEDVQVTQTPTSLYPNAGDSKEIHCEQKLNKNYMYWYQQRKREGLKLISYVNVVSVGDATKYEPGFTSRFHIRSKGNDAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1298 trav AFYH01118956.1 1896 KTNGDQTIQKDSMVQVEEAQNVTLRCNYITTDSDPYLFWYFQRPGHSPKYILQRSKYSNNKESGFSRFDAQLGSEKTFHLNIENVEIEDGAVYYCALS
Latimeria chalumnae Vs1891 ighv AFYH01273974.1 2243 VQSAVVLTQSAEEIKKPGDSFRVSCKTSGFSLTSYGVGWIRQPIGKGLEWLAIIFWNANTRYSSSIQGRFTISRDTSSSTVYLQMNNLKVEDTAMYYCARE
Latimeria chalumnae Vs1291 trav AFYH01118948.1 1521 GEPTSEVYQLPYIVSMEGLQVKIHCNHSISNYNNMFWYQQPNRNKPPEVIIYGYDSADPKGRFSMSFNREKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae Vs1290 trav AFYH01118948.1 5917 FQGQEEVSQNEIPLTARDGESVQINCTYKVKEYSLQWYKQYPGKAPEFILLRSTSGTDTVGRYKIFLDTSEKYVFLQIHNTTVEDTAVYFCAL
Latimeria chalumnae Vs1292 trav AFYH01118949.1 2428 KIKGNVVHQEDSLVYVKEKARVKLACNYTTSDASPYLYWYQQYPGDSFRYILGKNKFSTLDSAPGFSRFDAELGKDNTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae Vs415 trbv AFYH01119973.1 9131 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSNMYWYRQDRQKGPRLLFYSLAQGNVEKSNDPPSRFSAQRPSTKSFPLNVTKVESEDTAVYLCASSL
Latimeria chalumnae Vs414 trbv AFYH01119973.1 6833 ETESTIIRQNSSVVELQGTSIHLHCSQTGTDVNMYWYRQDRNPGLQLLFNSIEGTEKAEPSENVPDRFSALRRSEKTLILIITDLQPQDTAVYFCSSS
Latimeria chalumnae Vs417 trbv AFYH01119973.1 13978 GVSQSVRQSPSYIVQSEGESARLECTFQGNTNPYMYWYRRAATGGIQLVSLSVDATATTENMLQHFKAKRSSSEDFLLTTERLQLDDTAVYYCAWS
Latimeria chalumnae Vs416 ighv AFYH01119973.1 12267 GLCQTVHQSPAIIVVSGNPVSLHCYQAGSSSSSYMYWYRQYPKKGLELILTSVYLSGDTVSPEFEGRFSSKRPDQRNCSLEITTLKSEDSAIYFCASS
Latimeria chalumnae Vs1796 ighv AFYH01243054.1 898 VHSAIELTQSNPQVRKPGESLKLQCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHTSSNNYYSSSIQGRFTASKDSSSFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs1172 trav AFYH01079947.1 13242 SVTEEHKVLQVTEGKETTFTCTYNKSTASSETLQWYIQPFNGAPKYILQQFNSGSKSLESKAEGIGDRFSSSLDPTKRLTTLTITDAQMADSGTYYCALT
Latimeria chalumnae Vs1299 trav AFYH01118959.1 23287 SAGSQKDSVSESSSAMTVLEGDKRTLTCNYETIDTSPNLFWYRQYPGRSLEYLLQVNAFGSAGGENTDERFNTSLEKEQKRVFLNIPSIQITDSAVYFCALR
Latimeria chalumnae Vs1347 trbv AFYH01120004.1 4793 ECLNLLANQSPLSVYNSTGGSVEVDCKPTDKSYAYMFWYRKQAEGPKLIGSTASTQDPVYEDGFNSPKFEIRKRDSDLKGSMKISELKVEDSGVYFCAVS
Latimeria chalumnae Vs1346 trbv AFYH01120002.1 970 GHCQTVLVTQSPSSVHKNAGKEVEIDCQHNKNDYYYMYWYQQRRAEGIKLIGHTYETQEAKHEDGFNSSKFQIPQRDQVEKGSMKIMDLGAGDSAVYFCAVSK
Latimeria chalumnae Vs1345 trbv AFYH01120002.1 4340 RGEIVQVTQIPASLHPNASDSTKIHCAQDSNKQYMYWYQQRKWEGLKSIGRIYMVGTGGDPEYEPGFTSRFEIMRTDSKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1344 trbv AFYH01120001.1 725 GHCQTVLVTQSPSSVHKNTGNEVEIYCQHNKSDYVYMYWYQQRRAEGIKLIGNTYMTNEAKHEDGFNSSKFQISKRDQVEKGSMKIVDLGAGDSAVYFCAVSE
Latimeria chalumnae Vs1343 trbv AFYH01120001.1 2221 HGEVVQVTQTPTSLYPNASDSTEIYCKQDSSKLNMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGSFVGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae Vs1342 trbv AFYH01120001.1 6788 RGEVVQVTQTPTSLHLNTGKSTEIHCEQKLNKNYMYWYQQHKREGLKLISYVSVVSEGDATQYEPGFTSRFHIRSQENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1341 trbv AFYH01120001.1 8116 RGEIVLVTQTPTSLHPNAGNSMEIHCEQDSSKQYMYWYQQRKREGLKFIGRIYTATKSEDLHHEPEFIMRFEITRIDSKVGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1340 trbv AFYH01119999.1 1215 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDSSYPTMLWYQERRGEGPKLIGSGYSTQEPTYENKEGFEPPKFEIKKETAVKGSLRIQSLTAADSAVYFCAVS
Latimeria chalumnae Vs70 iglv AFYH01023916.1 1082 SSSQLVLTQPSSESVSPGGTVKLSCTLTGVTFSNVDVRWLQQKSGSAPRYLLWYRSASEKHQGSGVPARFSGSKDGSKDIFYLTISSVEAEDEADYYCAEWD
Latimeria chalumnae Vs1293 trav AFYH01118952.1 2308 GEPTSEVHQLPYIDTVEGLQVKIHCNHSIISYSSMFWYQQLPYKHPEVIISGYDSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae Vs1349 trbv AFYH01120005.1 1321 DCLTLLANQSPPSVYNSMGGSVEVRCEPTDKSYRNMFWYRQQAEGPKLIGYTLSSQSATYEDKDGFKSPKFEIRKRDSNLKGSMKISDLTIEDSGVYFCAVN
Latimeria chalumnae Vs1348 trbv AFYH01120004.1 1489 DCQTLLANQSPPSVYNFTGGSVEVRCKPTDKSYAYMFWYRKQAEGPKLIGSTASSQDPVYEDGFNSPKFEIRKRDPDLKGSMKISELKVEDSGVYFCAVS
Latimeria chalumnae Vs859 trbv AFYH01273693.1 834 VHCQTVLVIQFPSSVHKNAGNKVETYCQHNKNDYYYMYWYQQRRAEGVKLIGNTYMTNEAKHEDGFNSSKFQIPQRDQVEKGSMKIVDLGAGDMAVYFCAVSE
Latimeria chalumnae Vs858 trbv AFYH01273692.1 681 HGEIVQVTQRPTSLHLNANNSTEIHCEQDSNKNYMYWYQHRKQEGLKLISYVILTTIGEATQYEPGFTSRFHIWSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae Vs1154 trav AFYH01079930.1 7029 FCKGDNVTEWDREKTTTEGNTVTMGCNYTLTSISTTNLVVMWYRQHLSRQLEYLLQVATYNTEANSAGEKFLTSELKTEEKLVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae Vs1155 trav AFYH01079931.1 15007 FCKGDNVTEWEREKTTTEGDTVTLGCNYTLTSISTNNLALMWYKQHVNQPLEYLLQVTKYRLKENSTGEKFTSELKTEENSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae Vs1152 trav AFYH01079927.1 3492 TEGLTKFSQPAHKTAKEGESVQILCEDINTSYLSLWYKQTLQHRQKGLQLMISGYDNDKNEKFNLTIEKKNQSSTLTVKEVQLGDAALYYCAQS
Latimeria chalumnae Vs1153 trav AFYH01079929.1 1312 REGACKPEQPPSMEAAEGKEVNISCTYALPTSDYIHWYKQTKESLKHLIQAHKGTPNEGRYILTTAEDRKNNTLTIRNVGLQDTAVYYCVAAAQ
Latimeria chalumnae Vs1151 trav AFYH01079923.1 4280 QECQGKLSQPAYKTAEEGESVQILCKEVDTRYNTLWYKQAPQHSQKGLQLIIYGISNDENKKFTLTVEKENKSITLTIKEAHLGDAGLYYCAES
Latimeria chalumnae Vs1295 trav AFYH01118954.1 22854 SYASGQENSAFQPTTVVTKSEGDNVTLSCNYTVTTSTPYVFWYHQQPRKPLRYLLHNDFLNKVYLDERHDNRYSGSLEKSHNNASFSISSTKISDAGVYFCAVS
Latimeria chalumnae Vs1158 trav AFYH01079932.1 4579 REGLAKLFQHPYKTAKEGESAQILCEDIDTNYLIQWYKQTPQHSQKGLQLMISGYSDENEKFNLTTEKKNQSSTLTVKEVQLGDAALYYCAQD
Latimeria chalumnae Vs1159 trav AFYH01079933.1 4477 YCKGDKVTEWDREKPAIEGETVTLGCNYTLTKISTNDVVLMWYKQHLTRPLEYLLQVAAHNIKTSSTGEKLLTSELKSKDNSVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae Vs408 ighv AFYH01118923.1 6417 VHFSVVLSQSSEEVKKAEESLRLKCTLSGFDANSYRMYWYRQAPGKGLDWLVNYYSSPVYSPSIQGRFIASKESSNFYLQMNSLRIEDTAVYYCARRD
Latimeria chalumnae Vs409 ighv AFYH01118924.1 3864 VQSEVVLTQSGEEVRKAEESLTVSCKGSGFTFTDYHIYWYRQPPGQELNWLGVLWASGSINYNQAMKGRFTVSRENSNSMAYLQMNSLQLQDTAVYYCAAV
Latimeria chalumnae Vs1297 trav AFYH01118954.1 9493 GENKEQVFQRPKMKSLEGFTVEIACRHSISSHQGLYWYKQLPGKGPELVIFGYNMADPVGRFNMSFSDNGKNTSLLISQVQIKDAVTYYCAVM
Latimeria chalumnae Vs1811 trav AFYH01245180.1 11259 KGCLAKLNQPPDTAVMEGETAEIQCDGVATVDYVYWYKQYLHQSPEHIINGFEKTEEKGRFILQINKTSQFCTLSISGVNVGDAALYYCAVS
Latimeria chalumnae Vs1810 trav AFYH01245177.1 6781 KCCLAKLNQPPDTVVMEGETAEIQCDGVARADTIFWYQQYLHRSPEHIINGYENPEEKGRFILQINKTSQFCTLSIRGVNVGDAALYYCAVS
Latimeria chalumnae Vs1422 trgv AFYH01131030.1 2829 GVTAVTLEQPKLSITKASGKTAQIICKMSGVPLSAAIHWYYGKPGEELKRIMFHSTSITHDLGFRKEKFTSDKTDGSCTFIIHNIAEEDSATYYCAWWD
Latimeria chalumnae Vs397 trav AFYH01118913.1 13960 SVSHMSKSVVEEESQAVTITCSYNTSYSNLYLQWYRQFKQEAPIYLLQKYFLGIGTVQGDKAEGIDDRFEGFLDPKTKVTNLTIKDLKLSDTAMYYCALS
Latimeria chalumnae Vs1421 trgv AFYH01131029.1 1738 GVVSITLEQPELSVTKSVTRTVKLSCRFQGVSIIHWYILRPNEALQRILYYESAAKNGYDQGFNNMSFRAEKKNDECFLVIYNLEMSDTATYYCARWD
Latimeria chalumnae Vs392 trav AFYH01118909.1 519 NTVTQWPGSVNAKEGDETILNCSNSSPIATGDSLQWYYLSFNRVPRYFIQCYKTSLGSKQLEADGVEDRFSVSLGASNKISTLFIREMQMADSGLYYCTLK
Latimeria chalumnae Vs393 trav AFYH01118910.1 1547 SVTQTSKSVDAEETQAVTITCSYNTSATTVYLYWYRQNKQGALTYLLQKSVFGTGTVQGDKAEGTDDRFEGFLDPKTKVTNLTINDLKLSDSAVYYCALS
Latimeria chalumnae Vs259 ighv AFYH01079844.1 1693 VQSAVVLTQSGAEVKKPGESLRLSCEASGFTFGDYWMSWIRQAPGKGLEWLARISYWAGSTINYAQPVQGRFTISRDNSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae Vs391 trav AFYH01118908.1 4518 SVNHISISVTAEESRAVTITCSYNASYSNVYLFWYRQFKQEAPNYLLHKYTFGTDTVQEDKAEGIDDRFEGFLDPKTKVTSLTIEDLKLSDSAVYYCALS
Latimeria chalumnae Vs1272 trav AFYH01118938.1 8386 VHCNDEIDQIITSLNVTEGQNVTMNCTYKSSNIYNLQWYKQSWSKKPENLFILTSDGEVPNPPFTASLNKKEKLSVLRITNVKFVESTTYFCAVQ
Latimeria chalumnae Vs868 ighv AFYH01275529.1 203 AQSDIVLTQSAAEVKKPGDSLRLSCKVSGLSLTSSGTVVVWIRQPIGKGLEWLARIDWDLDTFYSSSVQGRFTISRDTSSNTVYLQMNSLTVEDTAMYYCARA
Latimeria chalumnae Vs1332 trbv AFYH01119992.1 1652 LCDGAVKVTQSPKSLAQTSGKLAEITCKHNESSYYNMYWYRQYSGQGLTLILTSVFQGTTTFEDGFKEGFQVERPTLLNSTLKILQLKAEDTASYLCAASL
Latimeria chalumnae Vs1333 trav AFYH01119993.1 1080 LCGGKILVTQLPKTLIGTVGNSVEMNCTHNDTSVSATMYWYRQYGGQGLELITYTLAGGSNQTEPEFKEKVEVKRLNSKQTSLKIKELKAADTASYLCAVRE
Latimeria chalumnae Vs1330 trbv AFYH01119989.1 1722 LCGGAIIVTQQPNSLTGGTGNPVEMNCSHDFTGADPYNIFWYQQKRGQGLTLIVYTYGAQGKPSFEQDFEKEFEVTRPDNRNSALTIKGLKAADTASYLCAASK
Latimeria chalumnae Vs1331 trav AFYH01119991.1 1255 LCGGTTLVTQLPKTLIGTVRNSVEMNCTHNDTVSTARMYWYRQYGGQGLELITNTVSVGSNQTEPEFKEKVEVKRLNTKQTFLKIKELKASDTASYLCAVRE
Latimeria chalumnae Vs1336 trbv AFYH01119995.1 873 LCDGAVKVTQSPKSLAQTSGKLAEITCNHSESTYYNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLQAADTASYLCAAS
Latimeria chalumnae Vs1337 trbv AFYH01119996.1 6314 HGQTVSVQQSPPSVHNSTGGSVELHCQHEDASYLNMLWYQKRAGEGPKLIGSGYSTQEPTYENKEGFEPPKFEIKKKKNNLKGSLTVTELTAAESAMYFCAVS
Latimeria chalumnae Vs1334 trbv AFYH01119994.1 2122 LCDGAVKVTQSPKSLAQTSGKLAEITCNHSESTYYNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLQAADTASYLCAAS
Latimeria chalumnae Vs1335 trbv AFYH01119994.1 1046 VSGGVIHVTQLPNSLIGTPRDTLEINCTHMDTSNSVHSIFWYQQKRGQGLTLIVYTDSADGEPKFELDFKEKFEVKRPDDLNSTLKIKELKASDTASYLCAVNE
Latimeria chalumnae Vs1338 trbv AFYH01119996.1 2693 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDASYNTMVWYQKRRGEGPRFIGYAYLSQPPEYEKKEGLEPPKFEIKKDKNNLNGSLTITELTAADSAVYFCAVS
Latimeria chalumnae Vs1339 trbv AFYH01119997.1 1563 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDTSYLNMLWYQKRRGEGPKLIGSGYSTQEPKYEKKEGFEPPKFEIIKETDVKGSLTIQKLTAADSAVYFCAAS
Latimeria chalumnae Vs1144 trdv AFYH01079919.1 11921 LGVDSQEKQLLHTEAIEGTNVTFSCTYKETASRSYWYRQVPKGAPQHLIDGYDGKTSEGQGHYTLEIEEGRKSSKLTVSAVELNDNGVYFCAWQ
Latimeria chalumnae Vs1147 trav AFYH01079920.1 1868 IHVYGQESKLSHLEAVEGEDIIIPCNHSTAASFTLWYKQLPNKAPQHLISRYSGNLTEGRFTLRITEERRSSKLTVTAVELNDTGVYFCAWQ
Latimeria chalumnae Vs1143 trav AFYH01079918.1 1835 RGLGNELQQSVVPLEKEDGSSVKLECTYITSYAYFILYWYKMNLDKTLQYISRYYSADSSSDTDALFQDRFTSTWDTSSSSTTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae Vs843 trgv AFYH01269167.1 1027 NFAAVRLKQLELSITKAPGRTAKFTCAVSGVANLDSTVIHWYRARAGQAPERILYYSSGDNYDPGFTKAKHSSNKVNNIFTLTISKASEEDNGYYYCACWD
Latimeria chalumnae Vs1148 trav AFYH01079922.1 5852 FCKGDNVTEWDLEKIVIEGDTVTLRCNYIATSTSSPYLMWYKQHLNQPLEYLLQVVKSNAKANSTGEKFLTSELKSEEKLVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae Vs844 trgv AFYH01269169.1 1357 GVGSVTLKQTERSITKTTGKIARVNCQVSGVSLDNAIIHWYRHRPNEGPERILYHSSEVKYDPGFTETKYSAYKVNDNFVLRISNVAEEDNGYYYCAYWD
Latimeria chalumnae Vs1669 ighv AFYH01211826.1 13439 EPQIRQLPRILQQKPGGTLSIECKLSGKSSHPYNVFWLRQYPGQKLEFFIRYNTEADKYIVSGFEARFLPSKNISTNVYYLKIKDLRVEDSATYYCTHYALS
Latimeria chalumnae Vs1139 trav AFYH01079916.1 994 WGLGNEVQQTVPSLNTENGNTVTLECTYTTSFTDYVLYWYKQHADKSLQYISQQRSWGGSDTERLFQNRFTSTFNKQASLTTLTIKNVEFSDTALYYCALRE
Latimeria chalumnae Vs1289 trav AFYH01118948.1 16068 GEPSSEVQQLPDMKLVEGHPVQIHCNHSITSYNSMFWYQQLPNKPPEVIIYGYESADPIGRFSMSFNRDKLETSLIISGTEISDAATYYCAVS
Latimeria chalumnae Vs1605 ighv AFYH01191461.1 6587 VQSAIVLKESGGDIKKPGESLRLSCKTSGYTFDDYALSWIRQPPGKGLEWVGVIYTDTGDTAYSQSVQGRFTITMDVPSSSGFLQMNSLRAEDTAMYYCARE
Latimeria chalumnae Vs1603 ighv AFYH01191459.1 3506 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYAMHWVRQPPGKGLEWIAFISYPSGSTTHYSQSVQGRFTVSRENSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae Vs400 ighv AFYH01118918.1 8273 FQFTAVLAQAGTEVTKAGESIKLQCDLSGFDVNSYWMYWYRQDPRKGMDWLVSYWSSSNNRYSPSIQGRFTASKENSNFYLQMNNLGIEDTAMYYCARLD
Latimeria chalumnae Vs1601 ighv AFYH01191455.1 13766 IQSDVILTASGGDVKKPGESLRLSCKASGFDFSSYYMHWFRQPPGKGLEWVGRISDGSGSSKLYSQSVQGRFTISRENSNSMLHLQVNSLKVEDTAMYYCARE
Latimeria chalumnae Vs873 ighv AFYH01281554.1 30 VQSAVVLTQSAAEVKKPGDSLRLSCKTFGFSITRIPNTMSWIRQPIGKGLEWLAVIDWDGDTSYLSSIQGRFTISRGTSSSTVYLQMNSLRVEDTAMYYCARA
Latimeria chalumnae Vs1321 trbv AFYH01119985.1 12696 LCGGAILVTQHPKSLTGRLANTIEMNCRHSETSDSIYRMFWYQQKRGQRLTLIANTYITGDKLDIEQDFKKEFEVMRSDNRNSNLKIKTLKAGDTASYLCAVGG
Latimeria chalumnae Vs1320 trbv AFYH01119985.1 14318 LCGGAILVSQLPNSLTGRTEKTVEMNCSHDYPGTDPYSILWYQQKRGQGLTLIVYTVGAQGKPNFESDFEKEFEVTRPDNRNSALTIKGLKAEDTASYLCAASK
Latimeria chalumnae Vs1323 trbv AFYH01119985.1 7451 LCDGAVKVTQSPKSLVQMSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTILNSTLKILQLKAADTASYLCAAS
Latimeria chalumnae Vs1322 trbv AFYH01119985.1 9240 FCGGVIHVTQHPNSLTGSTGNPVEINCTHDYTGTDISRMFWYQQKRGQGLTLVVYTVGAEGKPTFERDFEKEFEVKRPDKRNSALTIKGLKAADTASYLCAAS
Latimeria chalumnae Vs1325 trbv AFYH01119985.1 2964 LCGGAILVTQLPNSLTESSGKLVEMNCTHDYMGTDFYNIFWYQQKRGQGLTLIVYTSIAGDEPKFEPGLEKEFEVTRPDNRNSNLKIKALKLTDSASYLCAVRK
Latimeria chalumnae Vs1324 trbv AFYH01119985.1 5034 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTVSTANMYWYRQYRGQGPELIAYTKTVGSNQTEPGFQDKFEVMRLKTKETSLKIKKLKAADTASYLCAVSK
Latimeria chalumnae Vs1327 trav AFYH01119986.1 414 LCGGAIIVTQQPNSLTGRTGNPVEMNCSHDYMGADPYSIFWYQQKKGQGLTLIVYTYGAQGKPSFEQDFEKEFEVIRPDNRNSALTIKGLKAADTASYLCAASK
Latimeria chalumnae Vs1326 trbv AFYH01119985.1 369 LCSGAILVTQHPNSLTGRTGKPLEMNCTQTDTSSTATIYWYQQYRGQGLTLIVYTVGVTGTPYFEQNFTKHYEVMRSDKAHSTLKIKALKATDTASYLCAASK
Latimeria chalumnae Vs1329 trbv AFYH01119988.1 2259 LCDGAVKVTQSPNSLVQTSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLTVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLKAADTASYLCAAS
Latimeria chalumnae Vs1328 trbv AFYH01119988.1 4008 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTSSTATMYWYRQYRGQGPKFITYTLADGSNQTEPEFKEEVVVMRLNTKETSLKIKKLKASDTASYLCAVSE
Latimeria chalumnae Vs1792 ighv AFYH01243044.1 8148 IQSDVTLTESGGDIKKPGESLRLSCKASGFTFCNYLMHWIQQPPGKAIEWVAYISTGGVSTSYLQSVQGRFTISRDNSNNMLYLQMNSLRVEHTAIYYCAGD
Latimeria chalumnae Vs1170 trav AFYH01079944.1 15597 LCLGDSVTEEHKVLQVTEGQAATFTCRYNLTVTYSEALQWYIQPFNGAPKYILQRLKSSSQDLKADGIGDRFSSSLDTTKRLTTLTITDAQMADSGTYYCALS
Latimeria chalumnae Vs1171 trav AFYH01079944.1 3523 LCLGDSITEEHKVLEVTEGKAAKLTCRYNVGSASNEALQWYIQPFNRAPKYILQRFKSSSEDLKADGIGDRFSSSLNATEKLTTLTITDAQMSDSGTYYCALS
