WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Vicugna pacos JEMW00000000.1 (JEMW01) 144 10 33 10 50 24 7 10
Vicugna pacos ABRR00000000.2 (ABRR02) 132 8 29 9 50 24 4 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Vicugna pacos V0 trav JEMW01000016.1 480 SSIAQTVTQEQPPMSVQQKEAVTLDCTYDTSEPTYSLFWYKQPSSGAMTFLIGQDSHNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V1 trav JEMW01000016.1 4759 RTRGDSVMQMEGPVALSESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V2 trav JEMW01001102.1 3726 TVIEAEIDQPKSRDVAEGEDVTLSCNHPTIGGSDYVHWYRQNPTQSPQYIIHGFRDTVSNHMASLTIATDRKSSTSVLPRVALRGSAVYYCALTE
Vicugna pacos V3 trav JEMW01001102.1 9357 VTGEDVEQSPPVLSLQEGAPSTLWCKFSTTVYNLNWYRQKPGGRLVHLFYVASGTKHDGRFSATTDTQERRSSLNISSSRTTDSATYFCAVSTVLP
Vicugna pacos V4 iglv JEMW01002007.1 21001 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTSSNYPGWYQQTPGQAPRALIYSTNSRHSGVPSRFSGSISGNKATLTITGAQPEDEADYYCA
Vicugna pacos V5 iglv JEMW01002007.1 26477 SWAQSVLTQPPSVSGSPGQKFTISCTGSSSNIGDNYVNWYQHLPGTAPKLLIYGNSNRASGVPERFSGSKSGSSASLTITGLQAEDEADYYCSSWDDSLS
Vicugna pacos V6 iglv JEMW01002008.1 3367 VDSQTVVTQKPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQVLHTLIYSTSSCLSGVPSRFSGSISGNKTTLTITGAQPEDEADYYCAVYIWVVAV
Vicugna pacos V7 iglv JEMW01002008.1 5784 SLSQLVLTQPPSLSASLGASTRLTCTLSSGISVGSYYISWNQQKAGSPPQYLLYDYTDSSKQQDSWVPSRFSGSSANAGLLLISGLQPEDESEYYCSAYISGS
Vicugna pacos V8 iglv JEMW01002008.1 11995 SLSQPVLTQLPSLSASPGASARLTCSLSSGTIVGGYHINWYQQKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGTYHS
Vicugna pacos V9 trbv JEMW01002542.1 14464 SMDTGVTQTPRNRITNTGNSVLLECSQTKGHDYMYWYRQDPGLGLRLIYSSYNVNDTNKGELSNGYRVSRMEKEKFFLFLETPVPSQTAFYLCASSY
Vicugna pacos V10 trbv JEMW01002543.1 1659 LTNADVNQTPRYAVVIGTGKKITLECNQTMDHESMYWYRQDPGMEPQLIHYSHGVNITEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Vicugna pacos V11 trbv JEMW01002543.1 7934 LKDAAVTQSPRHRILKTQQKLILQCSQEMNHYSMYWYRQDPGFGLRLIYYSTGTGTTAEGDVPEGYHVSRDNQTDFPLTLESASTNQTSVYFCASSE
Vicugna pacos V12 trbv JEMW01002543.1 13271 PVEADVTQSPTHRITETRKKLTVTCSQNMNHDAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKDKKDFSLTLESASITQTSLYLCASSV
Vicugna pacos V13 trbv JEMW01002543.1 21625 LMDAKVTQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDPALGLRLLHYSYDVNNVEKGDMPEGYNVSRKKKERFALTLESASTSQTSVYLCASSI
Vicugna pacos V14 trbv JEMW01002543.1 27472 CVFGALVSQKPRRAICQRGVSVTIDCEVNGELISMYWYRQRPGQSLSLMATANQGSQATYESGFAKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Vicugna pacos V15 iglv JEMW01003228.1 1740 SWANSALTQPPSVSGTLGKTVTISCAGTSSDIGGYNYVSWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSKSGNTASLSISGLQSEDEADYICASYTTS