Latimeria chalumnae Vs589 igkv AFYH01182555.1 6924 SNGQTTLTQSTSKSVSPGENFTVICKSSCGISASHLHWYQQKPGQVPKPLMYQTSNCVSGVPNRFSGRVSGTGYSLTINNVQVEDAGDYYCQQSNNFP
Latimeria chalumnae Vs588 igkv AFYH01182553.1 21355 DRLHLISLLLLYVSPGESVTINCKASSSVSRSYFHWYQQKPGQAPWLLLYQTSNRASWAPNRFSGRGSGTEYSLTISNVQVEDAGVYYCQQGANFP
Latimeria chalumnae Vs402 ighv AFYH01118919.1 8062 VHFSVVLSQSNEEVKKAEESLRLKCSLTGFDVNSYSMFWYRQAPGKGLEWLVYYYSSSINDYSSAIRGRFTASKDSSSFYLQTNSLRVEDTAMYYCARRD
Latimeria chalumnae Vs1286 trav AFYH01118945.1 10639 LFRTDGGGNANVYQPPGMVKMEGILVEVPCNYSDKNYDFMYWYRQLSRKAPELLTYGIDSAAANGRFSMSFRKTNQETSLIVSGTEIQDSATYFCAVR
Latimeria chalumnae Vs587 igkv AFYH01182553.1 14686 SSGQTTLDQSPASKSVSPGESVTITCKASSSVSSSYFHWYQQKPGQAPNLLLYSTSSRASGVPNRFTGSGSGTDYSLTISNVQVEDAGDYYCQYY
Latimeria chalumnae Vs586 igkv AFYH01182553.1 8202 SGGQITLNQSPASKSLSPGESITITCKASSGISSDRLHWYQQKSGQAPWLLLYKTSNCASWAPNRFSGRGSGTDYSLTITNVQVEDAGDYYCQQGNSFP
Latimeria chalumnae Vs406 ighv AFYH01118923.1 647 VHFSVVLSQSSEEVKKAEESLRLTCSLTGFNVNSYHMYWYRQAPGKGLEWLVRYYSSSNNDYSSAIQGRFTASKDSSSFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs596 igkv AFYH01182572.1 1041 SNSQITMEQSPLTSSVIPGETVTIKCKASSGIDDYIAWYQQKSGQKPKLLIYAASTRASGISSRFSGSGSGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae Vs1876 ighv AFYH01267210.1 5193 IQSEVILTESGGDVKKPGESLRLSCKASGFTFRSYYMHWVRQPPGKGLKWVLAISSGSGSSTWYLQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAIYYCARE
Latimeria chalumnae Vs1879 ighv AFYH01268027.1 1089 VQSAVVLTQSAAEVKKPGDSLRLSCKTSVFSLTSSPNTVSWIRQPIGKSLEWLALIYWDADTSYLSSIQGRFTISRDASSSTVYLQMNSLTVEDTAMYYCARR
Latimeria chalumnae Vs1285 trav AFYH01118945.1 12153 VHGQIEVIQTETFLPTLEGESVQFNCTYQGTEYSLQWYKHYPEKPPQVILLRTTDGYEKSGRNRMFLDSKKKFGFLQINNTSVEDTATYFCAV
Latimeria chalumnae V1 ighv AFYH01079847.1 5993 IQSDVILTESGGEVKKPGESVKMSCKASGFTFSSYEMNWIRQAPGKGLEWIAYISGSGGSTVYLQSVQGRFTISRENSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V0 ighv AFYH01079845.1 5732 IQSQVNLTESGGDFKKPGESLKLSCKASGFTYSSYYMHWIRQPPGKGLEWVSATNTAGSSKWYSQSVQGRFTISRDNSNNMLYLQMNSLRVEDTAMYYCAKD
Latimeria chalumnae V39 trav AFYH01273693.1 4894 HGEIVQVTQTPTSLYPNAGNYMEIQCEQHSNKQYMYWYQQRKREGLKAIGQIFIATKGEKPKYEPGFSSRFEITRNDSKAGSLKISNLTAKDSAVYFCAAG
Latimeria chalumnae V38 trav AFYH01273693.1 2845 RGEIVQVTQTPTSIHPNTGNSMEIQCKQDSNKQYMYWYQQRKQEGLKAIGQILIATKGAKPKYEPGFTSRFEIMGIDSKAGSLKISNLTAEDSAVYFCAVSD
Latimeria chalumnae V37 trbv AFYH01273693.1 836 HCQTVLVIQFPSSVHKNAGNKVETYCQHNKNDYYYMYWYQQRRAEGVKLIGNTYMTNEAKHEDGFNSSKFQIPQRDQVEKGSMKIVDLGAGDMAVYFCAVSE
Latimeria chalumnae V36 trav AFYH01273692.1 678 HGEIVQVTQRPTSLHLNANNSTEIHCEQDSNKNYMYWYQHRKQEGLKLISYVILTTIGEATQYEPGFTSRFHIWSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V35 ighv AFYH01269728.1 255 VQSDVVLNQSGAEVKKPGESVKLSCKTSGYDYTDYYLHWIRQRPQKGLEWIVRINTGDGNGDFHQSFQGRFTISEDVSSATAFLQISSLTVEDTAMYYCARE
Latimeria chalumnae V34 trgv AFYH01269169.1 1354 GVGSVTLKQTERSITKTTGKIARVNCQVSGVSLDNAIIHWYRHRPNEGPERILYHSSEVKYDPGFTETKYSAYKVNDNFVLRISNVAEEDNGYYYCAYWD
Latimeria chalumnae V33 trgv AFYH01269167.1 1024 NFAAVRLKQLELSITKAPGRTAKFTCAVSGVANLDSTVIHWYRARAGQAPERILYYSSGDNYDPGFTKAKHSSNKVNNIFTLTISKASEEDNGYYYCACWD
Latimeria chalumnae V32 ighv AFYH01256699.1 1905 IQSQIILTESGGDAKKPGESLSLSCKTSGFTISSYYMHWIRQPPGKGLEWVSRLDTGSGKLYSQSVQGRFTISRDNANSMLYLQMNNLRVEDTAMYYCAGD
Latimeria chalumnae V31 ighv AFYH01256698.1 6164 LTQSDPQVGKPGESLKLQCAVSGFNVNSYWMAWVRQAAGKGLEWLVSYYSSSNNYYSSSIQGRFTASKDSSNFYLQMNSLRIEDTAMYYCA
Latimeria chalumnae V30 ighv AFYH01256697.1 4871 VQSAIVLTQSGAEVKKPGESVKLSCTPSGYSYTSYNLYWIRQIPGKGLEYIGYQSTGSGSAGYHPSFQGRFTISEQVSLTTTYLQISSLRIEDTAMYYCARQ
Latimeria chalumnae V29 ighv AFYH01213578.1 13932 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYHMHWVRQPPGKGLEWVAFIHTGSSSRYYTPSVQGRFTISREDSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V28 igkv AFYH01182575.1 2510 SSSQITMEQSPLTSSVIPGETVTIKCKASSDIDDYIAWYQQKSGQKPKLLIYAASTRASGISSRFSGSGSGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae V27 igkv AFYH01182572.1 1039 SNSQITMEQSPLTSSVIPGETVTIKCKASSGIDDYIAWYQQKSGQKPKLLIYAASTRASGISSRFSGSGSGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae V26 igkv AFYH01182567.1 6767 SSSQTTMEQSPLTSSVIPGETVTIKCKASSGIGDNIAWYQQKSGQKPKLLIYETTARASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYCQQYNSWP
Latimeria chalumnae V25 igkv AFYH01182564.1 5493 FNSQIAMEQSPLTSSVIPGETVTIKCKASSGINNDIAWYNQKSGQKPKLLIYAASTRASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYC
Latimeria chalumnae V24 igkv AFYH01182563.1 10388 SSGQITLNQSPASKSVSPGESVTIACKASSSVSSSYFHWYQQKPGQAPNLLLYSTSSRASGVPSRFTGSGSGTDYSLTISNVQVEDAGDYYCQEGSSWP
Latimeria chalumnae V23 igkv AFYH01182561.1 3602 SRGDITMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQKPKSLIYDSVKRYTGVSSRFSGSGYDYDFTFTSNNVQAEDAGEYYCQHYENFP
Latimeria chalumnae V22 igkv AFYH01182560.1 1459 SVGDIIMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQEPKLLIYAVNTRHTGVSSRFSGSGYDYDFTFTINNVQAEDTGVYYCQQDDSYP
Latimeria chalumnae V21 igkv AFYH01182553.1 8200 SGGQITLNQSPASKSLSPGESITITCKASSGISSDRLHWYQQKSGQAPWLLLYKTSNCASWAPNRFSGRGSGTDYSLTITNVQVEDAGDYYCQQGNSFP
Latimeria chalumnae V20 trgv AFYH01119975.1 782 ADSAAVIHQTPKSISEPVGATVRLNCSVEGESDPYMYWYRQSPYGKPELLIFSYGANSVDDKDNPAKHFTASRPDGRNFNLETPNLRANDTAVYYCAWS
Latimeria chalumnae V19 ighv AFYH01119973.1 13981 SQSVRQSPSYIVQSEGESARLECTFQGNTNPYMYWYRRAATGGIQLVSLSVDATATTENMLQHFKAKRSSSEDFLLTTERLQLDDTAVYYCAWS
Latimeria chalumnae V18 trbv AFYH01119973.1 12264 GLCQTVHQSPAIIVVSGNPVSLHCYQAGSSSSSYMYWYRQYPKKGLELILTSVYLSGDTVSPEFEGRFSSKRPDQRNCSLEITTLKSEDSAIYFCASS
Latimeria chalumnae V17 ighv AFYH01118924.1 3862 VQSEVVLTQSGEEVRKAEESLTVSCKGSGFTFTDYHIYWYRQPPGQELNWLGVLWASGSINYNQAMKGRFTVSRENSNSMAYLQMNSLQLQDTAVYYCAAV
Latimeria chalumnae V16 ighv AFYH01118923.1 6416 VHFSVVLSQSSEEVKKAEESLRLKCTLSGFDANSYRMYWYRQAPGKGLDWLVNYYSSPVYSPSIQGRFIASKESSNFYLQMNSLRIEDTAVYYCARRD
Latimeria chalumnae V15 ighv AFYH01118923.1 4591 VLTQSSQEVKKADESLRLSCKGSGSTLNNYYIHWYRQPAGQGLDWLGVIWYDGSRTEYNQAVKDRFIITRDNSNSMAYLQMNSLRLEDTAVYYCAAE
Latimeria chalumnae V14 ighv AFYH01118922.1 4169 LTQAGTEVKKAGEPIKLKCDLSGFNVNSYWMYWYRQAPGKGLDWLVYYYTSPSYSSSIQGRFTASKESSNFYLQTNSLRIEDTAMYYCARR
Latimeria chalumnae V13 ighv AFYH01118918.1 1992 FQFTAVLTQAGTEVTKAGESIKLQCDLSGFDVNSYWYQQAPGKGLDWLVSYSSSSNNEHATSIRGRFTASKENSNFYLQMNNLGVEDTAMYYCARLD
Latimeria chalumnae V12 trgv AFYH01118913.1 13958 SVSHMSKSVVEEESQAVTITCSYNTSYSNLYLQWYRQFKQEAPIYLLQKYFLGIGTVQGDKAEGIDDRFEGFLDPKTKVTNLTIKDLKLSDTAMYYCALS
Latimeria chalumnae V11 trav AFYH01118913.1 5459 LTLGDSVSHISRSVAEEESQAVTITCSYNASRSDVYLYWYRQFKQGSLTYLLQKYTFGTGTVEGSKAEGIDNRFEGFLDPITKVTNLTISDLKLSDTAVYYCALR
Latimeria chalumnae V10 trdv AFYH01118911.1 1189 LTLENSVTQTSNSIDAEESRAVTITCCYNGSFSDVYLYWYRQFKQEALNYLLYKYTFGTDTVQGDKAEGIDIRFEGYLDPKTKVTNMMIKDLKISDSTVYYCALS
Latimeria chalumnae V9 trav AFYH01118910.1 1545 SVTQTSKSVDAEETQAVTITCSYNTSATTVYLYWYRQNKQGALTYLLQKSVFGTGTVQGDKAEGTDDRFEGFLDPKTKVTNLTINDLKLSDSAVYYCALSLTVVYN
Latimeria chalumnae V8 trav AFYH01118908.1 4516 SVNHISISVTAEESRAVTITCSYNASYSNVYLFWYRQFKQEAPNYLLHKYTFGTDTVQEDKAEGIDDRFEGFLDPKTKVTSLTIEDLKLSDSAVYYCALS
Latimeria chalumnae V6 ighv AFYH01079852.1 5191 VQSAVVLTQSGAEAKKPGESLRLSCEASGFTFGDYWMSWIRQAPGKGLEWLARISYWAGSTINYAQPVQGRFIISRDNSNNILYLQMNSLRVEDTAIYYCARD
Latimeria chalumnae V5 ighv AFYH01079851.1 12557 IQSQVILTESGGDAKKSGESLKLSCKASGSTFSSYYMHWIRQPPGKGLEWLAEIRPDASKTWHSQSVEGRFSISRDNANSMLYLQMNSLRVEDTAMYYCARN
Latimeria chalumnae V4 ighv AFYH01079850.1 1454 IQSEVTLIESGGDVKKPGESLTLSCEASGFSLSSYYMSWVRQPPGKGLEWLSAADTAGSSKWYSQSVQGRFTITKDNSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae V3 ighv AFYH01079849.1 9158 IQSQVILTESGGDVKKPGESLRLSCKASGFTFSSYYMHWFRQPPGKGLERIAYISADGSSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCTTD
Latimeria chalumnae V77 trgv AFYH01079927.1 3206 TEGLTKFSQPAHKTAKEGESVQILCEDINTSYLSLWYKQTLQHRQKGLQLMISGYDNDKNEKFNLTIEKKNQSSTLTVKEVQLGDAALYYCAQS
Latimeria chalumnae V76 trgv AFYH01079923.1 3971 QECQGKLSQPAYKTAEEGESVQILCKEVDTRYNTLWYKQAPQHSQKGLQLIIYGISNDENKKFTLTVEKENKSITLTIKEAHLGDAGLYYCAESDTVTTAGL
Latimeria chalumnae V75 trav AFYH01079922.1 5545 FCKGDNVTEWDLEKIVIEGDTVTLRCNYIATSTSSPYLMWYKQHLNQPLEYLLQVVKSNAKANSTGEKFLTSELKSEEKLVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae V74 trav AFYH01079920.1 1590 IHVYGQESKLSHLEAVEGEDIIIPCNHSTAASFTLWYKQLPNKAPQHLISRYSGNLTEGRFTLRITEERRSSKLTVTAVELNDTGVYFCAWQ
Latimeria chalumnae V73 trdv AFYH01079919.1 11635 LGVDSQEKQLLHTEAIEGTNVTFSCTYKETASRSYWYRQVPKGAPQHLIDGYDGKTSEGQGHYTLEIEEGRKSSKLTVSAVELNDNGVYFCAWQ
Latimeria chalumnae V72 ighv AFYH01079918.1 1522 LGNELQQSVVPLEKEDGSSVKLECTYITSYAYFILYWYKMNLDKTLQYISRYYSADSSSDTDALFQDRFTSTWDTSSSSTTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae V71 trav AFYH01079918.1 4306 SYADNKTTQLSDIQVIEGTDALIPCNYTETAGNTFWYKQAPEGTLHNLITNFSRNKTEGKLTLYVDQGRQSSKLKVSSVELGNSGVYFCAWQAQ
Latimeria chalumnae V70 trgv AFYH01079916.1 684 WGLGNEVQQTVPSLNTENGNTVTLECTYTTSFTDYVLYWYKQHADKSLQYISQQRSWGGSDTERLFQNRFTSTFNKQASLTTLTIKNVEFSDTALYYCALRE
Latimeria chalumnae V69 trav AFYH01079916.1 5545 SDVLFQQKELIRTEEGLNVTVECNYTESNPTLFWYRQMQHGKLEYILGRNEYNYKDNAEGFDSFSANVNKNDGTLKMFHLVITGVQVTDSAVYYCALS
Latimeria chalumnae V68 ighv AFYH01079916.1 11825 RGLGNKVQQSVDPLEKENGSSVKLECTYSTSYTYYYLQWYKLNPDKTLQFISSYYSSSSSSYTDALFQNRFTQTLDKSSSRTTLSIRNLELRDTAVYYCALSD
Latimeria chalumnae V67 ighv AFYH01079912.1 2865 FGNEVKQSVHSQKKEDGSSVILECTYKTSYTSYYFFWYKLNPDKALQFISRYHNYGSASNTDTSFQHRFTTTLDTSGSRTTLSIKNLELRDTAVYYCALSE
Latimeria chalumnae V66 ighv AFYH01079912.1 5736 RGLGNELKQSVEPQEKEYGSSVKLECTYKTSYTYYFLFWYKLNTDKSLQFISRYNSYDSTSYTDASYQDRFTSTWDTSSSSVTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae V65 ighv AFYH01079910.1 4764 HGNEVQQSARSMEKVYGSSVKLECTYSTTYGSYLLYWYKLNLDKSLQYISYRSSWGTDDTHALFRNRFTSALDTSSSLTTLSIKNLELKDTAVYYCALSDAQ
Latimeria chalumnae V64 ighv AFYH01079910.1 13281 LGNELQQSEGPLEKEDGSSVRLECTYRTSYSSYYLYWYKINLDKSLQYISRYLNSWTSGRIDPLFQNRFTSTLDTSSSLTTLSIKNLELRDTAVYYCALRD
Latimeria chalumnae V63 trav AFYH01079910.1 21251 RSKDVLFQDKELIGVEGQNVTVECNYTESIQYLFWYRQMQHGKLEYILGRNEYSYKDNAEGFGSFSANVNKNDGTLKMFHLVITGVQVTDSAVYYCALS
Latimeria chalumnae V62 trav AFYH01079909.1 2047 SVYGDSVEQPDVELSVKEGESIALKCTFPSGSGYVFWYRKYPNQALQYILQQGVGGNRFTNKAEFARKRFSIHPAGNTGGMIVSDLSFSDSALYYCVFSDS
Latimeria chalumnae V61 trav AFYH01079906.1 191 AVFGDSVQQDQPEHTEKEGFSVSLTCTYSTSSSYIYLHWYHSYPNRASEYILQRGAKSRSGNVHTAEFAKGKFDSRVDSSTTTLTINNVQLSDAALYYCALQV
Latimeria chalumnae V60 ighv AFYH01079906.1 930 TIQPQELIVSSEEGEIATLTCTFSTSETWINLHWFRKYPNRAPEFILLRGAKGSSDRYNANFVKQKFDSSTDSSSTRLAVKNLELRDTALYYC
Latimeria chalumnae V59 trdv AFYH01079906.1 5010 SIQSQELAVPSKEGDTVTLVCTHSTSSSNIWLHWYRKFPNEAPEFILSRGAKSASGDDYTADFAKDKFDSSADSSTTKLIIKNVQQSDAPLYYCALQM
Latimeria chalumnae V58 trav AFYH01079906.1 9168 EVFGDSVQQDQSAHSQKEGDSVTLTCTYSTTENYVYLYWYRKNRNGALEYILYRGAKSRSGYDHTAEFAKDKFDSRADSSTTTLTIKTVQLSDAALYYCALRID
Latimeria chalumnae V57 trdv AFYH01079905.1 3954 GLLGDSIQPQELTVPSEEGETVTLTCTYSTSTSNIFLHWYRKYPKTAPEFIHYRGAKGYTGTHTADFAKQRFDSKTDSSSTRLTVKNLELRDTALYYCA
Latimeria chalumnae V56 trdv AFYH01079904.1 2505 SIQSQELAVPSKEGDTVTLVCTHSTSSSNIWLHWYCKFLNEAPQFIFFRGVESASGGVYTEQFVKGKFDSSADSSTIRLIIKNVQLTDAALYYCALQM
Latimeria chalumnae V55 ighv AFYH01079903.1 5298 SIQSQELEVPSKEGDTVTLTCTYSTSDTYIRLHWFRKYPNKAPEFILLRGAKGSSASYDADFVKQRFDSNTDSSSTRLTVKNLELRDTALYYC
Latimeria chalumnae V54 trdv AFYH01079903.1 6716 SLLGDSIQPQESTVPSLEGDTATLTCTYSTSSTDIWLHWYRKYPNGAPKFILYRGARSRSNEYYTAEFAKDRFESTADSNTTTLTINNVELSDTAFYYCALD
Latimeria chalumnae V53 trgv AFYH01079903.1 8546 SVQQDQPVHSEKEGNSVTLTCTYSTSFDWIYLNWYRKYPNKAPEFILYRGAKSRSGTDYTAEFARGKFDSSADSSTTKLAINNVQLNDAALYYCALWK
Latimeria chalumnae V52 trgv AFYH01079903.1 10779 SVQQDQPVHSEKEGDSVNLTCTYSTSSSYINLHWYRKHPNGAPEYILQRGAKSNSGDDHTAEFAKNKFDSRTDSSTTTLTIKTVQLSDTALYYCALWI
Latimeria chalumnae V51 trav AFYH01079902.1 3499 EVFGDAVQQDQSVHSPKEGNSVTLTCTYSTTENDIYLNWYRKYPNGVPKFILYKGAKWNSGTDQTAEFAQERFDSRADSITTTLRINNVQLSDAALYYCALCID
Latimeria chalumnae V50 trdv AFYH01079901.1 5295 EVFGDSVQQDQTVQPQKEGGSVTLTCTYSTTNSNIYLHWYRKYPNGVPDYILKRGAKSYSSYQHTAEFAKGKFESNADSSTTRLTINNLQLSDTALYYCALEI
Latimeria chalumnae V49 trdv AFYH01079901.1 11403 GGFADEVQNSDTHLEKHLGETVNFKCTYSTSSTYVALYWYRGYQNHPLQYISYCDSSNNYHRANSFTRFSSTLDTNAHFTTLSVSKVDLGDNAVYYCGSTT
Latimeria chalumnae V48 trdv AFYH01079901.1 15418 VSLGDLIQQDQRSRFQRQGDSVTLICSYSTSSIAVYLHWYRKYHNGAPEWILYRGAKSTNRHQHTAPFAEERFESRADSISTRLTIKNIQPSDTALYYCA
Latimeria chalumnae V47 trdv AFYH01079901.1 21199 LFALQILGDSIQPQELVVPSNEGETVTLTCTYSTSYTGIYLYWYRKYPNRAPEFILLRGAKSYTGTRTADFAKQRFDSKTSSSSTRLTVKNLELGDAALYYCALLL
Latimeria chalumnae V46 trav AFYH01079901.1 23260 EVFGNSVQQDQSVHSPKVEDSVTLTCTYSTTESNIYLNWYRKYPKGALKFILYRGAKSQSGTDHTAEFARGRFDSSADSSTTTLTISNVQLSDATLYYCALEI
Latimeria chalumnae V45 trgv AFYH01079900.1 105614 FGNSIQSEKLLLSQKDGNPVTFTCTYSTSASWIYLFWYRKYPNGAPEYILRRGAKSNSGDDHTAEFAKDEFNSRADSSTTTLTIKNVQLSDAALYYCALWIDS
Latimeria chalumnae V44 trav AFYH01282963.1 793 RGQDVQVTQTPTSLHLNAGDSTLMHCKQDSNKNTMYWYQQRKREGLKFISSVVVLTEGDATKYEPGFTSRFHIRSQGNNAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V42 ighv AFYH01275529.1 202 AQSDIVLTQSAAEVKKPGDSLRLSCKVSGLSLTSSGTVVVWIRQPIGKGLEWLARIDWDLDTFYSSSVQGRFTISRDTSSNTVYLQMNSLTVEDTAMYYCARA
Latimeria chalumnae V41 trgv AFYH01274206.1 245 GVVSITLEQPELSVSKSVTETVKLSCRFQGVSIIHWYILKPNEALQRILYYGSAARNGYDEGFNKKSFRAEKKNDECFLFIYNLEMSDTATYYCA
Latimeria chalumnae V115 trav AFYH01118945.1 38835 GEPSSEVQQLPDMEFVEGNLVEIHCNHSISSYNNMYWYQQLPNKPPEVILYGYDSADPKGRFSMSFNRNKRETSLIINGTEITDAATYYCAVD
Latimeria chalumnae V114 trav AFYH01118944.1 703 QTRGDTEFKQDAVVSVKEKEIAKLHCDYNTSEVNLYFFWYRRIPGYALQYILRNSSYGAADTASGFSGFNAKVENKAFHLNINSVEMRDAAVYYCTLS
Latimeria chalumnae V113 trav AFYH01118944.1 6016 KSKEDSVNQSEVELVVFEGKTTIINCSYSTADTYPYLFWYVQYVNKAPQYILQRDPSTVQNAPRFKERFSATLDKEKKTTLLFIENTGMSDSAVYYCALR
Latimeria chalumnae V112 trav AFYH01118943.1 1431 VIHCNDKVEQVTSLSSSEGRSVTMNCTFTANIRALQWYKQSPSKTPENLFVLVLDGEENTTSYTASLNMKEKLSILKIRNVKLAYSATYFCAVE
Latimeria chalumnae V111 trav AFYH01118942.1 6478 GVHCDDEVIQIINSFRASEGRNVTMNCTYKAVSFYNLQWYQQFPSQNPENLFILRSDGVEPKPPVTASLNKNEKLSILTITNVKLTYSATYFCAVE
Latimeria chalumnae V110 trav AFYH01118941.1 3542 KNKENSVNQSEDELVDFEGNAIIIKCNYTATDPFPYLYWYVQYVNEAPQYLLRRDRNSEDNAPRFKDRFSATLDNEKKTVPLLINNAQIFDSAVYYCALR
Latimeria chalumnae V109 trav AFYH01118939.1 3300 KSKEDSVNQLEVEQVVFEGKTTIINCSFTTAQAYPYLFWYVQYVNEAPQYLLRRDRNSEDNAPRFKDRFSATLDNEKKTVPLLINNAQIFDSAVYYCALR
Latimeria chalumnae V108 trav AFYH01118939.1 15371 QTKGGTDFKQDYMVAVKEKETVKLNCNYNTTEALRTFFWYRGIPGRALQLVLRNDTYGNGYFEPGFSRFNAQVRTSNNAFHLHVESVEMRDAAMYYCALS
Latimeria chalumnae V107 trav AFYH01118938.1 6068 VNCSDEVIQIIQSLRVSEGQNVTMNCTYKLLNFYSLQWYKQSPNQNPENLFVFRLDGEEGKLPFTASFNEKEKLSILTITNPKLIESATYFCAVE
Latimeria chalumnae V106 trav AFYH01118938.1 8097 VHCNDEIDQIITSLNVTEGQNVTMNCTYKSSNIYNLQWYKQSWSKKPENLFILTSDGEVPNPPFTASLNKKEKLSVLRITNVKFVESTTYFCAVQ
Latimeria chalumnae V105 trav AFYH01118936.1 6955 VHCDDEVQQFITSVTENEGQRVSLNCTYKDATINNLQWYKQLPNKKPENLFFLSLDGEQNESSCTASLNRKEKLSTLKIRSMKLSDSATYFCAVE
Latimeria chalumnae V104 trdv AFYH01118935.1 487 LTEEDNVTNVQDTLFALEGESAKISCTYSKSISSFSSYWYKQHPGGNLIILCRKDDDDFEINKAGNRFAVNLHKSDNALSLIIKGLQLYDSALYYCALTK
Latimeria chalumnae V103 trdv AFYH01118934.1 1627 AVSNPAMVQRELLETIAGNKVSFECSLKDGNMGSYFMYWYRKRPQNSLEWIYREGDYYGDGFKDRFFGKVISSDNKFILEIKTAERGDAAVYYCAA
Latimeria chalumnae V102 trdv AFYH01118934.1 3856 AGSNPIILQLERLETPAGNKVNFECSLKDGGMGSYWMNWYRQRPKNSLELVYSQYGSKYGDGLADRFVGKVESSNNKFTLEIKAAELGDAATYYCAAW
Latimeria chalumnae V101 trdv AFYH01118934.1 15944 AASNQVVQLNDKLDTVAGNSVTFECSLKDGSMGSYYMFWYRQRPKNSLEWIYKEGGKYGDRFGDRFVGTVDGSNNKCTLEINAAELGDAAVYYCAAS
Latimeria chalumnae V100 trdv AFYH01118933.1 2256 AGSNPVVDQFQKNLETFAGNEVNFECSLNGGSMNDYYMSWYRLQPKKSLELIYSERGNKYGDGFQGGFVGKVESSNNKCTLKIKAAELGDAAMYYCAAAR
Latimeria chalumnae V99 trdv AFYH01118930.1 15200 NSLGNSVSQDISPLSAIKGSTVTIKCSYSTSYSNFVLPWYRHKPQESLEFLLLKYWDDDGYNLAGDRFSLDLKTNQKSITLTIKDLQLSDSAVYYCGLWD
Latimeria chalumnae V98 trdv AFYH01118930.1 17728 HSFGNSVSQDDQPLTVNEGSASSIINCKYSTSYSSYYLFWYRQYPQKPLEFLIRKYSDGSEHKSNSADRRFSSDLNTSQKKFTLTIKDLQLSDSAVYYCGLWE
Latimeria chalumnae V97 trdv AFYH01118930.1 17728 HSFGNSVSQDDQPLTVNEGSASSIINCKYSTSYSSYYLFWYRQYPQKPLEFLIRKYSDGSEHKSNSADRRFSSDLNTSQKKFTLTIKDLQLSDSAVYYCGLWE
Latimeria chalumnae V96 trav AFYH01079947.1 12938 LCLGDSVTEEHKVLQVTEGKETTFTCTYNKSTASSETLQWYIQPFNGAPKYILQQFNSGSKSLESKAEGIGDRFSSSLDPTKRLTTLTITDAQMADSGTYYCALT
Latimeria chalumnae V95 trav AFYH01079944.1 3210 LCLGDSITEEHKVLEVTEGKAAKLTCRYNVGSASNEALQWYIQPFNRAPKYILQRFKSSSEDLKADGIGDRFSSSLNATEKLTTLTITDAQMSDSGTYYCALS
Latimeria chalumnae V94 trav AFYH01079944.1 9604 LSLGDFVVEEYKVLQVTEGKAATFTCRYNMTVAYDEALQWYIQPFSGAPKYLIQRYKSGSTTHESKADGIGDRFSCSLDTTNRLITLIMRDAQMSDSGTYYCALS
Latimeria chalumnae V93 trav AFYH01079944.1 15284 LCLGDSVTEEHKVLQVTEGQAATFTCRYNLTVTYSEALQWYIQPFNGAPKYILQRLKSSSQDLKADGIGDRFSSSLDTTKRLTTLTITDAQMADSGTYYCALS
Latimeria chalumnae V92 trav AFYH01079943.1 9892 LCLGDSVTEEHKVLQVTEGKAITFTCTYNKSAAYNEALQWYIQPFNGAPKYILQQFKSSSKSLESKAEGIGDRFSSSLDTTNRLTSLTISDIQMADSGRYYCALS
Latimeria chalumnae V91 trav AFYH01079942.1 20852 LCLGNSITEEHKVLQVTEGKAETFTCRYNLSSGYNEALQWYLQPFNGAPKYILQWLKSGSTSQESKADRIGDRFSSSLDATKRLTTLTITDVQMSDSGTYYCALS
Latimeria chalumnae V90 trgv AFYH01079940.1 100 DSVTEWDLEKNTIEGETVILRCNYTATSTSNPVLMWYKQHLSRPLEYLLQVDNFNPKANRPGGKLTSELKKEEKSVSLSIPKTELSDSGVYYCALR
Latimeria chalumnae V89 trdv AFYH01079940.1 7784 KECLGKPSQLPYKIAEEGKTAEILCGAINVNYNILWYKQTPHHSQKRLQLITYGFGNDEKDQFQLTQGMENQTSTLTIRNVHLGDAALYYCAESDTVT
Latimeria chalumnae V88 trgv AFYH01079938.1 84 CQAKLSQPAYETVEEGKSVQILCKEIDTSSLTLWYKQTPLHNQKGLQLIIHGYESTQEKQFNLTVDKQNKFITLTIKEAHLGDAGLYYCAESDTVTTAGL
Latimeria chalumnae V87 trav AFYH01079937.1 2931 REGAFEPQQPPSVEAAEGKEVNLPCNYSLGTSDNLYWYKQTKESMKFLIQGYKDTKNESHYTLTIATDRKNSTLTMWDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V86 trgv AFYH01079935.1 5326 KVTEWDLVKAATEGDTVTLQCNYTATTISSPNLMWYKQKLNRPLEYLLQVHEYKTTDNTTGEKFLTSELKSKDNSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae V85 trav AFYH01079934.1 255 REGASKPEQPSSMEAAEGKEVNLSCTYNLPTNYYIQWYKQTKESLKYLIQTLKNPENDGRYTLTIVEDRKNNTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V84 trgv AFYH01079934.1 5351 DKVTEWDLEKTAIEGDAVTLRCNYTATSTSSPALMWYKQHLSQPLEYLLQVATFNTKANSTGEKFLTSELKSKENSVSLSIPKAELSDSGVYYCALSDTVIQT
Latimeria chalumnae V83 trgv AFYH01079933.1 4146 TEWDREKPAIEGETVTLGCNYTLTKISTNDVVLMWYKQHLTRPLEYLLQVAAHNIKTSSTGEKLLTSELKSKDNSVSLSIPKAELSDSGVYYCALSDTVMQT
Latimeria chalumnae V82 trdv AFYH01079931.1 3639 REGLAKLSQLPYKTTKEGESVQILCKDIDTSEIVQWYKQTPQHSQKGLQLMISGYSDENERFNLTTEKKNQSSTLTVKEVQLGDAALYYCAQSDTVTTAGL
Latimeria chalumnae V81 trav AFYH01079931.1 9651 REGASKPEQPPSMEAAEGKEVNLSCTYTLPLTDYIHWYKQTKESLKHLIQAHSGAPNDGRYTLTIAADRKNSTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V79 trgv AFYH01079930.1 6698 NVTEWDREKTTTEGNTVTMGCNYTLTSISTTNLVVMWYRQHLSRQLEYLLQVATYNTEANSAGEKFLTSELKTEEKLVSLSIPKAELSDSGVYYCALSDTVMQT
Latimeria chalumnae V153 trbv AFYH01119985.1 2648 LCGGAILVTQLPNSLTESSGKLVEMNCTHDYMGTDFYNIFWYQQKRGQGLTLIVYTSIAGDEPKFEPGLEKEFEVTRPDNRNSNLKIKALKLTDSASYLCAVRK
Latimeria chalumnae V152 trbv AFYH01119985.1 4724 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTVSTANMYWYRQYRGQGPELIAYTKTVGSNQTEPGFQDKFEVMRLKTKETSLKIKKLKAADTASYLCAVSK
Latimeria chalumnae V151 trbv AFYH01119985.1 7137 LCDGAVKVTQSPKSLVQMSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTILNSTLKILQLKAADTASYLCAASLTQ
Latimeria chalumnae V150 trbv AFYH01119985.1 8927 FCGGVIHVTQHPNSLTGSTGNPVEINCTHDYTGTDISRMFWYQQKRGQGLTLVVYTVGAEGKPTFERDFEKEFEVKRPDKRNSALTIKGLKAADTASYLCAAS
Latimeria chalumnae V148 trbv AFYH01119984.1 2058 VSGGVIHVTQLPNSLIGTARNTLEINCTHTDTSSAAHRIFWYQQKRGQGLTLIVYTVGAGGNPNFEQDFDKDFNVSRPDNFHSTLKIKELKAADTASYLCAVSK
Latimeria chalumnae V147 trbv AFYH01119984.1 3372 LCGGAILVTQLPKSLTGKPGKPVEMNCTHNDTSSASTVYWYQQYRGQGLTLIAYSITAEENGKPETGFEKEFEVKRPDKQKSILKINKLKASDTASYLCAVSK
Latimeria chalumnae V146 trbv AFYH01119984.1 4742 LCGGAILVTQLPNSLTGRIGNPVKINCTHNFTGADPYSIFWYQQKRGQGLTLIVYTASAGGEPKFESDFEKEFEVTRPDNRNSALTIKGLKAADAASYLCAASK
Latimeria chalumnae V145 trbv AFYH01119984.1 7232 LYSGVIFVTQLPNSLTGGSGKAIEINCKHNDTINTVHRIFWYQQKRGQGLTLIVYTVGAGGNPTFEQNFHNEFNVSRTDNLHSTLKIKALKAADTARYLCAVSE
Latimeria chalumnae V144 trbv AFYH01119983.1 2440 LCGGVIPVTQHPNSLTGSAGKEVNLTCTHHDKGGTNIYLYWYQQKRDQGPRFIAYTFLAGEKPDPETGFEKKFEVTRPNKENSILKIKELEAADTASYLCAASK
Latimeria chalumnae V143 trbv AFYH01119983.1 3898 LCGGAILVTQLPKSLTGRTGSTVNLTCTHDDTSANLIYVFWYQQKRGQGLASISYTSTDGEKGKPEPGFENKFEVTRPDRKESILKIKDLKAADTASYLCAASK
Latimeria chalumnae V142 trbv AFYH01119982.1 53270 LCGGVIHVTQLPNSLTGRTGNEVNLTCTQHDKSGSTIYLYWYQQKRDQGLKLIAYTSFDGENPDQETGFEKNFQVTRPNEENSILNIRELKAADTATYLCAAS
Latimeria chalumnae V141 trav AFYH01118967.1 796 HIVRCKKDSVSQLETTVEVPEEKDLVLNCTYETSDPYNAVLYWYRQTPGESLELLIYADAYGNIHKEKTTDQRFNISLEKEKTTVYLTISTAEVTDSGVYFCALR
Latimeria chalumnae V140 trav AFYH01118967.1 2088 HLTKSQEDSAVQPVSTIKASEEEKLTITCTYNTAYPNNVALYWYRQYAGGSLEYLLHADAYNKIYRGESTEQCFNTSLEKEKKHVFLYINPLQVVDSAVYYCALR
Latimeria chalumnae V139 trbv AFYH01118967.1 6989 CCSRSQKDFVSQTESTMELSEGKGLKLNCTYELAFASNDFGLFWYRQYPGKSLEYLLRALAYDTHDGERTDQRFNVTLEKEKKTVYLYISTVEIADSAVYFCALN
Latimeria chalumnae V138 trav AFYH01118965.1 4120 HSVRSQNDSVSQPVPTVEATEEADLTILCTYTTASAAAGNFGLFWYRQNPGGPLKYLFHADAYDTYREPRTNQRFNMKLEMEEKTVYLNISTVQVADGAVYFCALR
Latimeria chalumnae V137 trbv AFYH01118963.1 710 HNARCKKGSVSQLEPTVEVPEEKDLVLNCTYETSDPYNYAPFWYCQTPGESLELLIYADAYGNIHKEKTTDQRFNISLEKEKTTVYLTISTAEVTDSGVYFCALR
Latimeria chalumnae V136 trbv AFYH01118963.1 5659 DARRTLCPRQSTMELSEGKDLKLNCTYELEFANNNFGLFWYRQYPGKPLEYLLRADSYGTHEREITDQRFNVSLEKEKKAVYLLISTVEIADSAVYFCALS
Latimeria chalumnae V135 trav AFYH01118962.1 526 HSVRSQNDSVSQPVPTVEATEEADLTILCTYTTASAAAGNFGLFWYRQNPGGPLKYLFHADAYDTYREPRTNQRFNMTLEKEKKTVYLNISAVQVADSAVYFCALR
Latimeria chalumnae V134 trdv AFYH01118961.1 207 DSVRSQKDTVSPVASTLKASEEESLTLNCTYETSNPNGAALFWYRQAVSQYLEYLLRITTYGNTVEEISTDGRLKIILEKEKKTVLLNISTAELTDSGMYFCALS
Latimeria chalumnae V133 trdv AFYH01118959.1 6603 KANGDEVFQEDRKVSVQEKQNVTLFCNYTTSDPDPYLFWYFQYPGHSPKYILQRSKHINNKGSGFSGFDARLERNKLFSLNIESAEIKDGAVYYCALR
Latimeria chalumnae V132 trbv AFYH01118959.1 22977 SAGSQKDSVSESSSAMTVLEGDKRTLTCNYETIDTSPNLFWYRQYPGRSLEYLLQVNAFGSAGGENTDERFNTSLEKEQKRVFLNIPSIQITDSAVYFCALR
Latimeria chalumnae V131 trav AFYH01118959.1 25113 PSVRSQKDSASQPASTVLVSEEKDVTLICYFNTSNVNNAAFFWYRQYPGMSLEYLIRVDAYNNVDKGEKAQNRFNISLEKEKTTVYLIISTVQVADSAVYFCALN
Latimeria chalumnae V130 trav AFYH01118956.1 1598 KTNGDQTIQKDSMVQVEEAQNVTLRCNYITTDSDPYLFWYFQRPGHSPKYILQRSKYSNNKESGFSRFDAQLGSEKTFHLNIENVEIEDGAVYYCALS
Latimeria chalumnae V129 trgv AFYH01118954.1 9210 GENKEQVFQRPKMKSLEGFTVEIACRHSISSHQGLYWYKQLPGKGPELVIFGYNMADPVGRFNMSFSDNGKNTSLLISQVQIKDAVTYYCAVM
Latimeria chalumnae V128 trbv AFYH01118954.1 22538 SYASGQENSAFQPTTVVTKSEGDNVTLSCNYTVTTSTPYVFWYHQQPRKPLRYLLHNDFLNKVYLDERHDNRYSGSLEKSHNNASFSISSTKISDAGVYFCAVS
Latimeria chalumnae V127 trbv AFYH01118954.1 33055 GRTRSQKDSVSQKDSTMKISEEQDLSLACTFNTSNIKDSYFFWYRQYQGRSLEYLFQVSAFTHDTGEVPKADNRFKVSLEEEKSTVSLNISTVKITDSAVYFCALR
Latimeria chalumnae V126 trav AFYH01118952.1 1203 GEFSSQVQQLPNVEYVEGHQVEIFCNHSISSYENMYWYQQLPNKPAEVIVYGYSSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V125 trav AFYH01118952.1 2025 GEPTSEVHQLPYIDTVEGLQVKIHCNHSIISYSSMFWYQQLPYKHPEVIISGYDSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V124 trbv AFYH01118949.1 2127 KIKGNVVHQEDSLVYVKEKARVKLACNYTTSDASPYLYWYQQYPGDSFRYILGKNKFSTLDSAPGFSRFDAELGKDNTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae V123 trav AFYH01118948.1 1235 GEPTSEVYQLPYIVSMEGLQVKIHCNHSISNYNNMFWYQQPNRNKPPEVIIYGYDSADPKGRFSMSFNREKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V122 trav AFYH01118948.1 5617 FQGQEEVSQNEIPLTARDGESVQINCTYKVKEYSLQWYKQYPGKAPEFILLRSTSGTDTVGRYKIFLDTSEKYVFLQIHNTTVEDTAVYFCALGTIAQK
Latimeria chalumnae V121 trav AFYH01118948.1 15785 GEPSSEVQQLPDMKLVEGHPVQIHCNHSITSYNSMFWYQQLPNKPPEVIIYGYESADPIGRFSMSFNRDKLETSLIISGTEISDAATYYCAVS
Latimeria chalumnae V120 trav AFYH01118945.1 1158 KIQGDTVFQQDSILTVKEKEDVKLHCNFTTADLSPYLFWYQQYPGDSLKYILRKNKNGIDDKATGFNRFDAQLERDNTIILKIESVEVKDAAVYYCALS
Latimeria chalumnae V119 trav AFYH01118945.1 10341 NANVYQPPGMVKMEGILVEVPCNYSDKNYDFMYWYRQLSRKAPELLTYGIDSAAANGRFSMSFRKTNQETSLIVSGTEIQDSATYFCAVR
Latimeria chalumnae V118 trav AFYH01118945.1 11853 VHGQIEVIQTETFLPTLEGESVQFNCTYQGTEYSLQWYKHYPEKPPQVILLRTTDGYEKSGRNRMFLDSKKKFGFLQINNTSVEDTATYFCAVGTVAQN
Latimeria chalumnae V117 trbv AFYH01118945.1 26872 KIKGNVVHQEDSLVYVKEKASIKLACNYTTSNASPYLYWYQQYPGDSLKFILHKNKHSSLDSAPGFSRFDAELGKDDTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae V191 trav AFYH01120012.1 6137 HGEIVQVTQTPTSLYLNASDSTLIQCKQDSNKLNMFWYQQHKREGLKLISYVSVASEGNATKYEPGFTSRFHIRSQGNYAGSLKISNLIAEDSAVYFCAVG
Latimeria chalumnae V190 trbv AFYH01120012.1 8872 DVQAVEVTQTPTSLYKRVGDSSEMQCQHGDSNKNNMLWYQQNPGTGPKLIRYAIATSKATNEKDFPEHKFEIVKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae V189 trav AFYH01120012.1 10235 RGEVVQVTQTPTSSHLNTGESTEIQCEQKVNKNTMYWYQQRKREGLKFISYVNVLTKGNATQYEPGFTSRFHIWSRKNKAGSLKISNLTAEDSAMYFCAVG
Latimeria chalumnae V188 trbv AFYH01120012.1 17574 DVQAVKVTQTPASLYKRVGDSSEMQCQHNDSSKDTMLWYQQNPGTGLKLIGYSVVTNKAITESDFPEEKFQIVKETVQKGSLTVDNLQAADSAVYFCAVS
Latimeria chalumnae V187 trav AFYH01120012.1 18745 HGEIVQVTQTPTSLYLNVGGSTEIHCEQDSSKQNMYWYQQCKREALKSIGYIDVLATSGDARNEPGFTSRFEITRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V186 trbv AFYH01120012.1 21047 DVQAVEVTQTPASLYKRVGELSKMQCQHYDSSKINMLWYQQNSGAGPKLIGYASGTSEATNENEFPKEKFEIAKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae V185 trbv AFYH01120011.1 677 DVHTLEVTQTPTSLCKRVGDLSEMQCQHGDSNKDTMLWYQQNPGTGPKLIGYASGTSEAINEKDFPEDKFQIVKETDVKGSMIIQNLTAADSAVYFCAAS
Latimeria chalumnae V184 trav AFYH01120011.1 2512 HGEDVQVTQTPTSLYPNAGDSKEIHCEQKLNKNYMYWYQQRKREGLKLISYVNVVSVGDATKYEPGFTSRFHIRSKGNDAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V183 trbv AFYH01120010.1 129 RGEDVLVTQTPTSLYLNASDSMEIHCKQDSSKTKMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGKYEGSLKISKLTAEDSAVYFCAVG
Latimeria chalumnae V182 trbv AFYH01120010.1 6578 NVHTLEVTQTPTSLHKRVGGSSEMQCQHGDSNKNNMLWYQQNPRTGPKLIGYAIATSKATNEKDFPEDKFQIVKETAMKGSLTIKELTAADSAVYFCAAS
Latimeria chalumnae V181 trav AFYH01120010.1 7809 YGEDVQVTQTPTLLHPNAGNSMEIHCEQTLKKQTMFWYQQHKEEGLKFISSVNVLTKGDATQYEPGFTSRFHIRSKGNYAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V180 trbv AFYH01120009.1 1496 DVQAVELTQTPASLYKRVRDASKMQCQHNDNTKNTMLWYQQKSGTGPKLIGHAIGTSEATNEKDFSKDKFQIVKETDVKGSLTITELTAADSAVYFCAVS
Latimeria chalumnae V179 trav AFYH01120008.1 26 RGEVVQVTQTPTSLHPKAGDSTEIHCEQKLNKDNMYWYQQRKQEGLKFISSVLLASIGEATQYEPGFTSRFHIRSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V178 trav AFYH01120007.1 71 RGEILQVTQTPASLHPKAGDSTEIHCKQKLNKDYIYWYQQRKREALKSIGYINVLATSGDARNEPGFTSRFEIMRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V177 trbv AFYH01120006.1 962 NCRTLLADQSPPSVYNSTGGSVEVRCEPTDKSYLNMFWYQQQAEGPKLIGYTLSSQSATYEDKDSFNSPKFEIRKRDSDLKGSMKISDLKIEDSGVYFCAVN
Latimeria chalumnae V176 trbv AFYH01120005.1 1011 DCLTLLANQSPPSVYNSMGGSVEVRCEPTDKSYRNMFWYRQQAEGPKLIGYTLSSQSATYEDKDGFKSPKFEIRKRDSNLKGSMKISDLTIEDSGVYFCAVN
Latimeria chalumnae V175 trbv AFYH01120004.1 1185 DCQTLLANQSPPSVYNFTGGSVEVRCKPTDKSYAYMFWYRKQAEGPKLIGSTASSQDPVYEDGFNSPKFEIRKRDPDLKGSMKISELKVEDSGVYFCAVS
Latimeria chalumnae V174 trbv AFYH01120004.1 4489 ECLNLLANQSPLSVYNSTGGSVEVDCKPTDKSYAYMFWYRKQAEGPKLIGSTASTQDPVYEDGFNSPKFEIRKRDSDLKGSMKISELKVEDSGVYFCAVS
Latimeria chalumnae V173 trbv AFYH01120002.1 657 HCQTVLVTQSPSSVHKNAGKEVEIDCQHNKNDYYYMYWYQQRRAEGIKLIGHTYETQEAKHEDGFNSSKFQIPQRDQVEKGSMKIMDLGAGDSAVYFCAVSK
Latimeria chalumnae V172 trav AFYH01120002.1 4033 RGEIVQVTQIPASLHPNASDSTKIHCAQDSNKQYMYWYQQRKWEGLKSIGRIYMVGTGGDPEYEPGFTSRFEIMRTDSKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V171 trav AFYH01120001.1 412 HCQTVLVTQSPSSVHKNTGNEVEIYCQHNKSDYVYMYWYQQRRAEGIKLIGNTYMTNEAKHEDGFNSSKFQISKRDQVEKGSMKIVDLGAGDSAVYFCAVSE