Vicugna pacos V16 trav JEMW01004202.1 3805 GTSGDSVTQTEVPVTLPEEASMFLNCIYQTADSNPYLFWYVQYVNRAPQLLLKGSTGNPRPEHQGFQATLVKSNRTFHLQKPSVQTSDSAMYYCALS
Vicugna pacos V18 trav JEMW01004495.1 9205 TVIEAEIDQPKSKDVAEGEDVTLSCNHSTIGGSDYIHWYRQKPSQSPQYIIQGLRDTVSNHMASLTIATDRKSSTSVLPRVALRGSAVYYCALTE
Vicugna pacos V19 trav JEMW01005980.1 11737 VNGQQIKQIPEFMLLQEGENFTIYCNTSSTIDSLQWYKQQLGGLPVLLMLLTKGGDVKRQGRLTAEFGETRKDSFLRIPAAQTADVGTYFCAE
Vicugna pacos V20 iglv JEMW01006603.1 18689 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTAPKLLIYNANNRASGVPNRFSGSKSGSLASLTITGLQAEDEADYYCGCYDSSLST
Vicugna pacos V21 iglv JEMW01006603.1 22755 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYNTNSRHSGVPSRFSGSISGNKAALTITRAQPEDEADYYCSLYPGS
Vicugna pacos V22 iglv JEMW01006604.1 35691 SVASSALTQPSAVSVSLGQTARITCQGSSLGSSYAHWYQQMPGQAPVLVIYRDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSDN
Vicugna pacos V23 iglv JEMW01006604.1 39300 SVASSVTQPSAASVSLGQTASITCQFGSLGSYYAHWLQQKPGQAPVLVIYNDNSRPSGIPERFSGSRSGDTATLTISGAQAEDEADYYCQVWDSSGYN
Vicugna pacos V24 iglv JEMW01006604.1 43858 SVASYELTQSPSVSVALRQTAKITCGGDNIGSKNAHWYQQKPGQAPVLVIYDDNSRPSGIPERFSGSNSGNTATLTVSGAQAEDEADYYCQVWDSSAN
Vicugna pacos V25 ighv JEMW01008137.1 52895 VQAQVQLVESGGGLVQPGGSLRLSCAASGLTFSSYYMSWVRQAPGKGLESVSSIYSYSSNTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAT
Vicugna pacos V26 trav JEMW01008520.1 1919 GVRGVNVEQSPSALSLQEGTSSTLRCNFSTTVDSVQWFRQNPGGGLIRLFYIASGMKQNGRLNSTLNSKERYSTLHITASQLEDSAAYLCAAE
Vicugna pacos V28 trav JEMW01010905.1 2278 VSSKQHVNQSSEVLTVREGGSLVLNCTYTDSALYSLQWFRQDPGKGLTSLLLIQANQREQTSGRIKASLDQLSRHSALHIAAAQPSDSATYLCAV
Vicugna pacos V29 trav JEMW01010905.1 5738 GAGAQSVTQPDRHGITVPEGARLELRCSYSSSYPPYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRKNETSFHLRKMSAHWSDSAEYFCALG
Vicugna pacos V30 trav JEMW01010905.1 10730 VTGEDVEQSPPVLIVPEGATSTLWCSFSSSLPNVHWYRQNPGGRRIHLFSVASGTKRDGRFSAIAVAKERRSSLNISSSQTADSATYFCAVSTVLP
Vicugna pacos V31 trgv JEMW01012530.1 136927 HLEQPQLSSTKQLSKTARLECVVSGVTMSTTSVYWYRERPGQAVQHLLHVSADNTVSVESGIRPGKFEADKTPDTSTSTLTIHSVGEQDAATYYCALWD
Vicugna pacos V32 trgv JEMW01012530.1 143968 GLGLSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQRRNQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDAGVYYCAGWY
Vicugna pacos V33 trgv JEMW01012530.1 149393 GLMLPQLEQPEVSVTGVRDKSVLLSCKVTSDSFDNDYIHWYQQKPDQGLKQLMYISTASALGDLGGKKNKLEARKYASTSTSTLKISFLKKEDEATYYCALWIS
Vicugna pacos V34 trgv JEMW01012530.1 186209 TQVSSNTDGDKTSVSRKMGSSFVMTCDLNTQSTYYIHWYKFREGTAPRRLFYYDVYYKTTSYDSGINRKKYRAYEGAGKNNILVISDLEDSDSGMYYCAIWEE