Latimeria chalumnae V170 trav AFYH01120001.1 1914 HGEVVQVTQTPTSLYPNASDSTEIYCKQDSSKLNMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGSFVGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae V168 trav AFYH01120001.1 7809 RGEIVLVTQTPTSLHPNAGNSMEIHCEQDSSKQYMYWYQQRKREGLKFIGRIYTATKSEDLHHEPEFIMRFEITRIDSKVGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V167 trbv AFYH01119999.1 905 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDSSYPTMLWYQERRGEGPKLIGSGYSTQEPTYENKEGFEPPKFEIKKETAVKGSLRIQSLTAADSAVYFCAVS
Latimeria chalumnae V166 trbv AFYH01119997.1 1253 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDTSYLNMLWYQKRRGEGPKLIGSGYSTQEPKYEKKEGFEPPKFEIIKETDVKGSLTIQKLTAADSAVYFCAAS
Latimeria chalumnae V165 trbv AFYH01119996.1 2380 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDASYNTMVWYQKRRGEGPRFIGYAYLSQPPEYEKKEGLEPPKFEIKKDKNNLNGSLTITELTAADSAVYFCAVS
Latimeria chalumnae V164 trbv AFYH01119995.1 559 LCDGAVKVTQSPKSLAQTSGKLAEITCNHSESTYYNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLQAADTASYLCAASLTQ
Latimeria chalumnae V163 trbv AFYH01119994.1 730 VSGGVIHVTQLPNSLIGTPRDTLEINCTHMDTSNSVHSIFWYQQKRGQGLTLIVYTDSADGEPKFELDFKEKFEVKRPDDLNSTLKIKELKASDTASYLCAVNE
Latimeria chalumnae V162 trbv AFYH01119994.1 1808 LCDGAVKVTQSPKSLAQTSGKLAEITCNHSESTYYNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLQAADTASYLCAASLTQ
Latimeria chalumnae V161 trbv AFYH01119993.1 770 LCGGKILVTQLPKTLIGTVGNSVEMNCTHNDTSVSATMYWYRQYGGQGLELITYTLAGGSNQTEPEFKEKVEVKRLNSKQTSLKIKELKAADTASYLCAVRE
Latimeria chalumnae V160 trbv AFYH01119992.1 1345 LCDGAVKVTQSPKSLAQTSGKLAEITCKHNESSYYNMYWYRQYSGQGLTLILTSVFQGTTTFEDGFKEGFQVERPTLLNSTLKILQLKAEDTASYLCAASL
Latimeria chalumnae V159 trbv AFYH01119991.1 945 LCGGTTLVTQLPKTLIGTVRNSVEMNCTHNDTVSTARMYWYRQYGGQGLELITNTVSVGSNQTEPEFKEKVEVKRLNTKQTFLKIKELKASDTASYLCAVRE
Latimeria chalumnae V158 trbv AFYH01119989.1 1406 LCGGAIIVTQQPNSLTGGTGNPVEMNCSHDFTGADPYNIFWYQQKRGQGLTLIVYTYGAQGKPSFEQDFEKEFEVTRPDNRNSALTIKGLKAADTASYLCAASK
Latimeria chalumnae V157 trbv AFYH01119988.1 1945 LCDGAVKVTQSPNSLVQTSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLTVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLKAADTASYLCAASLTQ
Latimeria chalumnae V156 trbv AFYH01119988.1 3698 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTSSTATMYWYRQYRGQGPKFITYTLADGSNQTEPEFKEEVVVMRLNTKETSLKIKKLKASDTASYLCAVSE
Latimeria chalumnae V155 trbv AFYH01119986.1 98 LCGGAIIVTQQPNSLTGRTGNPVEMNCSHDYMGADPYSIFWYQQKKGQGLTLIVYTYGAQGKPSFEQDFEKEFEVIRPDNRNSALTIKGLKAADTASYLCAASK
Latimeria chalumnae V229 trgv AFYH01221042.1 6904 VSITLEQTQQSVTKSVNSIARLPCKFQGVSYIHWYILRPNEALQRILYYESEAKGENDQGFSNVRFQAEKISDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae V228 trgv AFYH01221041.1 43 NLTAVTLNQLEPSITKTPERTAKFTCSVSGVANLDNAIIHWYRARADQAPERILYYSSGRAVHDEGFSKAKYSAEKDNNFILRLSNVAEEDNGYYYCAYWD
Latimeria chalumnae V227 trgv AFYH01221039.1 1515 GTVTLEQPEASITKTLGKIVRLTCRVSGVSVVDAAIHWYRDRPSEGMKRILYYSTQVNHDSGFTKDRFAAEKDGGSCSLIIPSVIEDDSGDYYCAYWD
Latimeria chalumnae V226 trgv AFYH01221037.1 1898 RCSGFSLRQPDQYKLVRASRNARIECRMEGGSIQDKYIHWYWQQEGKELEWILYFKSQTERDTLAGLPARFTVGKNTRNNACVLTVSNTKEEDSATYYCAAWEA
Latimeria chalumnae V225 trgv AFYH01221033.1 4066 GIVAVTSDKIVSVTKGEGKTAEIICRVSASSSYIHWYRQEDGKAPERYVFYEKTSGDSGTTLKSASSKTVEVRNLGDNKFSLKIFSTTESDTGMYYCASWD
Latimeria chalumnae V224 trgv AFYH01221033.1 9499 GVVSVKLEQPKLSETKLSGKSVQISCKADELANNYIHWYRHLVGEGPTRILYFDKSSTNPTAINDQGFPSDKFDILKREENQYILKIHSAKESDSGMYYCASWD
Latimeria chalumnae V223 trgv AFYH01221033.1 13354 GVDAVPFHQPLSVIKPETKTAEISCSEASSSYIHWYRHRDGEAPTRILYLDSSNDNVNRDSGFSAAKYESLKPGNNKYILKIHTAEESDSGMYYCARWD
Latimeria chalumnae V222 trgv AFYH01221031.1 488 GIVAVTSGKKMSETKIEGKTAEVTCEVEDTSYNYIHWYRQLDGKALERILYYEKDSKDSGATRDPGFKKTVEVDNLPNKTYSLKIHAAEESDTGMYYCARWD
Latimeria chalumnae V221 ighv AFYH01211826.1 13129 EPQIRQLPRILQQKPGGTLSIECKLSGKSSHPYNVFWLRQYPGQKLEFFIRYNTEADKYIVSGFEARFLPSKNISTNVYYLKIKDLRVEDSATYYCTHYALS
Latimeria chalumnae V220 ighv AFYH01191464.1 520 LTRSGPEVRKPGESLKLECAVRGFDVNSYWMAWICQAPGKGLEWLASIGGRSSTKYHSQSIQGRFHASKDFSNHIFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V219 ighv AFYH01191461.1 6277 VQSAIVLKESGGDIKKPGESLRLSCKTSGYTFDDYALSWIRQPPGKGLEWVGVIYTDTGDTAYSQSVQGRFTITMDVPSSSGFLQMNSLRAEDTAMYYCARE
Latimeria chalumnae V218 ighv AFYH01191460.1 97 LTQSGPEVRKSGESLKLKCAVSGFDINSYVLAWIRQDPQKGLEWLVSYKSSSDNVYSCLIQGRFISSKDSSNFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V217 ighv AFYH01191459.1 3193 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYAMHWVRQPPGKGLEWIAFISYPSGSTTHYSQSVQGRFTVSRENSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae V216 ighv AFYH01191456.1 6931 IQSAVNLIESGGDVKKPGESLKLSCKGSGFTFRSSYLHWLRQPPGKGPEWVAYISTDSSPIHYAQSVQGRFTISRDDSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V215 ighv AFYH01191455.1 13453 IQSDVILTASGGDVKKPGESLRLSCKASGFDFSSYYMHWFRQPPGKGLEWVGRISDGSGSSKLYSQSVQGRFTISRENSNSMLHLQVNSLKVEDTAMYYCARE
Latimeria chalumnae V214 ighv AFYH01191455.1 19168 IQATVNLTESGGDVKKPGESLKLSCKASGFSFSSHWMHWVRQPPGKGLEWLAYISGPSGSTKRYSQSVNGRFTISRENSKKMLHLQMDSLRVEDTAMYYCARE
Latimeria chalumnae V213 ighv AFYH01191454.1 4024 IQADVVLTESGGDVKKPGESLRLSCKTSGLDLDSSNIEWIRQPLRKGLEWVAEIDYDGDTYYTQSVQGRFTISREVSSSMVYLQMNSLTVEDTAMYYCAGE
Latimeria chalumnae V212 ighv AFYH01191453.1 2094 IQSDVILTESGGDVKKPGESLKLSCKASGFDFSSYWMYWFRQPPGKGLERVAGISSPSGSTTHYSQSVQGRFTISRDNSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V211 ighv AFYH01191453.1 7246 IVLTQSGPEVRKPGESLKLECAVRGFDVNSHWMDWIHQAPGKGLEWLASIGSRSDTEDHAQSIQGRFQASKDFSNHIFYLQMNSLKVEDTAMYYCAGE
Latimeria chalumnae V210 trgv AFYH01131030.1 2528 GVTAVTLEQPKLSITKASGKTAQIICKMSGVPLSAAIHWYYGKPGEELKRIMFHSTSITHDLGFRKEKFTSDKTDGSCTFIIHNIAEEDSATYYCAWWD
Latimeria chalumnae V209 trgv AFYH01131029.1 1440 GVVSITLEQPELSVTKSVTRTVKLSCRFQGVSIIHWYILRPNEALQRILYYESAAKNGYDQGFNNMSFRAEKKNDECFLVIYNLEMSDTATYYCARWD
Latimeria chalumnae V208 trgv AFYH01131029.1 5029 VSITLEQTQLSVTKSVKRTARMQCEFQGVSKIHWYRLRPNEAPQRILYYESEREKKYDEGFSNVRFQAEKNNDECFLYIHSLEASDTAMYYCAGWD
Latimeria chalumnae V207 trgv AFYH01131029.1 8598 MSITMEQTQLSITKSVTRTAKLSCRFQGSSYIHWYRLRPNEALQRILYYESEAKSEYDAGFSNMKFRAEKNNDECFLYIHSLEMSDTAMYYCAGWD
Latimeria chalumnae V205 trbv AFYH01120032.1 2390 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNYIYWYRQTLTRGFQLMGMYFRATKELTPEDGFNKTEYEVMEPQSKLIVLRIVSVKPEDTVRYFCAAS
Latimeria chalumnae V204 trbv AFYH01120030.1 424 VCSGVLVSQWPSSITERVGASVKIHCYQNETDHDWIYWYRQTLTQGFQLMGRYTRASKELTPEDGFNKTEYEVTEPQNKLIVLQIVSVKPKDTARYFCAAS
Latimeria chalumnae V203 trbv AFYH01120029.1 744 VCSGVLISQWPTSVTERVGASVKIQCYQNETDHDYIYWYRQTPTRGFQLMTYYNRLSKQLTPEDGFNKTEYEVTEPQNKLVVLRIVSVKPEDMARYFCAAS
Latimeria chalumnae V202 trbv AFYH01120028.1 173 VCSGVLISQWPTSITERVGASVEIHCYQNETDHDYIYWYRQMLTRGFQLMVWYHRATKKLTPEGGFNKTEHEVMEPQSKLVVLRIVSVKPEDTARYFCAAS
Latimeria chalumnae V201 trbv AFYH01120026.1 841 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNFIYWYRQMPTRGFQLMGMYYRATKELTPEDGFNKTEYEVTEPQSKLIVLRIVRVKPEDMARYFCAAS
Latimeria chalumnae V200 trbv AFYH01120024.1 936 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSYMYWYRQDRQEGLRLLFYSVAQGNVEKSDDPPSRFSAQRPSTKSFPLNVTKVESEDTAVYLCASSL
Latimeria chalumnae V199 trbv AFYH01120024.1 3605 YSDALHVEQSPRASYILVSGHIELHCTQSGSQSGMYWYQQRRGEGLKLIGHNTNTGEPTLDKNFPSSRFQILRKETIGKGSLKISNLTAADTAVYFCAFG
Latimeria chalumnae V198 trbv AFYH01120018.1 952 VADATTIEQNSTTLWVKGSTASLYCRQSSDDMNMFWYRQYRNAGLDLIFHSVTGSNIQQFNNISARFSPSRPNPETLTLTITDLQPEDTAVYFCASS
Latimeria chalumnae V197 trav AFYH01120015.1 214 HGAIEQVTQTPTSLHPNAGGSMEIQCKQDSNKQFMYWYQQHKREGLKLISYVSVVSEGDATQYEPGFTSRFHIRSKKNMAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V196 trbv AFYH01120015.1 1568 HGAIEQVTQTPTSLHLNTGNSTLIHCKQDSTKPNMYWYQQRKREGLKLISYVSVVSKGDATQYEPGFTSRFHIRSQGNMEGSLKISSLTAEDSAVYFCAAG
Latimeria chalumnae V195 trbv AFYH01120014.1 1129 DVQAVEVTQTPASLYRRVRESSKMQCQHNDSTKFYMLWYQQNPGAGPNLIGYASGTSEATNENEFPKEKFKIAKETATKGSLTIKELTAADSAVYFCAAS
Latimeria chalumnae V194 trbv AFYH01120013.1 524 HGAIEQVTQTPTSLYPNAGDSTEIHCKQDSNKDTMYWYRQRKREGLKFISYVSVVSEGDATKYEPGFSSRFHIRSKGNFAGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae V193 trbv AFYH01120012.1 981 RGEIVEVTQTPASLHLNVGNSMEIHCKQDSNKEYMYWYQQRKREALKYIGRIDVSVASGDAQYEPEYSSRFEITRGESKAAYLKISNLTAEDSAVYFCAAS
Latimeria chalumnae V267 ighv AFYH01289472.1 621 VQSAVVLTQSGAEVKKPGESLKMSCETSGYDYTSSYIHWIRQPPRKGLEWIGRIDCGSGSSVYQQSFQGRFTISEDVSLSTAYLQINRLTVEDTAMYYCARA
Latimeria chalumnae V266 trgv AFYH01287628.1 501 GVVSITLKQPQVSVTKSVTRTAKLHCKFQGVSYIHWYRLRPNEAPQRILYYESEAKSEYDQGFRNTRFIFQIKNDECFLYIYSLEMSDTAIYYCAGWE
Latimeria chalumnae V265 ighv AFYH01282515.1 3200 VQSDVVLTQSGAEVKKPGESIKLSCKTSGYSYTSSYLHWIRQHPQNGLEGIVRIDTGEGKGDFHQSFQGRFTISEDVSSATAFLQISSLRVEDTAMYYCARE
Latimeria chalumnae V264 ighv AFYH01280065.1 364 VQPVILLTQSAAEVKKPGETIRLSCKPSGYTLTCCSVHWVRKIPGKGLEWIGYQIFKGGSGYHQSFQGIFTISEDVSLTTTYLQINSLRAEDTAMYYCTRGVQG
Latimeria chalumnae V263 ighv AFYH01278532.1 1391 IQSAVILTESGGDVKKPGESLRLSCKASGFDFSGYYMGWVQQPPGKGLEWVSTISGPSGSDKYYLQSVQGRFTISRENSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V262 ighv AFYH01278194.1 2575 IQSDVILTESGGDVIKPGESLRLSCKASGFTFSSNWMAWVRQPPGKGLEWVLGIDTDGSRAYYSQSVQGRFTISRDNSNSMLYLQMNNLRAEDTAMYYCAKD
Latimeria chalumnae V261 ighv AFYH01274082.1 607 CQSLHQSPSSICQSEGGEAKLKCVLKGSSNPNLYWYRQLPSREIQLIAYSVTKGSIAENNLPHFTVARPEDTEFTLETQHLQLNDTAVYYCAWSS
Latimeria chalumnae V260 trbv AFYH01274081.1 398 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSYMYWYRQDRQKGPWLLFYSLAQGNVEKSDDSPTRFSAQRPSTKSFPLNMTKVESGDTAVYLCASRL
Latimeria chalumnae V259 ighv AFYH01273974.1 1936 VQSAVVLTQSAEEIKKPGDSFRVSCKTSGFSLTSYGVGWIRQPIGKGLEWLAIIFWNANTRYSSSIQGRFTISRDTSSSTVYLQMNNLKVEDTAMYYCARE
Latimeria chalumnae V258 trgv AFYH01271172.1 539 VSITLEQTQLSVTKIVNRNVRLQCKFQGVSKIHWYRLRPNEALQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYIYSLEMNDTDTYYCAGWD
Latimeria chalumnae V257 trgv AFYH01271169.1 388 VSMTLKQPQVSVTKSVTKTVKLHCKFQGVSYIHWYRQRPNEALQRILYYESEAKSEYDQGFSNTRFKSKKKDDECFLYIYSLEISDTAIYYCAGWD
Latimeria chalumnae V256 ighv AFYH01271127.1 1805 VQSAIVLNQSGDEVKKPGESIRLTCRTSGYTHTNYDIHWSRQPPGKGVEWIGRINSGSGSSRYQQPFRERFRISEDVSSSTAYLYISSLRVEDTAMYYCAREPNMA
Latimeria chalumnae V255 igkv AFYH01270251.1 673 SRGQITVTQSPSSKSVLPGESITIACRTSSSVSSWMSFYQQKPGQAPKLLLNRVSRSESGVSNRFSGSGSGTDFSFTISNVQTEDAGDYYCLQGY
Latimeria chalumnae V254 ighv AFYH01268357.1 277 IQSEVILKESGGDIKKPGESLRLSCKGSGFTFSGYALSWVRQPPGKGLEWVAFIHTASSPIYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARR
Latimeria chalumnae V253 ighv AFYH01268027.1 776 VQSAVVLTQSAAEVKKPGDSLRLSCKTSVFSLTSSPNTVSWIRQPIGKSLEWLALIYWDADTSYLSSIQGRFTISRDASSSTVYLQMNSLTVEDTAMYYCARR
Latimeria chalumnae V252 ighv AFYH01267210.1 4880 IQSEVILTESGGDVKKPGESLRLSCKASGFTFRSYYMHWVRQPPGKGLKWVLAISSGSGSSTWYLQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAIYYCARE
Latimeria chalumnae V251 ighv AFYH01257144.1 891 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYWMAWIRQPPGKGLEWIAYINTDGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V250 ighv AFYH01257141.1 1498 LTQSDPQVGKPGESLKLKCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHSSSSNYYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARL
Latimeria chalumnae V249 ighv AFYH01257139.1 1303 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYYMHWIRQPPGKGLEWIAYISGSGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V248 ighv AFYH01257135.1 1955 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYYMNWVRQPPGKGLEWVAIIYTGSSSIYYTPSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCAGD
Latimeria chalumnae V247 trav AFYH01245180.1 10979 KGCLAKLNQPPDTAVMEGETAEIQCDGVATVDYVYWYKQYLHQSPEHIINGFEKTEEKGRFILQINKTSQFCTLSISGVNVGDAALYYCAVS
Latimeria chalumnae V246 trav AFYH01245177.1 6501 KCCLAKLNQPPDTVVMEGETAEIQCDGVARADTIFWYQQYLHRSPEHIINGYENPEEKGRFILQINKTSQFCTLSIRGVNVGDAALYYCAVS
Latimeria chalumnae V245 trav AFYH01245177.1 12628 LCLGDSITEEHKVLQVTEGQVANFTCRYNMSAAVSETLQWYIQPFNGALKNILQRFKSSSEDLKADGIGDRFSSSLDPTKRLTTLTITDAQMSDAGTYYCALS
Latimeria chalumnae V244 trav AFYH01245173.1 6611 CLAELTQPPKKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLLHEYNEDVEQKQYTLKINKTSQFCTLSIRGVNVGDAALYYCAVSDTVT
Latimeria chalumnae V243 trdv AFYH01245173.1 12754 LCLGDSITEEHTDLQVTGGQAANVTCRYNISAGYDETLQWYIQPFNGAPKYILQRFKSSSEDLKADGIGAQFSSSLDTAKRLTTLTITDAQMADSATYYCAL
Latimeria chalumnae V242 trav AFYH01245173.1 18032 CLAELTQPPEKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLIQGYNTDVEQKQYTLKINKTSQFCTLSIRGVNVGDTALYYCAVSDTVT
Latimeria chalumnae V241 trav AFYH01243276.1 17725 CLAKLAQPPETVVKEGETAKIQCDDVDTSETIFWYQQYPYQKPKYLISAFKNKKEEKPFKVEINITSNFCTLSIRGVNVGDAALYYCAVSDTV
Latimeria chalumnae V240 trav AFYH01243275.1 3848 CLAELTQPPDKSVMEGKTAEIQCDGVATADIVFWYKQHPRRGPEFLIYEYSVLEEGGQYDLKRNKTSNFCILSIRGVNVRDTALYYCAVSDTVT
Latimeria chalumnae V239 trav AFYH01243273.1 18578 CLAKLTQPPESTVREGETAEIQCDGVASNDNIFWYKQHPHKRPEFLISGYSDMEKRDQYTLKINKTKQFCSLSISGVNAGDASLYYCAVSDTVT
Latimeria chalumnae V238 ighv AFYH01243054.1 597 LTQSNPQVRKPGESLKLQCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHTSSNNYYSSSIQGRFTASKDSSSFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V237 ighv AFYH01243053.1 5524 LTQYGQEVRNLGESMKLKCTISGFKPDSYWMAWICQAAGKELEWLIYYLRAADANHYFCSNQGRFTASKDSSSFYLQMNSLKVEDMAMYYCARA
Latimeria chalumnae V236 ighv AFYH01243052.1 3343 VQSAIVLTQSGAEVVKPGESVRLSCKISGFSLTSSPNTVGWVRQSIGKGMEWLTQIYWDASSNSAPVQGTFTISRDTSTNTVYLQMNSLRTEDTAMYYCEKGNYNSG
Latimeria chalumnae V235 ighv AFYH01243050.1 353 IHSQVNLTESGGDVKKPGETLRLSCKASGFTFSSYYMSWIRQPPGKGLEWIASISSGGGSTGYLQSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V234 ighv AFYH01243044.1 37 IQSQVNLTESGGDVKKPGESLKLSCKASGFTFSSYTMCWIRQPPGKGLEWIAYITGSGSTGYFQSVQGRFTASRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V233 trgv AFYH01243044.1 7838 IQSDVTLTESGGDIKKPGESLRLSCKASGFTFCNYLMHWIQQPPGKAIEWVAYISTGGVSTSYLQSVQGRFTISRDNSNNMLYLQMNSLRVEHTAIYYCAGD