Vicugna pacos V35 trgv JEMW01012530.1 190702 TQVSSNMDGDKTSVTRKMGWSFEMTCDLNTQSASYIHWYKFREGTAPRRLFYYDVYYKTTSYDSVINEKKYRAFEGAGKRNTFLISNLEDSDSGTYYCAIWE
Vicugna pacos V36 trgv JEMW01012530.1 195191 TQVSSNTDGDKTSVSRKMGSSFVMTCDLNTQSTYYIHWYKFREGTAPRRLFYYDVSNSKVLLESGISQGKYHAYEGSGKRNTFLISDLEDSDSGMYYCAIWE
Vicugna pacos V37 trgv JEMW01012530.1 223265 DQEEVRLVQPALVMARTRGSTTLPCRAHGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNKDGRSCFLSLMKLEKADEGMYYCAAWD
Vicugna pacos V38 iglv JEMW01014343.1 2786 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQIPGQTPRTLIYRTSNRLSGVPSRFSGSMSGNKATLTITGAQPEDEADYYCDLYMGS
Vicugna pacos V39 iglv JEMW01016136.1 5838 SWAQSALTQPPSVSGTLGKTVTISCAGTSSDVGYGNYVSWYQQLPGTAPKLLIYRVSTRASGIPDRFSGSKSGNTASLTISGLQSEDEADYYCASYRSG
Vicugna pacos V40 trav JEMW01016217.1 1318 GAGAQSVTQPEDHVSVFARAPVQVKCNYSYSGSPLLFWYVQYPKRSLQLLLKHTSKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCALS
Vicugna pacos V41 iglv JEMW01016440.1 35 SPSQPVLTQPPSLSSSPGASARLTCTLSSGTIIAGYHIIWFQQKAGSPPRYLLSYYSDSNKHQGSGVLSRFSGSKDASANAGLLLISGLQPEDEADYYCGTYHS
Vicugna pacos V42 iglv JEMW01016441.1 12265 SFSQPVLSQPPSASASLGASAKLTCTLSSGYSSYSVDWYQQVPGKSPWFLMRVGSSGVGSKGSGVSDRFSGSSSGLERYLTIQNVQEEDEAEYICGADHGSYM
Vicugna pacos V43 trav JEMW01017317.1 2232 GAGAQSVTQPEDHVSVFERAPVQVKCSYSTSGSPLLFWYVQYPKRSLQLLLKHISKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCALS
Vicugna pacos V44 trbv JEMW01017544.1 380596 ALDTGVFQMPKYLISQMGNKMSLKCEQKLGYDSMYWYKQGSEQLLKIMFIYSNKELILNETVPRRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Vicugna pacos V45 trbv JEMW01017544.1 389870 PVDSGVTQTPRHLTKARGQQVTLRCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYLCASSL
Vicugna pacos V46 trbv JEMW01017544.1 393385 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQLLIQYYSGEERDRGNISRRFSGQQCDNSSSELNVSSLELTDSALYLCASSR
Vicugna pacos V47 trbv JEMW01017544.1 397257 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHDYMYWYRQDPGHGLRLIHYSAGSGTTDKGDIPDGYSVSRSDVENFTLTLESATPSQTSVYLCASSY
Vicugna pacos V48 trbv JEMW01017544.1 399601 HTEAGVSQSPRHRVTGRGQNVTLRCDPISGHNGLFWYQQTLGQGLEILTYFQNKDAVDTSGMPDARFSAKRPQGSSSTLEIQRVEPGDSAVYLCASSL
Vicugna pacos V49 trbv JEMW01017544.1 402604 PTDEEITQMPRYCIVPTGHKTVLECSQHMNHFGMFWYRQDPGQGPRLIHYSNDIGSTAEGEVTEGYRASRPEKAHFPLTLESASTNQTSLYLCASSV
Vicugna pacos V50 trbv JEMW01017544.1 407734 PLEAGVTQTPRHLIKTTGQTVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSHSELNVSSLQLSDSALYLCASSL
Vicugna pacos V51 trbv JEMW01017544.1 414667 HTKAGVSQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQMLGQGLEILTYFQNKDAVDTSGMPDARFSAKRPQGSSSTLEIQRVEPGDLAMYLCASSL