Latimeria chalumnae V232 ighv AFYH01243040.1 5612 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYAMNWVRQPPGKGLEWVAFIHTSSSSRYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V231 trgv AFYH01221042.1 43 GLAAVTLKQLELSITKPPQRIAKISCQVSDISDIDRAVIHWYRAKADQAPERILYYSSEVKYDPGFTKVKYSANKANDIFSFVVDNVAEEDNGYYYCAYWD
Latimeria chalumnae V268 trav AFYH01289906.1 26 YGEDVQVTQTPTLLHPNAGNSMEIHCEQTLKKQTMFWYQQHKEEGLKFISSVNVLTKGDATQYEPGFTSRFHIRSKGNYAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V230 trgv AFYH01221042.1 3921 VSITLEQTQLSVTKSVNSIARLRCKFQGVSYIHWYRLRPNEALQWILYYESATKKEYVEGFSNMRFKADKSGDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae V206 trav AFYH01120032.1 631 SVSDSIVQPQPSLTAEEKDPVSIQCFQKNTDYPSMFWYRQVGVQGLQPIISAYRKGDPEISPEFEERVSAERGDDNSYPLTIKRVEKTDLAVYYCAASDGTQQEEG
Latimeria chalumnae V192 trbv AFYH01120012.1 4683 RGEIVEVTQTPTSLHLNVGNSTEIHCKQDSNKDYMYWYQQRKREALKYIGYIDVLVASGDAQYEPEFSSRFEITRGESKAAYLKISNLTAEDSAVYFCAVR
Latimeria chalumnae V169 trav AFYH01120001.1 6481 RGEVVQVTQTPTSLHLNTGKSTEIHCEQKLNKNYMYWYQQHKREGLKLISYVSVVSEGDATQYEPGFTSRFHIRSQENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V154 trbv AFYH01119985.1 56 LCSGAILVTQHPNSLTGRTGKPLEMNCTQTDTSSTATIYWYQQYRGQGLTLIVYTVGVTGTPYFEQNFTKHYEVMRSDKAHSTLKIKALKATDTASYLCAASK
Latimeria chalumnae V149 trbv AFYH01119985.1 12380 LCGGAILVTQHPKSLTGRLANTIEMNCRHSETSDSIYRMFWYQQKRGQRLTLIANTYITGDKLDIEQDFKKEFEVMRSDNRNSNLKIKTLKAGDTASYLCAVGG
Latimeria chalumnae V116 trav AFYH01118945.1 28188 GDSSSQVDQLPAIESVEGYPVKIPCNHSISNYNNMIWYQHLPNKPPKVIVYGYNSAAPNGRFNMSFNRDNPKMFLIISGTEISDAATYYCAVS
Latimeria chalumnae V80 trgv AFYH01079931.1 14694 NVTEWEREKTTTEGDTVTLGCNYTLTSISTNNLALMWYKQHVNQPLEYLLQVTKYRLKENSTGEKFTSELKTEENSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae V78 trav AFYH01079929.1 1026 REGACKPEQPPSMEAAEGKEVNISCTYALPTSDYIHWYKQTKESLKHLIQAHKGTPNEGRYILTTAEDRKNNTLTIRNVGLQDTAVYYCVAAAQ
Latimeria chalumnae V43 igkv AFYH01277020.1 307 VQSAIILTQPGAEFKNSGDSVRLSCKTSGYTYTSDYLHWIRQSPENGLEWIVKINTGSGNGDFHPSFQGRFTISQDVSATTAFLQIHHLRLEDTAMYYCATDQIWG
Latimeria chalumnae V40 trav AFYH01273693.1 6209 RGEIVQVTQTPASLHPNTGNSTEIHCKQISNKNTMYWYQQHTREALKCIGQIYLPGTGGDPVYESGFTSGFQITRIDSKAGSLKISNLTAEDSAMYFCAVG
Latimeria chalumnae V7 ighv AFYH01079853.1 2809 VQSGVVLTESGGDIKRPGESLTLTCKTAGYTFSYHHLHWVRQPPGKGLEWVGVRYMNSGNTHFDQSVQRRFTMDIDVPSHSLFLYMNSLRVEDTAMYYCARE
Latimeria chalumnae V2 ighv AFYH01079848.1 3977 LTQFGPEARKLGESLKLKCAISGLDVNSNWMDWIRQTPRKGLEWLARIGSRSDTEYHSQPIQGRFRASKDFSNNVFYLQMNSLTVEDTAMYYCTRHSQ
Latimeria chalumnae Vs593 igkv AFYH01182563.1 10390 SSGQITLNQSPASKSVSPGESVTIACKASSSVSSSYFHWYQQKPGQAPNLLLYSTSSRASGVPSRFTGSGSGTDYSLTISNVQVEDAGDYYCQEGSSWP
Latimeria chalumnae Vs1717 trgv AFYH01221042.1 350 GLAAVTLKQLELSITKPPQRIAKISCQVSDISDIDRAVIHWYRAKADQAPERILYYSSEVKYDPGFTKVKYSANKANDIFSFVVDNVAEEDNGYYYCAYWD
Latimeria chalumnae Vs1380 trav AFYH01120032.1 953 SVSDSIVQPQPSLTAEEKDPVSIQCFQKNTDYPSMFWYRQVGVQGLQPIISAYRKGDPEISPEFEERVSAERGDDNSYPLTIKRVEKTDLAVYYCAASD
Latimeria chalumnae Vs1709 trgv AFYH01221033.1 9815 GVVSVKLEQPKLSETKLSGKSVQISCKADELANNYIHWYRHLVGEGPTRILYFDKSSTNPTAINDQGFPSDKFDILKREENQYILKIHSAKESDSGMYYCASWD
Latimeria chalumnae Vs1275 trav AFYH01118939.1 3604 KSKEDSVNQLEVEQVVFEGKTTIINCSFTTAQAYPYLFWYVQYVNEAPQYLLRRDRNSEDNAPRFKDRFSATLDNEKKTVPLLINNAQIFDSAVYYCALR
Latimeria chalumnae Vs1882 igkv AFYH01270251.1 962 SRGQITVTQSPSSKSVLPGESITIACRTSSSVSSWMSFYQQKPGQAPKLLLNRVSRSESGVSNRFSGSGSGTDFSFTISNVQTEDAGDYYCLQGY
Latimeria chalumnae Vs267 ighv AFYH01079853.1 2810 VQSGVVLTESGGDIKRPGESLTLTCKTAGYTFSYHHLHWVRQPPGKGLEWVGVRYMNSGNTHFDQSVQRRFTMDIDVPSHSLFLYMNSLRVEDTAMYYCARE
Latimeria chalumnae Vs419 trbv AFYH01119975.1 785 ADSAAVIHQTPKSISEPVGATVRLNCSVEGESDPYMYWYRQSPYGKPELLIFSYGANSVDDKDNPAKHFTASRPDGRNFNLETPNLRANDTAVYYCAWS
Latimeria chalumnae Vs413 trdv AFYH01118930.1 4367 KGSVFGDSVTQPENSLSVSEGGSVKLDCSYSTGHSNPDLYWYRQLPDGTLQFILYRDNSRRKDADFTKGRFLADQTDPQKSFPLTISNVEKGDALMYFCALR
Latimeria chalumnae Vs1420 trgv AFYH01131029.1 5327 GVVSITLEQTQLSVTKSVKRTARMQCEFQGVSKIHWYRLRPNEAPQRILYYESEREKKYDEGFSNVRFQAEKNNDECFLYIHSLEASDTAMYYCAGWD
Latimeria chalumnae Vs594 igkv AFYH01182564.1 5495 FNSQIAMEQSPLTSSVIPGETVTIKCKASSGINNDIAWYNQKSGQKPKLLIYAASTRASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae V36 ighv BAHO01236174.1 16593 SQSVRQSPSYIVQSEGESARLECTFQGNTNPYMYWYRRAATGGIQLVSLSVDATATTENMLQHFKAKRSSSEDFLLTTERLQLDDTAVYYCAWS
Latimeria chalumnae V35 trbv BAHO01236174.1 14876 GLCQTVHQSPAIIVVSGNPVSLHCYQAGSSSSSYMYWYRQYPKKGLELILTSVYLSGDTVSPEFEGRFSSKRPDQRNCSLEITTLKSEDSAIYFCASS
Latimeria chalumnae V34 igkv BAHO01217482.1 1719 SNSQITMEQSPLTSSVIPGETVTIKCKASSGIDDYIAWYQQKSGQKPKLLIYAASTRASGISSRFSGSGSGTDFTLTISNVEAEDSGDYYCQHCYSFP
Latimeria chalumnae V33 igkv BAHO01217478.1 6832 SSSQTTMEQSPLTSSVIPGETVTIKCKASSGIGDNIAWYQQKSGQKPKLLIYETTARASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYCQQYNSWP
Latimeria chalumnae V32 igkv BAHO01217471.1 4386 FNSQIAMEQSPLTSSVIPGETVTIKCKASSGINNDIAWYNQKSGQKPKLLIYAASTRASGISSRFSGSGYGTDFTLTISNVEAEDSGDYYC
Latimeria chalumnae V31 igkv BAHO01217470.1 21740 SSGQITLNQSPASKSVSPGESVTIACKASSSVSSSYFHWYQQKPGQAPNLLLYSTSSRASGVPSRFTGSGSGTDYSLTISNVQVEDAGDYYCQEGSSWP
Latimeria chalumnae V30 igkv BAHO01217470.1 4636 SRGDITMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQKPKSLIYDSVKRYTGVSSRFSGSGYDYDFTFTSNNVQAEDAGEYYCQHYENFP
Latimeria chalumnae V29 igkv BAHO01217467.1 4342 SVGDIIMDQSPASVSVLPGESVTIKCKASAAIDDDIAWYQQKSGQEPKLLIYAVNTRHTGVSSRFSGSGYDYDFTFTINNVQAEDTGVYYCQQDDSYP
Latimeria chalumnae V28 trbv BAHO01078352.1 5321 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNYIYWYRQTLTRGFQLMGMYFRATKELTPEDGFNKTEYEVMEPQSKLIVLRIVSVKPEDTVRYFCAAS
Latimeria chalumnae V27 trav BAHO01078163.1 5772 RGEVVQVTQTPTSLHPKAGDSTEIHCEQKLNKDNMYWYQQRKQEGLKFISSVLLASIGEATQYEPGFTSRFHIRSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V26 trav BAHO01078163.1 4220 RGQDVQVTQTPTSLHLNAGDSTLMHCKQDSNKNTMYWYQQRKREGLKFISSVVVLTEGDATKYEPGFTSRFHIRSQGNNAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V25 trbv BAHO01078163.1 1719 DVQAVELTQTPASLYKRVRDASKMQCQHNDNTKNTMLWYQQKSGTGPKLIGHAIGTSEATNEKDFSKDKFQIVKETDVKGSLTITELTAADSAVYFCAVS
Latimeria chalumnae V24 trbv BAHO01078163.1 453 RGEIVEVTQTPASLHSNVGNSTEIHCKQDSNKDYMYWYQQRKREALKYIGRIDVLSTSGDAQYEAEYSSRFEITRGESKAAYLKISKLTAEDSAVYFCAVG
Latimeria chalumnae V23 trbv BAHO01078162.1 24443 RGEDVLVTQTPTSLYLNASDSMEIHCKQDSSKTKMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGKYEGSLKISKLTAEDSAVYFCAVG
Latimeria chalumnae V22 trbv BAHO01078162.1 17997 NVHTLEVTQTPTSLHKRVGGSSEMQCQHGDSNKNNMLWYQQNPRTGPKLIGYAIATSKATNEKDFPEDKFQIVKETAMKGSLTIKELTAADSAVYFCAAS
Latimeria chalumnae V21 trav BAHO01078162.1 16686 YGEDVQVTQTPTLLHPNAGNSMEIHCEQTLKKQTMFWYQQHKEEGLKFISSVNVLTKGDATQYEPGFTSRFHIRSKGNYAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V20 trbv BAHO01078162.1 10547 DVHTLEVTQTPTSLCKRVGDLSEMQCQHGDSNKDTMLWYQQNPGTGPKLIGYASGTSEAINEKDFPEDKFQIVKETDVKGSMIIQNLTAADSAVYFCAAS
Latimeria chalumnae V19 trbv BAHO01078162.1 4022 RGEIVEVTQTPASLHLNVGNSMEIHCKQDSNKEYMYWYQQRKREALKYIGRIDVSVASGDAQYEPEYSSRFEITRGESKAAYLKISNLTAEDSAVYFCAAS
Latimeria chalumnae V18 trbv BAHO01078162.1 321 RGEIVEVTQTPTSLHLNVGNSTEIHCKQDSNKDYMYWYQQRKREALKYIGYIDVLVASGDAQYEPEFSSRFEITRGESKAAYLKISNLTAEDSAVYFCAVR
Latimeria chalumnae V17 trav BAHO01078161.1 4896 HGEIVQVTQTPTSLYLNASDSTLIQCKQDSNKLNMFWYQQHKREGLKLISYVSVASEGNATKYEPGFTSRFHIRSQGNYAGSLKISNLIAEDSAVYFCAVG
Latimeria chalumnae V16 trbv BAHO01078161.1 2164 DVQAVEVTQTPTSLYKRVGDSSEMQCQHGDSNKNNMLWYQQNPGTGPKLIRYAIATSKATNEKDFPEHKFEIVKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae V15 trbv BAHO01078160.1 14065 DVQAVKVTQTPASLYKRVGDSSEMQCQHNDSSKDTMLWYQQNPGTGLKLIGYSVVTNKAITESDFPEEKFQIVKETVQKGSLTVDNLQAADSAVYFCAVS
Latimeria chalumnae V14 trav BAHO01078160.1 12891 HGEIVQVTQTPTSLYLNVGGSTEIHCEQDSSKQNMYWYQQCKREALKSIGYIDVLATSGDARNEPGFTSRFEITRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V13 trbv BAHO01078160.1 10594 DVQAVEVTQTPASLYKRVGELSKMQCQHYDSSKINMLWYQQNSGAGPKLIGYASGTSEATNENEFPKEKFEIAKETAMKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae V12 trbv BAHO01078160.1 7377 HGAIEQVTQTPTSLYPNAGDSTEIHCKQDSNKDTMYWYRQRKREGLKFISYVSVVSEGDATKYEPGFSSRFHIRSKGNFAGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae V11 trbv BAHO01078160.1 1935 HGAIEQVTQTPTSLHLNTGNSTLIHCKQDSTKPNMYWYQQRKREGLKLISYVSVVSKGDATQYEPGFTSRFHIRSQGNMEGSLKISSLTAEDSAVYFCAAG
Latimeria chalumnae V10 trbv BAHO01078158.1 4864 VADATTIEQNSTTLWVKGSTASLYCRQSSDDMNMFWYRQYRNAGLDLIFHSVTGSNIQQFNNISARFSPSRPNPETLTLTITDLQPEDTAVYFCASS
Latimeria chalumnae V9 trbv BAHO01078156.1 4409 SSGTVITQSPSVCVKKGQSVQLQCEQDGSDSYMYWYRQDRQKGPWLLFYSLAQGNVEKSDDSPTRFSAQRPSTKSFPLNMTKVESGDTAVYLCASRL
Latimeria chalumnae V8 trbv BAHO01078149.1 16244 VCSGVLISQWPTSIAERVGTSVEIQCYQNETDHNFIYWYRQMPTRGFQLMGMYYRATKELTPEDGFNKTEYEVTEPQSKLIVLRIVRVKPEDMARYFCAAS
Latimeria chalumnae V7 trbv BAHO01078149.1 12027 VCSGVLISQWPTSITERVGASVEIHCYQNETDHDYIYWYRQMLTRGFQLMVWYHRATKKLTPEGGFNKTEHEVMEPQSKLVVLRIVSVKPEDTARYFCAAS
Latimeria chalumnae V6 trbv BAHO01078148.1 3584 VCSGVLISQWPTSVTERVGASVKIQCYQNETDHDYIYWYRQTPTRGFQLMTYYNRLSKQLTPEDGFNKTEYEVTEPQNKLVVLRIVSVKPEDMARYFCAAS
Latimeria chalumnae V5 trgv BAHO01078148.1 1533 SQLQLVEQPDAFLLANVSESVTIACRLKNSQCYYLYWYQQRPTGAMEALASSAGANQVTDYAEKVYRGERPVEETSLLHIRKAEATASSVYYCACSK
Latimeria chalumnae V4 trgv BAHO01076248.1 6733 GENKEQVFQRPKMKSLEGFTVEIACRHSISSHQGLYWYKQLPGKGPELVIFGYNMADPVGRFNMSFSDNGKNTSLLISQVQIKDAVTYYCAVM
Latimeria chalumnae V3 trbv BAHO01076247.1 12337 SYASGQENSAFQPTTVVTKSEGDNVTLSCNYTVTTSTPYVFWYHQQPRKPLRYLLHNDFLNKVYLDERHDNRYSGSLEKSHNNASFSISSTKISDAGVYFCAVS
Latimeria chalumnae V2 trdv BAHO01076238.1 28417 KANGDEVFQEDRKVSVQEKQNVTLFCNYTTSDPDPYLFWYFQYPGHSPKYILQRSKHINNKGSGFSGFDARLERNKLFSLNIESAEIKDGAVYYCALR
Latimeria chalumnae V1 ighv BAHO01045975.1 3206 IQSDVILTESGGDVKKPGESLKLSCKASGFDFSSYYMHWVRQPPGKGLEWVGRISTGSSTWYSQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V0 ighv BAHO01457810.1 1509 IQSDVILTESGGDVIKPGESLRLSCKASGFTFSSNWMAWVRQPPGKGLEWVLGIDTDGSRAYYSQSVQGRFTISRDNSNSMLYLQMNNLRAEDTAMYYCAKD
Latimeria chalumnae V74 ighv BAHO01326060.1 5330 VKKPGETIRLSCKPSGYTLTCCSVHWVRKIPGKGLEWIGYQIFKGGSGYHQSFQGIFTISEDVSLTTTYLQINSLRAEDTAMYYCTRGVQG
Latimeria chalumnae V73 ighv BAHO01316321.1 15617 IQSDVILTESGGDVKKPGESLKLSCKASGFDFSSYWMYWFRQPPGKGLERVAGISSPSGSTTHYSQSVQGRFTISRDNSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V72 ighv BAHO01316321.1 10486 LTQSGPEVRKPGESLKLECAVRGFDVNSHWMDWIHQAPGKGLEWLASIGSRSDTEDHAQSIQGRFQASKDFSNHIFYLQMNSLKVEDTAMYYCAGESQ
Latimeria chalumnae V71 ighv BAHO01316318.1 8309 IQSDVILTASGGDVKKPGESLRLSCKASGFDFSSYYMHWFRQPPGKGLEWVGRISDGSGSSKLYSQSVQGRFTISRENSNSMLHLQVNSLKVEDTAMYYCARE
Latimeria chalumnae V70 ighv BAHO01316318.1 2592 IQATVNLTESGGDVKKPGESLKLSCKASGFSFSSHWMHWVRQPPGKGLEWLAYISGPSGSTKRYSQSVNGRFTISRENSKKMLHLQMDSLRVEDTAMYYCARE
Latimeria chalumnae V69 ighv BAHO01316310.1 3153 IQSAVNLIESGGDVKKPGESLKLSCKGSGFTFRSSYLHWLRQPPGKGPEWVAYISTDSSPIHYAQSVQGRFTISRDDSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V68 ighv BAHO01316305.1 26625 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYAMHWVRQPPGKGLEWIAFISYPSGSTTHYSQSVQGRFTVSRENSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae V67 ighv BAHO01316305.1 14215 LTQSGPEVRKSGESLKLKCAVSGFDINSYVLAWIRQDPQKGLEWLVSYKSSSDNVYSCLIQGRFISSKDSSNFYLQMNSLRVEDTAMYYCARESL
Latimeria chalumnae V66 ighv BAHO01316301.1 13756 LTRSGPEVRKPGESLKLECAVRGFDVNSYWMAWICQAPGKGLEWLASIGGRSSTKYHSQSIQGRFHASKDFSNHIFYLQMNSLRVEDTAMYYCARESQ
Latimeria chalumnae V65 ighv BAHO01316301.1 2425 LTQSGPELRKPGESLKLKCAVTGFDISSYAMAWIRQAPGKGLEWLVSYYSSSINDYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARESQ
Latimeria chalumnae V64 trgv BAHO01302692.1 5448 RVSAVPLEQSELSITKPPGKVARFTCYVSNSFNEQVAVAIIHWYRARKPDQGLERVLYYSYEVKHDPGFKKDKFTATKTANSFTPMIDNVAEDDNGDYYCAYWQ
Latimeria chalumnae V63 trgv BAHO01302691.1 4633 GTVTLEQPEASITKTLGKIVRLTCRVSGVSVVDAAIHWYRDRPSEGMKRILYYSTQVNHDSGFTKDRFAAEKDGGSCSLIIPSVIEDDSGDYYCAYWD
Latimeria chalumnae V62 trgv BAHO01302690.1 1902 GVGSVTLKQTERSITKTTGKIARVNCQVSGVSLDNAIIHWYRHRPNEGPERILYHSSEVKYDPGFTETKYSAYKVNDNFVLRISNVAEEDNGYYYCAYWD
Latimeria chalumnae V61 trdv BAHO01298393.1 6739 HSFGNSVSQDDQPLTVNEGSASSIINCKYSTSYSSYYLFWYRQYPQKPLEFLIRKYSDGSEHKSNSADRRFSSDLNTSQKKFTLTIKDLQLSDSAVYYCGLWE
Latimeria chalumnae V60 trdv BAHO01298391.1 8911 AGSNPVVDQFQKNLETFAGNEVNFECSLNGGSMNDYYMSWYRLQPKKSLELIYSERGNKYGDGFQGGFVGKVESSNNKCTLKIKAAELGDAAMYYCAAAR
Latimeria chalumnae V59 trdv BAHO01298390.1 13240 LTEEDNVTNVQDTLFALEGESAKISCTYSKSISSFSSYWYKQHPGGNLIILCRKDDDDFEINKAGNRFAVNLHKSDNALSLIIKGLQLYDSALYYCALTK
Latimeria chalumnae V58 trav BAHO01298390.1 2780 VHCDDEVQQFITSVTENEGQRVSLNCTYKDATINNLQWYKQLPNKKPENLFFLSLDGEQNESSCTASLNRKEKLSTLKIRSMKLSDSATYFCAVE
Latimeria chalumnae V57 trav BAHO01280903.1 15941 CLAKLTQPPESTVREGETAEIQCDGVASNDNIFWYKQHPHKRPEFLISGYSDMEKRDQYTLKINKTKQFCSLSISGVNAGDASLYYCAVSDTVT
Latimeria chalumnae V56 trav BAHO01280901.1 44629 CLAELTQPPDKSVMEGKTAEIQCDGVATADIVFWYKQHPRRGPEFLIYEYSVLEEGGQYDLKRNKTSNFCILSIRGVNVRDTALYYCAVSDTVT
Latimeria chalumnae V55 trav BAHO01280901.1 13829 CLAKLAQPPETVVKEGETAKIQCDDVDTSETIFWYQQYPYQKPKYLISAFKNKKEEKPFKVEINITSNFCTLSIRGVNVGDAALYYCAVSDTV
Latimeria chalumnae V54 trgv BAHO01260525.1 5017 GIVAVTSGKKMSETKSEGKTAEVTCEVEDTSSSYIHWYRHLDGKAPERILYYERNSKDSGATLDAGFKKTVEVDNLPNKKYSLKIHAAGESDTGMYYCARWD
Latimeria chalumnae V53 trgv BAHO01260524.1 6754 GIVAVTSDKIVSVTKGEGKTAEIICRVSASSSYIHWYRQEDGKAPERYVFYEKTSGDSGTTLKSASSKTVEVRNLGDNKFSLKIFSTTESDTGMYYCASWD
Latimeria chalumnae V52 trgv BAHO01260524.1 1310 GVVSVKLEQPKLSETKLSGKSVQISCKADELANNYIHWYRHLVGEGPTRILYFDKSSTNPTAINDQGFPSDKFDILKREENQYILKIHSAKESDSGMYYCASWD
Latimeria chalumnae V51 trgv BAHO01260523.1 3946 GVDAVPFHQPLSVIKPETKTAEISCSEASSSYIHWYRHRDGEAPTRILYLDSSNDNVNRDSGFSAAKYESLKPGNNKYILKIHTAEESDSGMYYCARWD
Latimeria chalumnae V50 ighv BAHO01258023.1 30960 EVQNSDTHLEKHLGETVNFKCTYSTSSTYVALYWYRGYQNHPLQYISYCDSSNNYHRANSFTRFSSTLDTNAHFTTLSVSKVDLGDNAVYYCGSTTTTVLQPH
Latimeria chalumnae V49 trdv BAHO01258023.1 26930 VSLGDLIQQDQRSRFQRQGDSVTLICSYSTSSIAVYLHWYRKYHNGAPEWILYRGAKSTNRHQHTAPFAEERFESRADSISTRLTIKNIQPSDTALYYCA
Latimeria chalumnae V48 trdv BAHO01258023.1 16 SLLGDSIQPQESTVPSLEGDTATLTCTYSTSSTDIWLHWYRKYPNGAPKFILYRGARSRSNEYYTAEFAKDRFESTADSNTTTLTINNVELSDTAFYYCALD
Latimeria chalumnae V47 trgv BAHO01258022.1 6788 SVQQDQPVHSEKEGDSVNLTCTYSTSSSYINLHWYRKHPNGAPEYILQRGAKSNSGDDHTAEFAKNKFDSRTDSSTTTLTIKTVQLSDTALYYCALWI
Latimeria chalumnae V46 trav BAHO01258019.1 7405 AVFGDSVQQDQPEHTEKEGFSVSLTCTYSTSSSYIYLHWYHSYPNRASEYILQRGAKSRSGNVHTAEFAKGKFDSRVDSSTTTLTINNVQLSDAALYYCALQV
Latimeria chalumnae V45 ighv BAHO01258019.1 6696 TIQPQELIVSSEEGEIATLTCTFSTSETWINLHWFRKYPNRAPEFILLRGAKGSSDRYNANFVKQKFDSSTDSSSTRLAVKNLELRDTALYYC
Latimeria chalumnae V44 trav BAHO01258015.1 6701 SVYGDSVEQPDVELSVKEGESIALKCTFPSGSGYVFWYRKYPNQALQYILQQGVGGNRFTNKAEFARKRFSIHPAGNTGGMIVSDLSFSDSALYYCVFSDS
Latimeria chalumnae V43 ighv BAHO01258010.1 6461 RGLGNELKQSVEPQEKEYGSSVKLECTYKTSYTYYFLFWYKLNTDKSLQFISRYNSYDSTSYTDASYQDRFTSTWDTSSSSVTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae V42 ighv BAHO01257898.1 1441 LTQSGPEVRKPGESLKLECAVRGFDVNSYWMAWIRQAPGKGLEWLASIGGRSSTEYHSQSIQGRFRASKDYSNHIFYLQMNRLRVEDTAMYYCARD
Latimeria chalumnae V41 ighv BAHO01257891.1 7113 VRKPGESLKLKCAVTRFDVSSDYMAWICQAPGKGLEWLVSYYSSSYNDYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARESQ
Latimeria chalumnae V40 ighv BAHO01257890.1 4737 VQSAIVLKESGGDIKKPGESLRLSCKTSGYTFNQYALYWIRQPPGKGLEWVGWINTNTGGTAYSQSVQGRFTITMDVPSSSGFLQMNSLRAEDTAMYYCARE
Latimeria chalumnae V39 trgv BAHO01236176.1 7108 ADSAAVIHQTPKSISEPVGATVRLNCSVEGESDPYMYWYRQSPYGKPELLIFSYGANSVDDKDNPAKHFTASRPDGRNFNLETPNLRANDTAVYYCAWS
Latimeria chalumnae V38 ighv BAHO01236176.1 6045 VCSEVVIRQTPRSLSVPVGDPVKLHCSIEGYEFDNPYMYWYKQSPDGAIEMLFLSRAVKTVDDSPVKHFTASRPDNKNFELDGKSQSVNDTAVYYCAWS
Latimeria chalumnae V112 ighv BAHO01043491.1 3838 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYWMHWVRQPPGKGLEWVAAISYDGVVWSGDTYYSQSVQGRFTISREDSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V111 ighv BAHO01043480.1 1260 IQSDVILTESGGDVKKPGGSLRLSCKASGFDFSSYRFSWVRQPPGKGLEWVAYIGTASTPIYYAQSFQGRFTISREDSNSMVYLQMNSLRVEDTAMYYCAAE
Latimeria chalumnae V110 ighv BAHO01043473.1 1394 IQSDVILTESGGDVKRPGESLRLSCKASGFTFSSYRFSWVQQPPGKGLEWIAYISSHSGSSTYYSQSVQGRFTISRDNSNSMLHLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V109 trav BAHO01038580.1 30796 TDSSIALIQTPSSVLALKDSPAQLTCAMKQNSMDHLGVFWYRQPEGSQEFQFILHATPMNRYTHGENFKDRFNVVRDAFRGSYTLSITSVQLSDNGTYYCVISHT
Latimeria chalumnae V108 ighv BAHO01017758.1 3219 LTQSDPQVGKPGESLKLQCAVSGFNVNSYWMAWVRQAAGKGLEWLVSYYSSSNNYYSSSIQGRFTASKDSSNFYLQMNSLRIEDTAMYYCA
Latimeria chalumnae V107 ighv BAHO01017758.1 13730 VQSAIVLTQSGAEVKKPGESVKLSCTPSGYSYTSYNLYWIRQIPGKGLEYIGYQSTGSGSAGYHPSFQGRFTISEQVSLTTTYLQISSLRIEDTAMYYCARQ
Latimeria chalumnae V106 ighv BAHO01013494.1 5868 LTQSGPELRKPGESLKLKCAVTGFDVSSYAMAWIRQPPGKGLEWLVYYYTSSSNAYSSSIQGRFTASKDSSNFYLQMNSLKVEDTAMYYCA
Latimeria chalumnae V105 ighv BAHO01470106.1 7560 LTQSGSEVRKPGESLKLKCAVTGFDVSSYYMAWIRQAPGKGLEWLVSYYSSGSSYNYYSSSIQGRFTASKDSSNFYLQMNSLKVEDMAMYYCARD
Latimeria chalumnae V104 ighv BAHO01470103.1 1690 LTQSGPEVRKAGESLKLKCAVTGFDISSYAMAWIRQAPGKGLEWLVRYYRSGSSYNVYSSLIQGRFTASKDRSNFYLQMNSLKVEDTAMYYCVRG
Latimeria chalumnae V103 ighv BAHO01470097.1 6514 VQSDIILTQSAAEVKKPGNSLRLSCKVSGLSLTSHGTIVVWIRQPIGKGLEWLARIDWDLDTFYSSSVQNRFTISRDTSSNTVYLQMNSLRVEDMTMYYCARA
Latimeria chalumnae V102 ighv BAHO01470091.1 3695 LTQSGPEVRKPGESLKLKCAVTGFDVSSDYMAWIRQAPGKGLEWLVSYYTSSSNAYSSSIQGRFTASKDSSNFYLQMNSLKVEDTAMYYCARE
Latimeria chalumnae V101 ighv BAHO01459570.1 6203 IQSDVILTESGGDVKKPGESLKLSCKASGFTFSSYAMHWVRHPPGKGLEWVSAINYGGGSKWYLQSVQGRFTISRDNSNSMLYLQMNSLRVEDTAMYYCAKD
Latimeria chalumnae V100 ighv BAHO01458584.1 9114 LTQSGSEVRKPGESLKLKCAVTGFDVSSYYMAWIRQAPGKGLEWLVSYYRSGSSYNYYSSSIQGRFTASKDSSNFYLQMNSLKVEDMAMYYCARD
Latimeria chalumnae V99 ighv BAHO01453657.1 4622 VQSDVVLNQSGAEVKKPGESVKLSCKTSGYDYTDYYLHWIRQRPQKGLEWIVRINTGDGNGDFHQSFQGRFTISEDVSSATAFLQISSLTVEDTAMYYCARE
Latimeria chalumnae V98 ighv BAHO01453657.1 15172 VQSAVVLTQSAAEVKKPGDSLRLSCKTSVFSLTSSPNTVSWIRQPIGKSLEWLALIYWDADTSYLSSIQGRFTISRDASSSTVYLQMNSLTVEDTAMYYCARR
Latimeria chalumnae V97 ighv BAHO01453655.1 321 IQSDVILTASGGDVKKPGESLRLSCKASGFDVSNYDMAWVRQPPGKGLEWVAAMSYGGGGTYYSQSAQGRFTISRDNSNSTLYLQMNSLKVEDTAMYYCARA
Latimeria chalumnae V96 ighv BAHO01453649.1 5798 IQSDVILTESGGDVKKPGESLRLSCKASGFTFSSHWMDWVRQPPGKGLEWVSEISGSASSTYYSQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V95 ighv BAHO01448112.1 828 LTQSGPEVRKPGESLKLKCAVTGFDVNSYYMAWIRQAPGKGLEWLVSYYTSSSNYYSSSIQGRFTASKDSSNFYLQMNSLKVEDTAMYYCAGDSQ
Latimeria chalumnae V94 ighv BAHO01448013.1 7554 LTQSGPEVRKPGESLKLECAVRGFDVNSYWMDWIRQAPGKGLEWLASIGGRSDTEYHSQSIQGRFRASKDFSNHIFYLQMNSLRVEDTAMYYCARESQ
Latimeria chalumnae V93 ighv BAHO01448012.1 1893 LTQSGPESKKPGESLKLKCAVTGFDVSSYAMFWIRQAPGKGLEWLVYYYSSSSNDYSSSIQGRFSASKDSSNFYLQMNSLRVEDTAMYYCARASQ
Latimeria chalumnae V92 ighv BAHO01444205.1 2054 LTQSGSEVRKPGESLKLKCAVTGFDVSSYSMAWIRQAPGKGLEWLVSYYRSGSSYNYYSSSIQGRFTASKDSSNFYLQMNSLKVEDTAMYYCARDSQ
Latimeria chalumnae V91 trdv BAHO01418954.1 1226 LTLENSVTQTSNSIDAEESRAVTITCCYNGSFSDVYLYWYRQFKQEALNYLLYKYTFGTDTVQGDKAEGIDIRFEGYLDPKTKVTNMMIKDLKISDSTVYYCALS
Latimeria chalumnae V90 trav BAHO01418953.1 5592 SVTQTSKSVDAEETQAVTITCSYNTSATTVYLYWYRQNKQGALTYLLQKSVFGTGTVQGDKAEGTDDRFEGFLDPKTKVTNLTINDLKLSDSAVYYCALSLTVVYN
Latimeria chalumnae V89 ighv BAHO01398818.1 11500 VQSAIVLNQSGDEVKKPGESIRLTCRTSGYTHTNYDIHWSRQPPGKGVEWIGRINSGSGSSRYQQPFRERFRISEDVSSSTAYLYISSLRVEDTAMYYCAREPNMA
Latimeria chalumnae V88 igkv BAHO01398813.1 893 VQSAIILTQPGAEFKNSGDSVRLSCKTSGYTYTSDYLHWIRQSPENGLEWIVKINTGSGNGDFHPSFQGRFTISQDVSATTAFLQIHHLRLEDTAMYYCATDQIWG
Latimeria chalumnae V87 ighv BAHO01398810.1 1230 IQSDVILTESGGDVKQPGESLKLSCKASGFTFRSYWMHWVRQPPGKGLEWASAISSGSGSSTYYSQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V86 igkv BAHO01394376.1 5316 VQSAIVLTQPGAEFKNSGDSVRLSCKTSGYTYTSDYLHWIRQSPEKGLEWIVKINTGSGNGDFHPSFQGRFTISQDVSATTAFLQIHHLRLEDTAMYYCATDQIWG
Latimeria chalumnae V85 ighv BAHO01394375.1 3097 IQSDVILTESGGDVKKPGESLKLSCKASGFTFSSYAMHWVRQPPGKRLEWVSAISYDGGSTWYLQSVQGRFTISRDNSNSMLYLQMNSLRVEDTAMYYCAKD
Latimeria chalumnae V84 ighv BAHO01392740.1 4928 IQSEVLLTESGGDVKKPGESLKLSCKASGFNFRSYFMHWVRQPPGKGLEWVGRISTGSSARYSQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V83 ighv BAHO01378182.1 7544 LTQSGPEVRNPGESLKLKCAVTGFDVSSYAMFWIRQAPGKGLEWLVSYYRSGSSYNYYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCA
Latimeria chalumnae V82 trav BAHO01364089.1 31294 CLAELTQPPKKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLLHEYNEDVEQKQYTLKINKTSQFCTLSIRGVNVGDAALYYCAVSDTVT
Latimeria chalumnae V81 trdv BAHO01364089.1 25125 LCLGDSITEEHTDLQVTGGQAANVTCRYNISAGYDETLQWYIQPFNGAPKYILQRFKSSSEDLKADGIGAQFSSSLDTAKRLTTLTITDAQMADSATYYCAL
Latimeria chalumnae V80 trav BAHO01364089.1 19846 CLAELTQPPEKTVMEGETDEIQCDGVATTDYIYWYKQYPHQGLEYLIQGYNTDVEQKQYTLKINKTSQFCTLSIRGVNVGDTALYYCAVSDTVT
Latimeria chalumnae V79 trav BAHO01364085.1 22712 KCCLAKLNQPPDTVVMEGETAEIQCDGVARADTIFWYQQYLHRSPEHIINGYENPEEKGRFILQINKTSQFCTLSIRGVNVGDAALYYCAVS
Latimeria chalumnae V78 trav BAHO01364081.1 7200 KGCLAKLNQPPDTAVMEGETAEIQCDGVATVDYVYWYKQYLHQSPEHIINGFEKTEEKGRFILQINKTSQFCTLSISGVNVGDAALYYCAVS
Latimeria chalumnae V77 ighv BAHO01359530.1 884 IQSEVILTESGGDVKKPGESLRLSCKASGFTFRSYYMHWVRQPPGKGLKWVLAISSGSGSSTWYLQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAIYYCARE
Latimeria chalumnae V76 ighv BAHO01359527.1 1773 LTQSGPEMRKPGESLKLKCAITGFDVNGYVMAWIRQALGKGLEWLDSYYTSSYNAYSSSIQGRFTASKDSSNFYLQMNSLRVEDMAMYYCAGESQ
Latimeria chalumnae V150 trav BAHO01156919.1 5717 KIQGDTVFQQDSILTVKEKEDVKLHCNFTTADLSPYLFWYQQYPGDSLKYILRKNKNGIDDKATGFNRFDAQLERDNTIILKIESVEVKDAAVYYCALS
Latimeria chalumnae V149 trav BAHO01156919.1 14966 NANVYQPPGMVKMEGILVEVPCNYSDKNYDFMYWYRQLSRKAPELLTYGIDSAAANGRFSMSFRKTNQETSLIVSGTEIQDSATYFCAVR
Latimeria chalumnae V148 trav BAHO01156918.1 9421 QTRGDTEFKQDAVVSVKEKEIAKLHCDYNTSEVNLYFFWYRRIPGYALQYILRNSSYGAADTASGFSGFNAKVENKAFHLNINSVEMRDAAVYYCTLS
Latimeria chalumnae V147 trav BAHO01156918.1 14731 KSKEDSVNQSEVELVVFEGKTTIINCSYSTADTYPYLFWYVQYVNKAPQYILQRDPSTVQNAPRFKERFSATLDKEKKTTLLFIENTGMSDSAVYYCALR
Latimeria chalumnae V146 trav BAHO01156917.1 3963 GVHCDDEVIQIINSFRASEGRNVTMNCTYKAVSFYNLQWYQQFPSQNPENLFILRSDGVEPKPPVTASLNKNEKLSILTITNVKLTYSATYFCAVE
Latimeria chalumnae V145 trav BAHO01156917.1 8674 VIHCNDKVEQVTSLSSSEGRSVTMNCTFTANIRALQWYKQSPSKTPENLFVLVLDGEENTTSYTASLNMKEKLSILKIRNVKLAYSATYFCAVE
Latimeria chalumnae V144 trav BAHO01156916.1 4060 KNKENSVNQSEDELVDFEGNAIIIKCNYTATDPFPYLYWYVQYVNEAPQYLLRRDRNSEDNAPRFKDRFSATLDNEKKTVPLLINNAQIFDSAVYYCALR
Latimeria chalumnae V143 trav BAHO01156915.1 2789 QTKGGTDFKQDYMVAVKEKETVKLNCNYNTTEALRTFFWYRGIPGRALQLVLRNDTYGNGYFEPGFSRFNAQVRTSNNAFHLHVESVEMRDAAMYYCALS
Latimeria chalumnae V142 trav BAHO01156909.1 10141 VNCSDEVIQIIQSLRVSEGQNVTMNCTYKLLNFYSLQWYKQSPNQNPENLFVFRLDGEEGKLPFTASFNEKEKLSILTITNPKLIESATYFCAVE
Latimeria chalumnae V141 trav BAHO01156909.1 12172 VHCNDEIDQIITSLNVTEGQNVTMNCTYKSSNIYNLQWYKQSWSKKPENLFILTSDGEVPNPPFTASLNKKEKLSVLRITNVKFVESTTYFCAVQ
Latimeria chalumnae V140 trav BAHO01156906.1 4243 KSKEDSMNQSVAKLPVVEGENTVINCSYSTTVTFSYLFWYVQYANEAPQYLLERDPSTAANASRFQERFSATLDNEKKTIPLFIENTGVSDSAVYYCALR
Latimeria chalumnae V139 ighv BAHO01126491.1 3022 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYYMNWVRQPPGKGLEWVAIIYTGSSSIYYTPSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCAGD
Latimeria chalumnae V138 ighv BAHO01126487.1 531 IQSEVILKESGGDIKKPGESLRLSCKGSGFTFSGYALSWVRQPPGKGLEWVAFIHTASSPIYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARR
Latimeria chalumnae V137 ighv BAHO01126485.1 15961 VQSAIVLTQSGAEAKKPGESVKLSCTPSGYSYTSYNLQWIRQVSGKGLEYIGYQSTGSGSAGYHPSFQGRFTISEEISLTTTYLQISSLKVEDTAMYYCARQ
Latimeria chalumnae V136 ighv BAHO01126485.1 21115 IQSQIILTESGGDVKKLGESLKLSCKASGFTFSSYGMHWVRQPTGKGLEWVGVIWYDASRTEYSQNVKGRFTISRDNSNSFLYLQMNSLRVEDTAMYYCTRD
Latimeria chalumnae V135 ighv BAHO01107480.1 851 LTQCGPEVRKPGESLKLKCAVTGFDVSSYDMDWIRQAPGKGLEWLVSYYDSSNNEYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCAGE
Latimeria chalumnae V134 ighv BAHO01107480.1 10873 IQSDVILTESGGDVKKPGESLRLSCKASGFTFSSNWMAWVRQPPGKGLEWVLGIDTDGSRTYYSQSVQGRFTISRDNFNSMVYLQMNNMRPEDTAMYYCAKD
Latimeria chalumnae V133 trav BAHO01106186.1 3478 SVNHISISVTAEESRAVTITCSYNASYSNVYLFWYRQFKQEAPNYLLHKYTFGTDTVQEDKAEGIDDRFEGFLDPKTKVTSLTIEDLKLSDSAVYYCALS
Latimeria chalumnae V132 ighv BAHO01088620.1 270 LTQSGPELRKPGESLKLKCAVTGFDVSSYHMYWIRQAPGKGLEWLVSYYRSGSSYNAYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V131 ighv BAHO01088614.1 3524 LTQSGSEVRKPGESLKLKCAVSGFDVSSYTMHWIRQAPGKGLEWLVYYYSSSSNAYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V130 ighv BAHO01088613.1 5673 IQSDVILTESGGDVKKPGESLRLSCEASGFDFSSYWMYWVRQPPGKGLEWVSAISSGSGSSTYYSQSVQGRFTISRENSNSMLYLQMNSLKVEDTAMYYCARD
Latimeria chalumnae V129 ighv BAHO01084730.1 5182 VQSAVVLTQSGAEVKKPGESLRLSCEASGFTFGDYWMSWIRQAPGKGLEWLARISYWAGSTINYAQPVQGRFTISRDNSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V128 ighv BAHO01084727.1 7484 IQSQVNLTESGGDFKKPGESLKLSCKASGFTYSSYYMHWIRQPPGKGLEWVSATNTAGSSKWYSQSVQGRFTISRDNSNNMLYLQMNSLRVEDTAMYYCAKD
Latimeria chalumnae V127 ighv BAHO01084724.1 2797 IQSDVILTESGGEVKKPGESVKMSCKASGFTFSSYEMNWIRQAPGKGLEWIAYISGSGGSTVYLQSVQGRFTISRENSNSMLYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V126 ighv BAHO01084723.1 4007 VYSDIVLTQFGPEARKLGESLKLKCAISGLDVNSNWMDWIRQTPRKGLEWLARIGSRSDTEYHSQPIQGRFRASKDFSNNVFYLQMNSLTVEDTAMYYCTRH
Latimeria chalumnae V125 ighv BAHO01084722.1 17111 IQSQVILTESGGDVKKPGESLRLSCKASGFTFSSYYMHWFRQPPGKGLERIAYISADGSSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCTTD
Latimeria chalumnae V124 ighv BAHO01084721.1 4942 IQSEVTLIESGGDVKKPGESLTLSCEASGFSLSSYYMSWVRQPPGKGLEWLSAADTAGSSKWYSQSVQGRFTITKDNSNSMLYLQMNSLRAEDTAMYYCARD
Latimeria chalumnae V123 ighv BAHO01084720.1 1039 IQSQVILTESGGDAKKSGESLKLSCKASGSTFSSYYMHWIRQPPGKGLEWLAEIRPDASKTWHSQSVEGRFSISRDNANSMLYLQMNSLRVEDTAMYYCARN
Latimeria chalumnae V122 ighv BAHO01084718.1 8323 VQSAVVLTQSGAEAKKPGESLRLSCEASGFTFGDYWMSWIRQAPGKGLEWLARISYWAGSTINYAQPVQGRFIISRDNSNNILYLQMNSLRVEDTAIYYCARD
Latimeria chalumnae V121 ighv BAHO01084717.1 2765 MKSVVLLTESGGDIKKPGESLMLSCKASDVNFNSYHMEWVRQHSGKGLEWIAEVENDGDIYYAPSVQGRFAISRDVSSSMLYLQMNNLKVEDTATYYCARN
Latimeria chalumnae V120 ighv BAHO01084717.1 10156 VQSGVVLTESGGDIKRPGESLTLTCKTAGYTFSYHHLHWVRQPPGKGLEWVGVRYMNSGNTHFDQSVQRRFTMDIDVPSHSLFLYMNSLRVEDTAMYYCARE
Latimeria chalumnae V119 trgv BAHO01077836.1 3825 GVTAVTLEQPKLSITKASGKTAQIICKMSGVPLSAAIHWYYGKPGEELKRIMFHSTSITHDLGFRKEKFTSDKTDGSCTFIIHNIAEEDSATYYCAWWD
Latimeria chalumnae V118 ighv BAHO01043517.1 9896 LTQSGPELRKPGESLKLKCAVTGFDVSSYYMAWIRQAPGKSLEWLVNYYSSDSRYHAYSSSIQGRFTASKDSSNFYLQMNSLKVEDMAMYYCARE
Latimeria chalumnae V117 ighv BAHO01043515.1 425 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYWMHWVRQPPGKGLEWVAAISYGGGSTYYSQSVQGRFTISRENSNSMLYLQMNSLKVEDTAMYYCVRD
Latimeria chalumnae V116 ighv BAHO01043508.1 5233 VQSAVVLTQSAEEIKKPGDSFRVSCKTSGFSLTSYGVGWIRQPIGKGLEWLAIIFWNANTRYSSSIQGRFTISRDTSSSTVYLQMNNLKVEDTAMYYCARE
Latimeria chalumnae V115 ighv BAHO01043501.1 4690 VRSAVVLTQSGAEVKKPGESIRLSCKPSGYSYSSYNLHWVRQIPGKTLEWIGYQSTGGGSAGYHPSFQGRFTISEQVSLTTTYLQINSLRVEDTAMYYCARE
Latimeria chalumnae V114 ighv BAHO01043499.1 539 VQSDVTLTESGGDVKRPGESLKLSCKASGFDFSSYWMGWVRQPPGKGLEFVSILEYDSDRRYFGQSVQGRFTTSRENSNSMLYLQMNSLRVEDTAMYYCARA
Latimeria chalumnae V188 trbv BAHO01236186.1 34632 LCGGVIHVTQLPNSLTGRTGNEVNLTCTQHDKSGSTIYLYWYQQKRDQGLKLIAYTSFDGENPDQETGFEKNFQVTRPNEENSILNIRELKAADTATYLCAAS
Latimeria chalumnae V187 trbv BAHO01236186.1 37884 LCGGVIPVTQHPNSLTGSAGKEVNLTCTHHDKGGTNIYLYWYQQKRDQGPRFIAYTFLAGEKPDPETGFEKKFEVTRPNKENSILKIKELEAADTASYLCAASK