Vicugna pacos V52 trbv JEMW01017544.1 422963 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYFTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSVYLCASSN
Vicugna pacos V53 trbv JEMW01017544.1 429385 LTEGGVAQSPGHKITEERQAVALWCDPISGRSFLHWYRQTLERDLELLILFEETAGINVLQSPKNRFSAEGPSGANSTLKIQSAELGDSAVYFCASSL
Vicugna pacos V54 trbv JEMW01017544.1 435710 PTDAGVTQTPRHQVAGMGQAVTLECEPASGHTALFWYRQNSEQGLALLIYFRNQAPVDDTGMPKDRFLAKMTNKSFSTLNIQPAEPRDSATYLCASSI
Vicugna pacos V55 trbv JEMW01017544.1 446502 PTDAGVTQTPRHQVAGMGQAVTLGCEPASGHAALFWYRQTSEQGLALLIYFNNQDPVDDTGMPKDRFLAKMTNKSFSTLNIQPAEPRDSATYLCASSI
Vicugna pacos V56 trbv JEMW01017544.1 449959 HLLAGVAQFPSHRVIEKKQAMSLRCDPISGHEYLVWYQHAVGKEMKFLMSFLRDTVQDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Vicugna pacos V57 trbv JEMW01017544.1 452071 PVGAMVNQTPRYWVTRTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKLLLYYYNTQLNKEADTSDNFQSRRLNTSSCSLDIRSAGVGDSAVYLCASRR
Vicugna pacos V58 trbv JEMW01017544.1 456609 FLEAEVTQTPGHLVKGKGQKAEMCCVPKKGHSYVYWYQQIPAKEFKFLISFQNNNELDKTGMPKERFSAVCYHNSSCTLKIQPTALQDSAVYLCASSE
Vicugna pacos V59 trbv JEMW01017544.1 470498 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDAMYWYRQDPGQRLRLIYFSLSAKDVQKGDIAEGYSASREKKPLFSLTVTLTQKNQTAVYLCASST
Vicugna pacos V60 trbv JEMW01017544.1 473513 SGLGAHVSQHPSRAIREKGASVTFQCHAEDFQAMTVFWYRQFPEQGLTLIATSNQGSNATYEQGFTKDKFPINHPNLTFSSLMVTSVHPADSSLYFCSAS
Vicugna pacos V61 trav JEMW01017908.1 730 GTSGDSVTQTEVPVTLPEEASMFLNCIYQTAGSTPYLFWYMQYVNRAPQLLLKGSTGNPRPEHQGFQATLVKSSRTFHLQKPSVQTSDSAMYYCALR
Vicugna pacos V62 iglv JEMW01018268.1 4941 SWANSALTQPPSVSGTLGKTVTISCAGTSSDIGGYNYVSWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSKSGNTASLSISGLQSEDEADYFCASYTTS
Vicugna pacos V63 ighv JEMW01018463.1 559 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITTSCYAWSWILQPPGKGLEWMGYIAYSGNTYYSPSLKSHTSVSRDTSKNQFSLQLSSVTPEDTAVYYCAR
Vicugna pacos V64 trdv JEMW01019339.1 1412 SGVAQTVTQDQPAVSSHVGETVTLNCRYEASWTEFSEYYIFWYKQPPSGEMTFLIRQGSSSGNAKSGRYSVNFRIAEKSLSLIISNLLLEDSAKYFCALRE
Vicugna pacos V66 iglv JEMW01021172.1 290 SVASYELTQTPSVSVALRQTAKITCGGDNIGSKYAYWYQQKPGQAPVLVIYRDSERPSGIPEWFSGSNSGNTATLTISGAQAKDEADYYCQSYDSSDN
Vicugna pacos V67 ighv JEMW01021803.1 4311 VLSQVQLQESGPGLVKPSQTLSLTCAVYGGSITTSYYYWSWIRQPPGKGLEWMGVIGYEGSTYYSPSLKSHTSISRDTSKNQFSLQLSSVTPEDTAVYYCAR
Vicugna pacos V68 ighv JEMW01022788.1 14505 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITTSYYAWSWIRQPPGKGLEWMGVIAYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDTAVYYCAR
Vicugna pacos V69 trav JEMW01023748.1 972 RTRGDSVMQTEGPVALSESAALTIDCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V70 igkv JEMW01023803.1 6364 SSGDVVLTQTPGSLSVVPGESASISCKASQSLVHTDGKTYLYWLLQKPGQSPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQAIYDP
Vicugna pacos V71 igkv JEMW01023803.1 12714 ARCATQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYYS
Vicugna pacos V72 igkv JEMW01023803.1 24193 SSGDVVLTQTPGSLSVVPGESASISCKASQSLVHTDGKTYLYWLLQKPGQSPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQAIYDP
Vicugna pacos V73 igkv JEMW01023803.1 33614 SSGDLVLTQIPGSLSVTPGEPASISCRSTENLEDSEGDTYLSWYLQKPGQSPQMLIFAGSSRAPGIPDRFTGSGSETAFTLKISGVKAEDAGVYYCAQSL
Vicugna pacos V74 igkv JEMW01023803.1 39268 CWGQIALTQFPESLAASHGSLVSITCRSSMEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Vicugna pacos V75 igkv JEMW01023803.1 43480 ARCATQMTQSSSSLSASLGDRVTITCQASQSISNELSWHQQKPGQTPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYYS
Vicugna pacos V76 igkv JEMW01023803.1 51449 ASGSTELTQTPAILSVSLRESISITCTASESVSDYVSWYQQKPGQAPRLLIYNADNRYSGVPDRFVGLQSGTQFILTINNVEADDTASYYCFQDYPVP
Vicugna pacos V77 igkv JEMW01023803.1 59669 ARCATQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCLQHKLP
Vicugna pacos V78 iglv JEMW01026410.1 2770 YVTTSALTQPSAVSVSLGQTARITCQGGNFGSYYASWYQQKPSQAPVLVIYKDSERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCQSADSSVYN
Vicugna pacos V81 ighv JEMW01027956.1 1598 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITTNYYYWSWIRQPPGKGLEWMGAIAYSGSTYYSPSLKSRTSISRDTSKNQFTLQLSSVTPEDTAVYYCAR
Vicugna pacos V82 trav JEMW01028579.1 693 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSDSDFFPWYKQEPGKSLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITAAQPGDAAVYFCAAS
Vicugna pacos V83 ighv JEMW01029158.1 1075 VQAQVQLVESGGGLVQPGGSLRVSCAASGFTFSSYYMSWVRQAPGKGLEWVSAINTGGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTALYYCAR
Vicugna pacos V84 ighv JEMW01030907.1 5523 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMSWVLQAPGKGLEWVSSIYSYSSNTYYADSVKGRFTISTDNAKNTLYLQMNSLKPEDTVVYYCAA
Vicugna pacos V85 ighv JEMW01030907.1 18096 AHSQVQLVQSGAELRKPGASVKVSCKASGYTFTSYYIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTADTSTSTAYVELSSLRSEDTAVYYCAR
Vicugna pacos V86 trdv JEMW01030914.1 3222 SGVAQTVTQDQPAVSSHVGESVTLNCRYETSWSYYYIFWYKQPPSGEMTFLIRQDYNRGNAKSGRYSVNFRKAESFLSLTISNLQLEDSAKYFCALWE
Vicugna pacos V87 trav JEMW01030914.1 15202 VNGQQLKQIPEFVSLQEGENFTTYCNTSSILSSLQWYKQQPGGRPVFLMTLTKGRDVKSQERLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Vicugna pacos V88 trav JEMW01030914.1 19436 TVIEAEIDQPKSRDVAEGEDVTLPCNHATFGGSDYVHWYRQNPTQSPQYIIHGLRDTVTNHMASLTIATDRKSSTSVLPRVTLRGSAVYYCALTE