Latimeria chalumnae V186 trbv BAHO01236186.1 39342 LCGGAILVTQLPKSLTGRTGSTVNLTCTHDDTSANLIYVFWYQQKRGQGLASISYTSTDGEKGKPEPGFENKFEVTRPDRKESILKIKDLKAADTASYLCAASK
Latimeria chalumnae V185 trav BAHO01232996.1 3835 LCLGDSITEEHKVLEVTEGKAAKLTCRYNVGSASNEALQWYIQPFNRAPKYILQRFKSSSEDLKADGIGDRFSSSLNATEKLTTLTITDAQMSDSGTYYCALS
Latimeria chalumnae V184 trav BAHO01232996.1 10229 LSLGDFVVEEYKVLQVTEGKAATFTCRYNMTVAYDEALQWYIQPFSGAPKYLIQRYKSGSTTHESKADGIGDRFSCSLDTTNRLITLIMRDAQMSDSGTYYCALS
Latimeria chalumnae V183 trav BAHO01232996.1 15909 LCLGDSVTEEHKVLQVTEGQAATFTCRYNLTVTYSEALQWYIQPFNGAPKYILQRLKSSSQDLKADGIGDRFSSSLDTTKRLTTLTITDAQMADSGTYYCALS
Latimeria chalumnae V182 trav BAHO01232995.1 6849 LCLGDSVTEEHKVLQVTEGKAITFTCTYNKSAAYNEALQWYIQPFNGAPKYILQQFKSSSKSLESKAEGIGDRFSSSLDTTNRLTSLTISDIQMADSGRYYCALS
Latimeria chalumnae V181 trav BAHO01232990.1 12268 LCLGNSITEEHKVLQVTEGKAETFTCRYNLSSGYNEALQWYLQPFNGAPKYILQWLKSGSTSQESKADRIGDRFSSSLDATKRLTTLTITDVQMSDSGTYYCALS
Latimeria chalumnae V180 trdv BAHO01232989.1 2840 QQSFAKFTQTPYETVEEGTVVKIRCDGIDPTDYTFWYKQGFGPTHRSLQLVISEFGDEKNNQFNLTKDTPSKSSTLTIKEVQLGDAALYYCAQS
Latimeria chalumnae V179 trgv BAHO01232985.1 2951 DSVTEWDLEKNTIEGETVILRCNYTATSTSNPVLMWYKQHLSRPLEYLLQVDNFNPKANRPGGKLTSELKKEEKSVSLSIPKTELSDSGVYYCALR
Latimeria chalumnae V178 trdv BAHO01232985.1 10680 KECLGKPSQLPYKIAEEGKTAEILCGAINVNYNILWYKQTPHHSQKRLQLITYGFGNDEKDQFQLTQGMENQTSTLTIRNVHLGDAALYYCAESDTVT
Latimeria chalumnae V177 trav BAHO01232984.1 3103 REGAFEPQQPPSVEAAEGKEVNLPCNYSLGTSDNLYWYKQTKESMKFLIQGYKDTKNESHYTLTIATDRKNSTLTMWDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V176 trgv BAHO01232982.1 5962 CQAKLSQPAYETVEEGKSVQILCKEIDTSSLTLWYKQTPLHNQKGLQLIIHGYESTQEKQFNLTVDKQNKFITLTIKEAHLGDAGLYYCAESDTVTTAGL
Latimeria chalumnae V175 trgv BAHO01232981.1 5022 KVTEWDLVKAATEGDTVTLQCNYTATTISSPNLMWYKQKLNRPLEYLLQVHEYKTTDNTTGEKFLTSELKSKDNSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae V174 trgv BAHO01232980.1 6715 TEWDREKPAIEGETVTLGCNYTLTKISTNDVVLMWYKQHLTRPLEYLLQVAAHNIKTSSTGEKLLTSELKSKDNSVSLSIPKAELSDSGVYYCALSDTVMQT
Latimeria chalumnae V173 trav BAHO01232980.1 21529 REGASKPEQPSSMEAAEGKEVNLSCTYNLPTNYYIQWYKQTKESLKYLIQTLKNPENDGRYTLTIVEDRKNNTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V172 trgv BAHO01232980.1 26649 DKVTEWDLEKTAIEGDAVTLRCNYTATSTSSPALMWYKQHLSQPLEYLLQVATFNTKANSTGEKFLTSELKSKENSVSLSIPKAELSDSGVYYCALSDTVIQT
Latimeria chalumnae V171 ighv BAHO01204935.1 1403 AQSDIVLTQSAAEVKKPGDSLRLSCKVSGLSLTSSGTVVVWIRQPIGKGLEWLARIDWDLDTFYSSSVQGRFTISRDTSSNTVYLQMNSLTVEDTAMYYCARA
Latimeria chalumnae V170 ighv BAHO01204932.1 205 VQSDVTLTESGGDVKRPGESLKLSCKASGFDFSSCWMGWVRQPPGKGLEFVSILEYDSDRRYFGQSVQGRFTTSRENSNSMLYLQMNSLRVEDTAMYYCARA
Latimeria chalumnae V169 ighv BAHO01204928.1 1353 VRSAVVLTQSGAEVKKPGESIRLSCKPSGYSYSSYNLHWVRQIPGKGLEYIGYQSTGGGSAGYHPSFQGRFTISEQVSLTTTYLQISSLRVEDTAMYYCARE
Latimeria chalumnae V168 ighv BAHO01204925.1 3618 VQSAVVLTQSAAEVKKPGDSLRLSCKTSRFSITSIPNTMSWIRQPIGKGLEWFAVIDWDGDTSYLSSIQGRFTTSRDTSSNTVYLQMNSLRVEDTAIYYCANE
Latimeria chalumnae V167 trgv BAHO01172539.1 1922 NFAAVRLKQLELSITKAPGRTAKFTCAVSGVANLDSTVIHWYRARAGQAPERILYYSSGDNYDPGFTKAKHSSNKVNNIFTLTISKASEEDNGYYYCACWD
Latimeria chalumnae V166 ighv BAHO01171913.1 7541 VQSAVVLTQSGAEVKKPGESLKMSCETSGYDYTSSYIHWIRQPPRKGLEWIGRIDCGSGSSVYQQSFQGRFTISEDVSLSTAYLQINRLTVEDTAMYYCARA
Latimeria chalumnae V165 ighv BAHO01171908.1 6346 VQSAVVLTQSAAEVKKPGDSLKLSCKTSGFSITSISNTMSWIRQPIGKGLEWLAIIDWDGDTSYLSSIQGRFTISRDTSSSTVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V164 ighv BAHO01171908.1 20374 VRSAVVLTQSGAEVKKPGESIRLSCKPSGYSYRSYYLHWVRQIPGKGLEWIGYQSTGGGSASYHPSFQGRFTISEDVSLTTTYLQINSLRAEDTAMYYCARE
Latimeria chalumnae V163 ighv BAHO01171906.1 2392 IQSDVILTESGGDVKKPGESLRLSCKASGFDFRNSDMVWVRQPAGNRLEWIAYISSPSGSSTYYSQSVQGRFTISRENSNSMLYLQMNSLKVEDTAMYYCARE
Latimeria chalumnae V162 ighv BAHO01171901.1 4439 IQSGVTLTESGGDVKKPGESLRLSCKASGFDFSSYVMHWVRQPPGKGLEWVAAINYDGIVLYGGTYYSQSVQGRFTISRENSNSMLYLQMNSLRVEDTAMYYCARA
Latimeria chalumnae V161 ighv BAHO01164908.1 3953 IQSEVLLTESGGDVKKPGESFKLSCKASGFNFRSYYMHWVRQPPGKGLEWVGRISTGSSARYSQSVQGRFTISRDNSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V160 ighv BAHO01164907.1 2602 VQSDVVLTQSGAEVKKPGESIKLSCKTSGYSYTSSYLHWIRQHPQNGLEGIVRIDTGEGKGDFHQSFQGRFTISEDVSSATAFLQISSLRVEDTAMYYCARE
Latimeria chalumnae V159 trav BAHO01156925.1 1701 GEFSSQVQQLPNVEYVEGHQVEIFCNHSISSYENMYWYQQLPNKPAEVIVYGYSSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V158 trav BAHO01156925.1 2523 GEPTSEVHQLPYIDTVEGLQVKIHCNHSIISYSSMFWYQQLPYKHPEVIISGYDSADPNGRFSMSFNRDKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V157 trav BAHO01156923.1 8696 GEPSSEVQQLPDMKLVEGHPVQIHCNHSITSYNSMFWYQQLPNKPPEVIIYGYESADPIGRFSMSFNRDKLETSLIISGTEISDAATYYCAVS
Latimeria chalumnae V155 trav BAHO01156922.1 3632 FQGQEEVSQNEIPLTARDGESVQINCTYKVKEYSLQWYKQYPGKAPEFILLRSTSGTDTVGRYKIFLDTSEKYVFLQIHNTTVEDTAVYFCALGTIAQK
Latimeria chalumnae V154 trav BAHO01156921.1 9718 GEPTSEVYQLPYIVSMEGLQVKIHCNHSISNYNNMFWYQQPNRNKPPEVIIYGYDSADPKGRFSMSFNREKRETSLIINKTEISDAATYYCAVS
Latimeria chalumnae V153 trbv BAHO01156920.1 204 KIKGNVVHQEDSLVYVKEKASIKLACNYTTSNASPYLYWYQQYPGDSLKFILHKNKHSSLDSAPGFSRFDAELGKDDTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae V152 trav BAHO01156920.1 1508 GDSSSQVDQLPAIESVEGYPVKIPCNHSISNYNNMIWYQHLPNKPPKVIVYGYNSAAPNGRFNMSFNRDNPKMFLIISGTEISDAATYYCAVS
Latimeria chalumnae V226 trav BAHO01236201.1 7429 HGEIVQVTQRPTSLHLNANNSTEIHCEQDSNKNYMYWYQHRKQEGLKLISYVILTTIGEATQYEPGFTSRFHIWSRENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V225 trbv BAHO01236198.1 950 HCQTVLVTQSPSSVHKNAGKEVEIDCQHNKNDYYYMYWYQQRRAEGIKLIGHTYETQEAKHEDGFNSSKFQIPQRDQVEKGSMKIMDLGAGDSAVYFCAVSK
Latimeria chalumnae V224 trav BAHO01236198.1 4326 RGEIVQVTQIPASLHPNASDSTKIHCAQDSNKQYMYWYQQRKWEGLKSIGRIYMVGTGGDPEYEPGFTSRFEIMRTDSKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V223 trav BAHO01236198.1 5650 QEEVVQVTQTPTSLYPNTGNSTQIDCKQDSNKNYMYWYQQRKQEGLKAIGQIFIATKGEKPKYEPGFSSRCEIMGIDNKVGSLKINNLTAEDSAVYFCAVG
Latimeria chalumnae V222 trbv BAHO01236198.1 8598 LVETVQVTQTPTSLHLNAGNSMEIHCKQDSNKQFMYWYQQHKREGPKFISSVNVVSEGDATKHEPGFTLRFHIRSKGKYAGSLKISNLTAEDSAVYFCAVSK
Latimeria chalumnae V221 trav BAHO01236198.1 9906 RGEIVQVTQTPTSLYPNAGNYTEIHCEQDSNKNTMYWYQQRKQEGLKAIGQIFIATKGEKPKYEPGFSSRFEIIRNDSKAGSLKISNLTAKDSAVYFCAVG
Latimeria chalumnae V220 trav BAHO01236197.1 611 HCQTVLVTQSPSSVHKNTGNEVEIYCQHNKSDYVYMYWYQQRRAEGIKLIGNTYMTNEAKHEDGFNSSKFQISKRDQVEKGSMKIVDLGAGDSAVYFCAVSE
Latimeria chalumnae V219 trav BAHO01236197.1 2113 HGEVVQVTQTPTSLYPNASDSTEIYCKQDSSKLNMYWYQQRKREGLKLISYVSVASEGDATQYEPGFTSRFHIRSKGSFVGSLKISNLTAEDSAVYFCAAG
Latimeria chalumnae V218 trav BAHO01236197.1 6678 RGEVVQVTQTPTSLHLNTGKSTEIHCEQKLNKNYMYWYQQHKREGLKLISYVSVVSEGDATQYEPGFTSRFHIRSQENKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V217 trav BAHO01236197.1 8006 RGEIVLVTQTPTSLHPNAGNSMEIHCEQDSSKQYMYWYQQRKREGLKFIGRIYTATKSEDLHHEPEFIMRFEITRIDSKVGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V216 trbv BAHO01236196.1 1559 HGQTVSVQQSPPLVHNSTGGSVEFRCEHKSSSYDTMLWYQKRRGEGPKLIGSGYSTQEPTYETKEGFEPPKFEIKKETDVKGSLTIQNLTAADSAVYFCAVS
Latimeria chalumnae V215 trbv BAHO01236195.1 2495 HGQTVSVQQSPPSVHNSTGGSVELHCQHEDASYLNMLWYQKRAGEGPKLIGSGYSTQEPTYENKEGFEPPKFEIKKKKNNLKGSLTVTELTAAESAMYFCAVS
Latimeria chalumnae V214 trbv BAHO01236195.1 4798 HGQTVSVQQSPPSVHNSTGGSVEFRCEHKSSSYDTMLWYQKRRGEGPKLIGSGYGTQEPTYETKEGFGPPKFEIIKETDVKGSLTIQKLTAADSAVYFCAAS
Latimeria chalumnae V213 trbv BAHO01236195.1 7652 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDTSYLNMLWYQKRRGEGPKLIGSGYSTQEPKYEKKEGFEPPKFEIIKETDVKGSLTIQKLTAADSAVYFCAAS
Latimeria chalumnae V211 trbv BAHO01236195.1 12400 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDSSYPTMLWYQERRGEGPKLIGSGYSTQEPTYENKEGFEPPKFEIKKETAVKGSLRIQSLTAADSAVYFCAVS
Latimeria chalumnae V210 trbv BAHO01236194.1 2845 HGQTVSVQQSPPSVHNSTGGSVEFHCQHEDASYNTMVWYQKRRGEGPRFIGYAYLSQPPEYEKKEGLEPPKFEIKKDKNNLNGSLTITELTAADSAVYFCAVS
Latimeria chalumnae V209 trbv BAHO01236193.1 756 LCGGKILVTQLPKTLIGTVGNSVEMNCTHNDTSVSATMYWYRQYGGQGLELITYTLAGGSNQTEPEFKEKVEVKRLNSKQTSLKIKELKAADTASYLCAVRE
Latimeria chalumnae V208 trbv BAHO01236193.1 2583 VSGGVIHVTQLPNSLIGTPRDTLEINCTHMDTSNSVHSIFWYQQKRGQGLTLIVYTDSADGEPKFELDFKEKFEVKRPDDLNSTLKIKELKASDTASYLCAVNE
Latimeria chalumnae V207 trbv BAHO01236193.1 3661 LCDGAVKVTQSPKSLAQTSGKLAEITCNHSESTYYNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLQAADTASYLCAASLTQ
Latimeria chalumnae V206 trbv BAHO01236191.1 28 LCDGAVKVTQSPKSLAQTSGKLAEITCKHNESSYYNMYWYRQYSGQGLTLILTSVFQGTTTFEDGFKEGFQVERPTLLNSTLKILQLKAEDTASYLCAASL
Latimeria chalumnae V205 trbv BAHO01236190.1 2032 LCDGAVKVTQSPNSLVQTSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLTVTSVYPDATTFEDGFKEGFQVERPTLLNSTLKILQLKAADTASYLCAASLTQ
Latimeria chalumnae V204 trbv BAHO01236190.1 3785 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTSSTATMYWYRQYRGQGPKFITYTLADGSNQTEPEFKEEVVVMRLNTKETSLKIKKLKASDTASYLCAVSE
Latimeria chalumnae V203 trbv BAHO01236190.1 6239 LCGGAIIVTQQPNSLTGRTGNPVEMNCSHDYMGADPYSIFWYQQKKGQGLTLIVYTYGAQGKPSFEQDFEKEFEVIRPDNRNSALTIKGLKAADTASYLCAASK
Latimeria chalumnae V202 trbv BAHO01236190.1 8141 LCGGAILVTQLPNSLTERMGNPVEMNCSHDYMGTDAYSMFWYQQKRGQGLTLIVYTARAGGEPKFELDFKKEFEVTRPDNRNSALTIKGLKAADTASYLCAAS
Latimeria chalumnae V201 trbv BAHO01236190.1 12703 LCGGTTLVTQLPKTLIGTVRNSVEMNCTHNDTVSTARMYWYRQYGGQGLELITNTVSVGSNQTEPEFKEKVEVKRLNTKQTFLKIKELKASDTASYLCAVRE
Latimeria chalumnae V200 trbv BAHO01236189.1 1644 LCGGTILVTQLPKLLIGTVGNRVEMNCTHNDTSSAARMYWYRQYRGQGSKLIAYSVAVGSSETEPEFREEVEVMRLKPKEMSLKIKTLKAVDTASYLCAVSK
Latimeria chalumnae V199 trbv BAHO01236188.1 29 LCSGAILVTQHPNSLTGRTGKPLEMNCTQTDTSSTATIYWYQQYRGQGLTLIVYTVGVTGTPYFEQNFTKHYEVMRSDKAHSTLKIKALKATDTASYLCAASK
Latimeria chalumnae V198 trbv BAHO01236188.1 2620 LCGGAILVTQLPNSLTESSGKLVEMNCTHDYMGTDFYNIFWYQQKRGQGLTLIVYTSIAGDEPKFEPGLEKEFEVTRPDNRNSNLKIKALKLTDSASYLCAVRK
Latimeria chalumnae V197 trbv BAHO01236188.1 4696 LCGGTILVTQLPKSLIGTVGNPVEMNCTHNDTVSTANMYWYRQYRGQGPELIAYTKTVGSNQTEPGFQDKFEVMRLKTKETSLKIKKLKAADTASYLCAVSK
Latimeria chalumnae V196 trbv BAHO01236188.1 7110 LCDGAVKVTQSPKSLVQMSGKLAEITCNHSESTYGNMYWYRQYSGQGLTLIVTSVYPDATTFEDGFKEGFQVERPTILNSTLKILQLKAADTASYLCAASLTQ
Latimeria chalumnae V195 trbv BAHO01236188.1 8903 FCGGVIHVTQHPNSLTGSTGNPVEINCTHDYTGTDISRMFWYQQKRGQGLTLVVYTVGAEGKPTFERDFEKEFEVKRPDKRNSALTIKGLKAADTASYLCAAS
Latimeria chalumnae V194 trbv BAHO01236188.1 12356 LCGGAILVTQHPKSLTGRLANTIEMNCRHSETSDSIYRMFWYQQKRGQRLTLIANTYITGDKLDIEQDFKKEFEVMRSDNRNSNLKIKTLKAGDTASYLCAVGG
Latimeria chalumnae V193 trbv BAHO01236187.1 2219 VSGGVIHVTQLPNSLIGTARNTLEINCTHTDTSSAAHRIFWYQQKRGQGLTLIVYTVGAGGNPNFEQDFDKDFNVSRPDNFHSTLKIKELKAADTASYLCAVSK
Latimeria chalumnae V192 trbv BAHO01236187.1 3533 LCGGAILVTQLPKSLTGKPGKPVEMNCTHNDTSSASTVYWYQQYRGQGLTLIAYSITAEENGKPETGFEKEFEVKRPDKQKSILKINKLKASDTASYLCAVSK
Latimeria chalumnae V191 trbv BAHO01236187.1 4931 LCGGAILVTQLPNSLTGRIGNPVKINCTHNFTGADPYSIFWYQQKRGQGLTLIVYTASAGGEPKFESDFEKEFEVTRPDNRNSALTIKGLKAADAASYLCAASK
Latimeria chalumnae V190 trbv BAHO01236187.1 7421 LYSGVIFVTQLPNSLTGGSGKAIEINCKHNDTINTVHRIFWYQQKRGQGLTLIVYTVGAGGNPTFEQNFHNEFNVSRTDNLHSTLKIKALKAADTARYLCAVSE
Latimeria chalumnae V264 ighv BAHO01303425.1 6357 VQSAIVLTQSGAEVVKPGESVRLSCKISGFSLTSSPNTVGWVRQSIGKGMEWLTQIYWDASSNSAPVQGTFTISRDTSTNTVYLQMNSLRTEDTAMYYCEKGNYNSG
Latimeria chalumnae V263 ighv BAHO01303424.1 1031 IHSQVNLTESGGDVKKPGETLRLSCKASGFTFSSYYMSWIRQPPGKGLEWIASISSGGGSTGYLQSVQGRFTISREDSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V262 ighv BAHO01303422.1 4044 IQSQVNLTESGGDVKKPGESLKLSCKASGFTFSSYTMCWIRQPPGKGLEWIAYITGSGSTGYFQSVQGRFTASRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V261 trgv BAHO01303422.1 11865 IQSDVTLTESGGDIKKPGESLRLSCKASGFTFCNYLMHWIQQPPGKAIEWVAYISTGGVSTSYLQSVQGRFTISRDNSNNMLYLQMNSLRVEHTAIYYCAGD
Latimeria chalumnae V260 ighv BAHO01303422.1 18831 LTQSDPQVGKAGESLKLKCAIVGFNVNSYWMAWIRQPAGKGLEWLVYYHTSSNNYYSCSAQGRFTASKDSSNFYLQMNNLRVEDTAMYYCARE
Latimeria chalumnae V259 ighv BAHO01303420.1 238 IQSQVNLTESGGDVKKSGESLRLSCKASGFTFSSYYMSWIRQPPGKGLEWIAYITNADGGSTGYLQSVQGRFTISRQNSNNMLYLQMNSLRVEDTAMYYCARN
Latimeria chalumnae V258 ighv BAHO01303420.1 12351 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYAMNWVRQPPGKGLEWVAFIHTSSSSRYYTPSVQGRFTISREDSSSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V257 ighv BAHO01298917.1 7195 LTQSGPELRNPGESLKLKCAVTGFDVSSNAMAWIRQAPGKGLEWLVYYFTSSINAYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V256 ighv BAHO01298915.1 139 VQSAVVLTQSGAEGKKPGESLKLSCETSGYSYTSDYIHWIRQPPRKGLEWIGRINCGSGSSVYQQSFQGRFTISEDVSLSTAYLQINRLTVEDTAMYYCART
Latimeria chalumnae V255 trgv BAHO01298415.1 895 SVSHMSKSVVEEESQAVTITCSYNTSYSNLYLQWYRQFKQEAPIYLLQKYFLGIGTVQGDKAEGIDDRFEGFLDPKTKVTNLTIKDLKLSDTAMYYCALS
Latimeria chalumnae V254 trav BAHO01298415.1 9379 LTLGDSVSHISRSVAEEESQAVTITCSYNASRSDVYLYWYRQFKQGSLTYLLQKYTFGTGTVEGSKAEGIDNRFEGFLDPITKVTNLTISDLKLSDTAVYYCALR
Latimeria chalumnae V253 ighv BAHO01298403.1 9489 FQFTAVLAQAGTEVTKAGESIKLQCDLSGFDVNSYWMYWYRQDPRKGMDWLVSYWSSSNNRYSPSIQGRFTASKENSNFYLQMNNLGIEDTAMYYCARLD
Latimeria chalumnae V252 ighv BAHO01298403.1 15782 FQFTAVLTQAGTEVTKAGESIKLQCDLSGFDVNSYWYQQAPGKGLDWLVSYSSSSNNEHATSIRGRFTASKENSNFYLQMNNLGVEDTAMYYCARLD
Latimeria chalumnae V251 ighv BAHO01298403.1 17474 LHFPAVLTQAETEVKKSGESINLKCDLSGFNINEYWMFWYRQTPGKELDWLFSYWDVNSKKQSPSTKGRFTALKENSNFYLQMNSLRIEDTAVYYCARR
Latimeria chalumnae V250 ighv BAHO01298402.1 5888 IQFTAVLTQDGTEVRKAGESIKLKCDLSGFDVNSYWMYWYRQAPGKELEWLVTYDTSSNNAHSPSIQGRFTASKENSNFYLQMNNLGVGDTATYYCARSD
Latimeria chalumnae V249 ighv BAHO01298402.1 7552 VHFSVVLSQSNEEVKKAEESLRLKCSLTGFDVNSYSMFWYRQAPGKGLEWLVYYYSSSINDYSSAIRGRFTASKDSSSFYLQTNSLRVEDTAMYYCARRD
Latimeria chalumnae V248 ighv BAHO01298402.1 14216 FQFTAVLTQAGTEVAKAGESIKLQCDLSGFDVNSYRMYWYRQAPGKGLDWLVNYWSSSVNHYSPSIRGQFTASKENSNFYLQMSNLEIEDTAIYYCARLD
Latimeria chalumnae V247 ighv BAHO01298400.1 8161 VQSEVVLTQSGEEVRKAEESLTVSCKGSGFTFTDYHIYWYRQPPGQELNWLGVLWASGSINYNQAMKGRFTVSRENSNSMAYLQMNSLQLQDTAVYYCAAV
Latimeria chalumnae V246 ighv BAHO01298400.1 15274 VHFSVVLSQSSEEVKKAEESLRLKCTLSGFDANSYRMYWYRQAPGKGLDWLVNYYSSPVYSPSIQGRFIASKESSNFYLQMNSLRIEDTAVYYCARRD
Latimeria chalumnae V245 ighv BAHO01298400.1 17101 VLTQSSQEVKKADESLRLSCKGSGSTLNNYYIHWYRQPAGQGLDWLGVIWYDGSRTEYNQAVKDRFIITRDNSNSMAYLQMNSLRLEDTAVYYCAAE
Latimeria chalumnae V244 ighv BAHO01298400.1 21040 VHFSVVLSQSSEEVKKAEESLRLTCSLTGFNVNSYHMYWYRQAPGKGLEWLVRYYSSSNNDYSSAIQGRFTASKDSSSFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V243 ighv BAHO01298400.1 24109 LTQAGTEVKKAGEPIKLKCDLSGFNVNSYWMYWYRQAPGKGLDWLVYYYTSPSYSSSIQGRFTASKESSNFYLQTNSLRIEDTAMYYCARR
Latimeria chalumnae V242 ighv BAHO01298400.1 27877 VHFNVVLSQSSEEVKKAEESLKLKCILSGFDVNSYDMYWYRKAPGKGLEWLVRYYSSSSNHYSPSIQGRFTASKDSSNFYLQMNSLRVEDMAMYYCARRE
Latimeria chalumnae V241 ighv BAHO01298398.1 6381 AQSASILTPSATMEVKNPGESLRLSCKGSGFVFADYAFHWFRQPIGKGLEWVAFISGPEGTTKKYLQSVEGRFTVSRDNANSTFYLQMNSLRFVDAATYYCAAQ
Latimeria chalumnae V240 ighv BAHO01298396.1 7168 VESAVVITYSDPEVKKTGESVRIWCKTSGFTFGDYSMLWYQQLPGKGPRWIAFITYWAGSNIQYIPSVQGRFVISRDNPNSLLYLQMNNLRVEDTAIYYCER
Latimeria chalumnae V239 trdv BAHO01298393.1 20104 SVFGDSVTQPENSLSVSEGGSVKLDCSYSTGHSNPDLYWYRQLPDGTLQFILYRDNSRRKDADFTKGRFLADQTDPQKSFPLTISNVEKGDALMYFCALR
Latimeria chalumnae V238 trdv BAHO01298393.1 20104 SVFGDSVTQPENSLSVSEGGSVKLDCSYSTGHSNPDLYWYRQLPDGTLQFILYRDNSRRKDADFTKGRFLADQTDPQKSFPLTISNVEKGDALMYFCALR
Latimeria chalumnae V237 trbv BAHO01236204.1 3116 ECLNLLANQSPLSVYNSTGGSVEVDCKPTDKSYAYMFWYRKQAEGPKLIGSTASTQDPVYEDGFNSPKFEIRKRDSDLKGSMKISELKVEDSGVYFCAVS
Latimeria chalumnae V235 trbv BAHO01236204.1 6607 DCLTLLANQSPPSVYNSMGGSVEVRCEPTDKSYRNMFWYRQQAEGPKLIGYTLSSQSATYEDKDGFKSPKFEIRKRDSNLKGSMKISDLTIEDSGVYFCAVN
Latimeria chalumnae V234 trav BAHO01236204.1 8279 RGEIVQVTQTPASLHPNAGESTEIHCKQDSNKQYMYWYQQRKREGLKSIGQIYVYADGRKPEYEPGFTSRFEITRIDSKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V233 trav BAHO01236204.1 9567 RGEIVQVTQAPTSIHPNTGNSTEIHCKQHSTKEYMYWYQQRKWEGLKSIGRIYVYADGRKPEYEPGFTSRFEITRIDSKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V232 trbv BAHO01236204.1 11440 NCRTLLADQSPPSVYNSTGGSVEVRCEPTDKSYLNMFWYQQQAEGPKLIGYTLSSQSATYEDKDSFNSPKFEIRKRDSDLKGSMKISDLKIEDSGVYFCAVN
Latimeria chalumnae V231 trav BAHO01236204.1 13188 RGEILQVTQTPASLHPKAGDSTEIHCKQKLNKDYIYWYQQRKREALKSIGYINVLATSGDARNEPGFTSRFEIMRKPGKAGSLKISNLTAEDSAVYFCAVG
Latimeria chalumnae V230 trav BAHO01236201.1 572 RGEIVQVTQTPASLHPNTGNSTEIHCKQISNKNTMYWYQQHTREALKCIGQIYLPGTGGDPVYESGFTSGFQITRIDSKAGSLKISNLTAEDSAMYFCAVG
Latimeria chalumnae V229 trav BAHO01236201.1 1887 HGEIVQVTQTPTSLYPNAGNYMEIQCEQHSNKQYMYWYQQRKREGLKAIGQIFIATKGEKPKYEPGFSSRFEITRNDSKAGSLKISNLTAKDSAVYFCAAG
Latimeria chalumnae V228 trav BAHO01236201.1 3936 RGEIVQVTQTPTSIHPNTGNSMEIQCKQDSNKQYMYWYQQRKQEGLKAIGQILIATKGAKPKYEPGFTSRFEIMGIDSKAGSLKISNLTAEDSAVYFCAVSD
Latimeria chalumnae V302 trgv BAHO01342892.1 3854 GVVSITLEQPELSVTKSVTRTVKLSCRFQGVSIIHWYILRPNEALQRILYYESAAKNGYDQGFNNMSFRAEKKNDECFLVIYNLEMSDTATYYCARWD
Latimeria chalumnae V301 trgv BAHO01342892.1 7443 VSITLEQTQLSVTKSVKRTARMQCEFQGVSKIHWYRLRPNEAPQRILYYESEREKKYDEGFSNVRFQAEKNNDECFLYIHSLEASDTAMYYCAGWD
Latimeria chalumnae V300 trgv BAHO01342892.1 11012 MSITMEQTQLSITKSVTRTAKLSCRFQGSSYIHWYRLRPNEALQRILYYESEAKSEYDAGFSNMKFRAEKNNDECFLYIHSLEMSDTAMYYCAGWD
Latimeria chalumnae V299 trgv BAHO01342891.1 1973 VSITLEQIQPSVTMSVNSIARLPCKFQGVSYIHWYMLRPNEALQQILYYQSAARNGYDQGFTNMRYSAKKKNDECFLVIYNLEMNDTATYYCAGWD
Latimeria chalumnae V298 trgv BAHO01342891.1 6326 VSITLEQTQLSVTKIVNRNVRLQCKFQGVSKIHWYRLRPNEALQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYIYSLEMNDTDTYYCAGWD
Latimeria chalumnae V297 trgv BAHO01342891.1 8947 GVVSITLKQPQVSVTKSVTRTAKLHCKFQGVSYIHWYRLRHNEAPQRILYFESEAKSEYDQGFSNTRFKSQKKNDECFLYIYSLEISDTAIYYCAGWE
Latimeria chalumnae V296 trgv BAHO01342891.1 12442 GVVSIILEQPELSVSKSVTETVKLSCRFQGVSYIHWYILRPNEALQRILYYQSEAKNGYDQGFNKKSLRAEKKNDECFLVIYNLEMSDTATYYCAGWD
Latimeria chalumnae V295 trgv BAHO01342891.1 15485 GAMSITLEQTQPFVTRSVTRTARLQCKFQGVSIIHWYRLRPNEAPQRILYYESETEKRYDEGFNNVKFRAEKKNDECLLFIRSIEMNDTATYYCAGWD
Latimeria chalumnae V294 trgv BAHO01342890.1 992 VSMTLKQPQVSVTKSVTKTVKLHCKFQGVSYIHWYRQRPNEALQRILYYESEAKSEYDQGFSNTRFKSKKKDDECFLYIYSLEISDTAIYYCAGWD
Latimeria chalumnae V293 trgv BAHO01342889.1 2208 GVMSITLEQTQPFVTRSVTRTARLQCKFQGVSKIHWYRLRPNEAPQRILYYESETEQRYDEGFNNVKFTAEKKNDECLLYIRSIEMNDTATYYCAGWD
Latimeria chalumnae V292 trgv BAHO01342889.1 4931 GVVSITLEQLQLSVTKSENNIARLRCKFQGVSKIHWYRLRPNEAPQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYLYSLEMSDTAMYYCAGWE
Latimeria chalumnae V291 trgv BAHO01342889.1 11337 GVVSITLEQTQLSVTKRVNRGVGLQCKFQGTSKIHWYRLRPNEALQRILYYESETEKRYDEGFSNVKYRAKKKNDECFLYIYSLEMSDTATYYCAGWD
Latimeria chalumnae V290 trgv BAHO01342888.1 1207 GVVSITLKQPQVSVTKSVTRTAKLHCKFQGVSYIHWYRLRHNEAPQRILYYESEAKSEYDQGFSNTKFKSKKKDDECFLYIYSLEISDTAIYYCAGWE
Latimeria chalumnae V289 trgv BAHO01342888.1 4699 VSITLEQPELSVSKSVTETVKLSCRFQGVSYIDWYILRPNEALQRILYYESVTKNGYDQGFNKKSFRAEKKNDECFLVIYNLEMSDTATYYCAGWE
Latimeria chalumnae V288 trgv BAHO01342886.1 1741 VSITLEQTQLSVTKSVNRDVRLQCKFQGVSKIHWYRLRPNEASQRILYYESETEKKYDEGFSNVRFIAKKKNDECFLYLYSLEMSDTATYYCAGWD
Latimeria chalumnae V287 trgv BAHO01342885.1 817 GVVSITLEQLQLSVTKSVDSIPRVRCKFQGVSKIHWYRLRPNEAPQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYIYSLEMSDTAMYYCAGWE
Latimeria chalumnae V286 trgv BAHO01342885.1 7239 GVVSITLEEIQPSVTISVNSIAILRCRFQDVSYIHWYILRPNEALQQILYYESEAKSEYDQGFNNMKLRAEKKNDECFLVIYNLEMNDTATYYCAGWD
Latimeria chalumnae V285 trgv BAHO01342884.1 1762 GVMSITLEQTQPSVTRSVTRTARLQCKFQGVSIIHWYRLRPNEAPQRILYYESETEQRYDEGFKNVKFRAEKKNDECLLFIRSIEMNDAATYYCAGWD
Latimeria chalumnae V284 trgv BAHO01342883.1 1294 VSITLEQTQLSVTKNVNRGVRLECKFQGVSKIHWYRLRPNEAPQRILYYESETEKRYDEGFNNVKFKAKKKNDECFLYIQNLEMSDTATYYCAGWD
Latimeria chalumnae V283 trgv BAHO01342881.1 3598 GVVSITLEQTQLSVTKIVNRNVRLECKFQGVSKIHWYRLRPNEAPQRILYYESETEKKYDEGFSNVRFRAEKNRNECFLYIYGLEMNDIATYYCGGWD
Latimeria chalumnae V282 trgv BAHO01342881.1 6222 GVVSITLKQPQVSVTKSVTRTAKLHCKFQGVSYIHWYRLRPNEAPQRILYYESEAKSEYDQGFRNTRFIFQIKNDECFLYIYSLEMSDTAIYYCAGWE
Latimeria chalumnae V281 trgv BAHO01342880.1 3780 VSITLEQTQLSVTKSVNRDVRLQCKFQGVSKIHWYRLRPNEASQRILYYESETEKKYDEGFSNVKFRAEKNNNECFLYIYSLEMSDIATYYCAGWD
Latimeria chalumnae V280 trgv BAHO01342880.1 6817 GVVSITLKQPQVSVTKSVTKTVKLNCKFQGVSYIHWYRLRPNEAPQRILYYESEAKSEYDQGFRNTKFKSQKKNDECFLYINSLEMSDTAMYYCAGWE
Latimeria chalumnae V279 trgv BAHO01342880.1 10413 GVVSITLEQPELSVSKSVTETVKLSCRFQGVSIIHWYILKPNEALQRILYYGSAARNGYDEGFNKKSFRAEKKNDECFLFIYNLEMSDTATYYCA
Latimeria chalumnae V278 trgv BAHO01342880.1 13455 GVMSITLEQTQPSVTKSVTRTARLQCKFQGVSKIHWYRLRPNEAPQRILYYESETEQRYDEGFNNVKFRAEKKNDECFLYIRSIEMNDTATYYCAGWD
Latimeria chalumnae V277 trgv BAHO01342880.1 16173 GVVSITLEQLQLSVTKSEDNIARLCCKFQGVSKIHWYRLRPNEAPQRILYYESETEKRYDEGFSNVRFRAEKNNNECFLYLYSLEMSDTAMYYCAGWE
Latimeria chalumnae V276 trgv BAHO01342880.1 22579 GVVSITLEQTQPSIIKSVNSIARLRCRFQGVSYIHWYILRPNEALQRILYYQSAARNGYDQGFNNMKFRAEKKNDECLLIIYNLEMSDTATYYCAGWD
Latimeria chalumnae V275 trgv BAHO01342878.1 2192 NLTAVTLNQLEPSITKTPERTAKFTCSVSGVANLDNAIIHWYRARADQAPERILYYSSGRAVHDEGFSKAKYSAEKDNNFILRLSNVAEEDNGYYYCAYWD
Latimeria chalumnae V274 trgv BAHO01342878.1 4741 GLAAVTLKQLELSITKPPQRIAKISCQVSDISDIDRAVIHWYRAKADQAPERILYYSSEVKYDPGFTKVKYSANKANDIFSFVVDNVAEEDNGYYYCAYWD
Latimeria chalumnae V273 trgv BAHO01342878.1 8620 VSITLEQTQLSVTKSVNSIARLRCKFQGVSYIHWYRLRPNEALQWILYYESATKKEYVEGFSNMRFKADKSGDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae V272 trgv BAHO01342878.1 11603 VSITLEQTQQSVTKSVNSIARLPCKFQGVSYIHWYILRPNEALQRILYYESEAKGENDQGFSNVRFQAEKISDECFLYIHNIQMSDTATYYCAGWE
Latimeria chalumnae V271 ighv BAHO01325781.1 7657 LTQSDPQVGKPGESLKLKCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHSSSSNYYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCARL
Latimeria chalumnae V270 trgv BAHO01325778.1 1653 IQSDVILTESGGDIKKPGESLRLSCKASGFTFCNYHMHWIRQPPGKALEWIAYISTGGVSTCNLQSVQGRFTISRDNSNNMLYLQMNSLRVELTAIYYCAGD
Latimeria chalumnae V269 ighv BAHO01325777.1 603 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYYMHWIRQPPGKGLEWIAYISGSGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V268 ighv BAHO01316966.1 3178 IQSQIILTESGGDAKKPGESLSLSCKTSGFTISSYYMHWIRQPPGKGLEWVSRLDTGSGKLYSQSVQGRFTISRDNANSMLYLQMNNLRVEDTAMYYCAGD
Latimeria chalumnae V267 ighv BAHO01303430.1 1240 LTQSDPQVGKPGESLKLKCAVVGFNVDSYWMAWIRQAPGKGLEWLIYYVRASATNYYSSSIQGRFTASKDSSNFYLQTNSLRVEDTAMYYCARD
Latimeria chalumnae V266 ighv BAHO01303428.1 2442 LTQSNPQVRKPGESLKLQCAVVGFNVNSYWMAWIRQAAGKGLEWLVYYHTSSNNYYSSSIQGRFTASKDSSSFYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V325 ighv BAHO01448129.1 455 IQSDVILTESGGDVKKPGESLRLSCKASGFDFSSYWMHWVRQPPGKGLEWVAAISYGGGSTYYSQSVQGRFTISREDSNSMLYLQMNSLKVEDTAMYYCASD
Latimeria chalumnae V324 ighv BAHO01448116.1 5857 IQSDVILTESGGDVKKPGESLRLSCKASGFTFSSHWMDWVRQPPGKGLEWVSEIRGSASSTYYSQSVQGRFTISRDNSNSMLYLQMNSLKVEDTAMYYCARE
Latimeria chalumnae V323 ighv BAHO01420064.1 2059 IQSQVNLTESGGDVKKPGESLRLSCKASGFTFSSYWMAWIRQPPGKGLEWIAYINTDGGSTGYLQSVQGRFTISRENSNNMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V322 ighv BAHO01417721.1 16066 LTQSGPEVRKPGESLKLKCAVTGFDVSSYAMDWIRQAPGKGLEWLVRYYDSSNNEYSSSIQGRFTASKDSSNFYLQMNSLRVEDTAMYYCAGE
Latimeria chalumnae V320 trdv BAHO01361505.1 3569 REGLAKLSQLPYKTTKEGESVQILCKDIDTSEIVQWYKQTPQHSQKGLQLMISGYSDENERFNLTTEKKNQSSTLTVKEVQLGDAALYYCAQSDTVTTAGL
Latimeria chalumnae V319 trav BAHO01361505.1 9581 REGASKPEQPPSMEAAEGKEVNLSCTYTLPLTDYIHWYKQTKESLKHLIQAHSGAPNDGRYTLTIAADRKNSTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V318 trgv BAHO01361505.1 14626 NVTEWEREKTTTEGDTVTLGCNYTLTSISTNNLALMWYKQHVNQPLEYLLQVTKYRLKENSTGEKFTSELKTEENSVSLSIPKAELSDSGVYYCALTE
Latimeria chalumnae V317 trav BAHO01361504.1 1070 REGACKPEQPPSMEAAEGKEVNISCTYALPTSDYIHWYKQTKESLKHLIQAHKGTPNEGRYILTTAEDRKNNTLTIRNVGLQDTAVYYCVAAAQ
Latimeria chalumnae V316 trgv BAHO01361504.1 11115 NVTEWDREKTTTEGNTVTMGCNYTLTSISTTNLVVMWYRQHLSRQLEYLLQVATYNTEANSAGEKFLTSELKTEEKLVSLSIPKAELSDSGVYYCALSDTVMQT
Latimeria chalumnae V315 trgv BAHO01361503.1 536 TEGLTKFSQPAHKTAKEGESVQILCEDINTSYLSLWYKQTLQHRQKGLQLMISGYDNDKNEKFNLTIEKKNQSSTLTVKEVQLGDAALYYCAQS
Latimeria chalumnae V314 trav BAHO01361500.1 9740 FCKGDNVTEWDLEKIVIEGDTVTLRCNYIATSTSSPYLMWYKQHLNQPLEYLLQVVKSNAKANSTGEKFLTSELKSEEKLVSLSIPKAELSDSGVYYCALS
Latimeria chalumnae V313 trgv BAHO01361500.1 21561 QECQGKLSQPAYKTAEEGESVQILCKEVDTRYNTLWYKQAPQHSQKGLQLIIYGISNDENKKFTLTVEKENKSITLTIKEAHLGDAGLYYCAESDTVTTAGL
Latimeria chalumnae V312 trav BAHO01361499.1 1583 IHVYGQESKLSHLEAVEGEDIIIPCNHSTAASFTLWYKQLPNKAPQHLISRYSGNLTEGRFTLRITEERRSSKLTVTAVELNDTGVYFCAWQ
Latimeria chalumnae V311 ighv BAHO01361498.1 10976 GEGAAKINQTLAMESLEGHNVILPCKHSLTGDEYVHWYKQTKESLKHLIQTFKDDRNEGRYTLTIAADRKNSTLTIRDVGLQDTAVYYCVAAAQ
Latimeria chalumnae V310 ighv BAHO01361497.1 2564 LGNELQQSVVPLEKEDGSSVKLECTYITSYAYFILYWYKMNLDKTLQYISRYYSADSSSDTDALFQDRFTSTWDTSSSSTTLSIKNLELRDTAVYYCALSD
Latimeria chalumnae V309 trgv BAHO01361490.1 8956 WGLGNEVQQTVPSLNTENGNTVTLECTYTTSFTDYVLYWYKQHADKSLQYISQQRSWGGSDTERLFQNRFTSTFNKQASLTTLTIKNVEFSDTALYYCALRE
Latimeria chalumnae V308 trav BAHO01361490.1 13817 SDVLFQQKELIRTEEGLNVTVECNYTESNPTLFWYRQMQHGKLEYILGRNEYNYKDNAEGFDSFSANVNKNDGTLKMFHLVITGVQVTDSAVYYCALS
Latimeria chalumnae V307 ighv BAHO01361490.1 20097 RGLGNKVQQSVDPLEKENGSSVKLECTYSTSYTYYYLQWYKLNPDKTLQFISSYYSSSSSSYTDALFQNRFTQTLDKSSSRTTLSIRNLELRDTAVYYCALSD
Latimeria chalumnae V306 ighv BAHO01351132.1 9014 IQSAVILTESGGDVKKPGESLRLSCKASGFDFSGYYMGWVQQPPGKGLEWVSTISGPSGSDKYYLQSVQGRFTISRENSNSMVYLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V305 ighv BAHO01351132.1 13688 IQSDVILTESGGDVKRPGESLRLSCKASGFTFSSYEMVWVRQPAGKGLEWIAYISSRSGSSTYYSQSVQGRFTISRDNSNSMLHLQMNSLRVEDTAMYYCARE
Latimeria chalumnae V304 ighv BAHO01345290.1 147 IQSEVILKESGGDVKKPGESLRLSCKGSGFTFSSYHMHWVRQPPGKGLEWVAFIHTGSSSRYYTPSVQGRFTISREDSNSMLYLQMNSLRVEDTAMYYCARD
Latimeria chalumnae V326 ighv BAHO01448132.1 1347 IQSDVILTESGGDVKKPGESLRLSCKASGFDFRNSDMVWVRQPAGKGLEWIAYISSPSGSSTYYSQSVQGRFTISRENSNSMLYLQMNSLKVEDTAMYYCARE
Latimeria chalumnae V321 ighv BAHO01401144.1 6010 VQSDVTLTESGGDVKRPGESLKLSCKASGFDFSSYWMGWVRQPPGKGLEFVSILEDDSDQRLFRQSVQGRFTISRENSISMLYLQMNSLRVEDTAMYYCVKA
Latimeria chalumnae V303 ighv BAHO01345290.1 10987 VHSDIILTESGGDVKKPGESIKLSCKISGFTGHYMEWVRQPPGKGLEWLAQISASSSTVYSKSLQGRFTISRDDSNNMVYLQMSSLREEDTALYYCARL
Latimeria chalumnae V265 ighv BAHO01303427.1 897 LTQYGQEVRNLGESMKLKCTISGFKPDSYWMAWICQAAGKELEWLIYYLRAADANHYFCSNQGRFTASKDSSSFYLQMNSLKVEDMAMYYCARA
Latimeria chalumnae V236 trav BAHO01236204.1 4678 RGEIVQVTQTPASVYPNAGESTKIHCEQNSTKEYMYWYQQRKREGLKSIGQIYVYADGRKPEYEPGFTSRFEITRIDSKAGSLKINNLTAKDSAVYFCAVG
Latimeria chalumnae V227 trbv BAHO01236201.1 5945 HCQTVLVIQFPSSVHKNAGNKVETYCQHNKNDYYYMYWYQQRRAEGVKLIGNTYMTNEAKHEDGFNSSKFQIPQRDQVEKGSMKIVDLGAGDMAVYFCAVSE
Latimeria chalumnae V212 trbv BAHO01236195.1 10014 HGQTVSVQQSPPSVHNSTGGSVELQCEHKSSSYENMLWYQKRRGEGPKLIGYGYGTQEPKYETEEGFEPPKFEIKKEAALKGSLTITELTAADSAVYFCAAS
Latimeria chalumnae V189 trbv BAHO01236186.1 31691 LCQEALKVTQSPKFLIKENGSVELRCEYDSSAVYTILWYRQYRDQKPVFLAYSAGAGVDAQVEKEFKEKFDILRQKTEESFLKIKELKAADTASYLCAVSKAQ
Latimeria chalumnae V156 trbv BAHO01156923.1 18042 KIKGNVVHQEDSLVYVKEKARVKLACNYTTSDASPYLYWYQQYPGDSFRYILGKNKFSTLDSAPGFSRFDAELGKDNTFHLTIENVEITDSAVYFCAFS
Latimeria chalumnae V151 trav BAHO01156920.1 12158 GEPSSEVQQLPDMEFVEGNLVEIHCNHSISSYNNMYWYQQLPNKPPEVILYGYDSADPKGRFSMSFNRNKRETSLIINGTEITDAATYYCAVD
Latimeria chalumnae V113 ighv BAHO01043495.1 244 IQSDVILTESGGGVKKPGESLRLSCKASGFDFRNSDMVWVRQPAGKGLEWIAYISSPSGSSTYYSQSVQGRFTISRENSNSMLYLQMNSLTVEDTAMYYCANE
Latimeria chalumnae V75 igkv BAHO01345325.1 7885 SGGQITLNQSPASKSLSPGESITITCKASSGISSDRLHWYQQKSGQAPWLLLYKTSNCASWAPNRFSGRGSGTDYSLTITNVQVEDAGDYYCQQGNSFP
Latimeria chalumnae V37 ighv BAHO01236176.1 5149 VCSEVIIRQTPRSLSVPVGDPVKLHCSVEGYTLGTPYMYWYKQSPDGAIEMLFLSRVVKMVDDSPVKHLTASRPDNENFELDGKSQRVNDTAVYYCAWS