Vicugna pacos V89 trav JEMW01030914.1 25282 VTGEDVEQSPPVLSLQEGAASTLWCKFSTSVTSLHWYRQNPGGRLIHLFHVTSGTKHGGRLSATTVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Vicugna pacos V90 trdv JEMW01030914.1 38200 SGVAQTVTQDQPAVSSHVGETVTLNCRYETSWNYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSVNFRKAEKSLSLTISNSQLEDSAKYFCALRE
Vicugna pacos V91 trav JEMW01030914.1 53463 ESTQQLEQSPRFLSIQEGENFTVYCNSSSTFTSFHWYRQSPEEGPVLLVILTKGGEMKTQKRLKARFGETRKDSSLSSTAAQPGDAGVYLCAG
Vicugna pacos V92 trav JEMW01030914.1 58249 LRVQMKVEQSPGVLTLQGGENSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSTTYFCAVE
Vicugna pacos V93 trdv JEMW01030914.1 66955 SGMAAKVTQTQATETAQEGQAVTMHCTYETMASRYTLYWYKRAPSGGMAFLIYQDDNKANAKRDRYSVNFQKANRSISLTISSSQLADSGKYFCALWD
Vicugna pacos V94 trav JEMW01030914.1 74726 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLNWYKQEEKGLAFLFVLISTGTEKKSGRFKGTLDKKELLGTLHITATEPEDSATYLCAVE
Vicugna pacos V95 trav JEMW01030914.1 79642 PGRADWMRPQETEVSGTVGKTVSLLCNYDTSSVGPVDLYWFRQYPNQAPEYILHRGWRHAGKGYASFATERFYSENTANTTSLYIRSVVPADAALYHCALYSE
Vicugna pacos V96 trdv JEMW01030914.1 98043 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDHYLFWYKQPPSGEMIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAVMYFCAYSG
Vicugna pacos V97 trav JEMW01030915.1 2765 LNAEVNVEQSPPSLSIQEGEDCTIYCNYSSSTSDQLHWYRQDPGKSLEFLFLLVSSGAVKQEGQLTASLDTKARRSTLHITASQPGFSATYFCALD
Vicugna pacos V98 trav JEMW01030915.1 16025 GTSGNSVQQTGQVTVSEGASVTMNCTYTSTGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNVKDKTSPITIYPTQIADSAVYYCLLRLTVPR
Vicugna pacos V99 trav JEMW01030915.1 19967 ISGENEVEQSPLYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPGDSAIYICAVA
Vicugna pacos V101 trdv JEMW01030915.1 81945 VSLGIILEPETQTLTALLGGPATFRCNVSGGDLVSYQMSWYKKNEDQSLTLVYRQGNHATEGARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Vicugna pacos V102 trdv JEMW01030915.1 102334 IMSADVLVPQEAAVTVSVGGSVTLRCSMKGGSISDYYNYWYKKIPGSTMTFVFQEGGTYGPGFQENFRGEVDQVNNQVLLEILKASERDKGSYYCA
Vicugna pacos V103 trav JEMW01068872.1 306 VSSKQHVNQSSEVLTVREGGSLVLNCTYTDSALYSLQWFRQDPGKGLTSLLLIQANQREQTSGRIKASLDQLSRHSALHIAAAQPSDSATYLCAV
Vicugna pacos V105 trav JEMW01000680.1 310 MRSRHKGAAQILNVPEGATASLICSYSVSDSRNFMWYRQYSGRGPERLMTFYPNNDKKEGRFTAQVNKTSRYVSLLIRDSQPSDSAAYLCAES
Vicugna pacos V106 trbv JEMW01002545.1 15870 VRAQTIHQRPPTVVQPIGSSLSLECTVKGTSNPRLYWYRQAAGGALQLLFYSFSADRVESEEPQNFEASISQDGPFILSSKKLLLNNSGFYLCAWS
Vicugna pacos V107 trav JEMW01003318.1 5391 GVRGVNVEQSPSALSLQEGTSSTLRCNFSAAVKNVQWFRQNPGGGLIRLFYIASGMKQNGRLNSTLNSKERYSTLHITASQLEDSAAYLCAAE
Vicugna pacos V108 ighv JEMW01008137.1 68286 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSAISWNGGSTYYAESMKGRFTISRDNAKNTLYLQMNSLKSEDTAVYYCAK
Vicugna pacos V109 trav JEMW01008710.1 3476 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSASLFWYVQYLNKGPELLLKSSSENQKVVRGRFQATLVKSDRTFHLQKPSVQTSDSAVYYCALG
Vicugna pacos V110 trav JEMW01008712.1 427 MRSHQKGAAQSLNVPEGATASLTCSYSDSNSRNFMWYRQYLGRGPERLMTFYSNNDKKEGRFTAQVNKTSHYVSLLIRDSQPSDSAAYLCAES
Vicugna pacos V111 trav JEMW01009573.1 3270 ASSKQHVNQSSEVLTVREGGSLVLNCTYTDSALYSLQWFRQDPGKGLTSLLLIQANQREQTSGRIKASLDQLSRHSALHIAAAQPSDSATYLCAV
Vicugna pacos V112 iglv JEMW01009660.1 12109 SLSQPVLTQLSSLSASLGASARLTCTLSSGFKVGDFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFSGSSDASANAGLLLISGLQHEDEADYYCAT
Vicugna pacos V113 iglv JEMW01009660.1 1184 SWAQSVLTQLPSVSGSPGQKITISCTGSSSNIGGGYSVQWFQQLPGTPPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEADYYCECYDNSLSG
Vicugna pacos V114 iglv JEMW01011389.1 591 SVASSALTQPSTVSVSLGQTAKITCQGGSLGSYYAHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSRSGGTASLTISGIQAEDEADYYCLSADSSDYN
Vicugna pacos V116 trav JEMW01014533.1 54063 GSNEDSVTQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNETGSNKGFKATYHRKQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V117 trav JEMW01014533.1 48765 DARAQTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCHGLQLLLKYFSGDPLVQGIKGFEAEYKRSESSFNLRKSSVHWSDSAEYFCAVS
Vicugna pacos V118 trav JEMW01014533.1 38807 GVRGMNVEQSPSALSIQEGTSSTLRCNFSNPVNYVQWFRQNPGGGLIRLFYITSGMKQNGRLNSTLNSKERYSTLHITASQLEDSAAYLCAAE
Vicugna pacos V119 trav JEMW01014533.1 32136 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSASNYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITAAQPGDAAVYFCAAS
Vicugna pacos V120 trav JEMW01014533.1 27427 SSIAQTVTQDQPPMLVQEKEAVTLNCTYETSEPTYSLFWYKQPSSGATTFLIGQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V121 trav JEMW01014533.1 20983 RTRGDSVMQTEGPVTLSESAALTMNCNYSTTGYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHKEQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V122 trav JEMW01014533.1 14260 VSQGKNVEQSPPSLSVQEGNSSVITCTYTDSNSDFFPWYKQEPGKGLQFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITAAQPGDAAVYFCAAS
Vicugna pacos V123 trav JEMW01014533.1 9363 SSIAQKVTQDQPPMLVQEKEAVTLKCTYDTSDTTYSLFWYKQPSSGAMTFLIGQDTYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V124 trav JEMW01014533.1 5502 RTRGDSVMQTEGPVTLSESAALTITCNYSTTGYPTLFWYVQYPGEGPQLLLKTSKDKEKVLKKGFEATYHREPNSFHLEKASVQGADSAVYYCALG
Vicugna pacos V125 trav JEMW01014534.1 65264 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSSFNGLSWYQQHDGGAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELRTKDSASYLCAVI
Vicugna pacos V126 trav JEMW01014534.1 13229 GLRAQSVTQLKEPITVAEGEPLTVKCTYSLSGTPYLFWYVQYPNQGLQFLLKYIAGDNLVKGNYGFEAEFNKSQTSFHLKKASVQGSDSALYFCAVT
Vicugna pacos V127 trav JEMW01014534.1 7410 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATNEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Vicugna pacos V128 trav JEMW01014534.1 1410 GAGAQSVTQPDRHGITVPEGARLELRCNYSSTYSPSLFWYVQYPNQGPQLLLKYVSGNSFVSGIKGFMAEFRRNETSFHLKKTSAHWSDSAEYFCVLG
Vicugna pacos V129 iglv JEMW01017612.1 20986 CADSAALPLWVSGIIARLTCTLSSGNNVGGDTVYWYQQKAGSPPRYFLYYYSDSSKHQGSGVPSRFSGSKDASANTGLLLTSGLQPEDEADYYCAMFLGNPVT
Vicugna pacos V130 iglv JEMW01017612.1 3916 TVAQARLTQPRSVTASPGQTATLTCTGDSHSVGNEGAAWLQQHPGQAPRLLTLGNNQRPSGVSERFSGSRSGSTATLSISGLQAEDEADYYCSAWDSSLSA
Vicugna pacos V131 trav JEMW01018271.1 818 GVRGVNVEQSPSALSLQEGTSPTLRCNFSTTVNNVQWFRQNPGGGLIRLFYIASGMKQNGRLNSTLNSKERYSTLHITASQLEDSAAYLCAAE
Vicugna pacos V132 trav JEMW01018701.1 2544 VTGEDVEQSPPVLSLQDGATSTLWCKFSSSVTSVQWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSWTTDSAPYFCAVSTVLP
Vicugna pacos V134 ighv JEMW01021504.1 3750 VQAQVQLVESGGGLVQAGGSLRHSCAASGLTFGSYAMGWYRQAPGKERELVAAISSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAK
Vicugna pacos V135 igkv JEMW01023803.1 68030 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKNYLAWYQQRPGQSPRLLIYWASTRESGVPDRFSGSGSTTDFTLTISSFQPEDAAVYYCQQGYSA
Vicugna pacos V136 igkv JEMW01023803.1 56619 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVVSGSNQKSYLNWYQQRPGQSPRLLIYYASTQESGIPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Vicugna pacos V137 iglv JEMW01024525.1 5171 SVASSALTQPSTVSVSLGQTARITCQGGNFGSYYASWYQQKPGQAPVRVIYGNSNRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSGYN
Vicugna pacos V138 trdv JEMW01027781.1 12332 SGVAQTVTQDQPAISSHVGETVTLNCRYETSYTQYYIFWYKQPPSGEMTFLIRQSSSSGNAKNGRYSVNFRKAEKSLSLSIPNLLLEDSAKYFCALEE
Vicugna pacos V139 trav JEMW01027781.1 4267 ANLLLSMKQSPPRLHVQERESTSATCSFPSSSFYALHWYRWERAKSAQNLFVTSLNGDEKEEGRIRVTLNTKDGHSYLYIKGPQPEDSATYLCA
Vicugna pacos V140 trav JEMW01027782.1 6678 VTGEDVEQSPPALSVQEGVTSTLWCKFSTTVSNLNWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSRTTDSATYFCAVSTVLP
Vicugna pacos V141 iglv JEMW01028476.1 13738 SWAQSALTQPPSVSGSPGKTVTISCAGTSSDVGYGNYVSWYQQLPGMAPKLLIYDVNKRASGIADRFSGSKSGNTASLTISGLQSEDEADYYCASYRSSNN
Vicugna pacos V142 iglv JEMW01028476.1 7616 YVASSALTQPSAVSVSLGQTARITCQGGNFGSYYPHWYQQKPGQAPVLVIYQYNNRPSGIPERFSGTKSGDTATLTISGAQAEDEADYYCQMWDSSAN
Vicugna pacos V143 iglv JEMW01028476.1 3697 YVASSALTQPSALSVTLGQTAKITCQGGSLGSSYAHWYQQKPGQAPVLVIYDDDSRPSGIPERFSGSSSGGRATLTISGAQAEDEGDYYCQSADSSGN
Vicugna pacos V144 trdv JEMW01028483.1 19804 SGVAQTVTQDQPAVSSHVGETVTLNCRYETTYSTYYIFWYKQPPSGEMTFLIRQDYNLQNVKSGRYSVNFRKAEKSLSLTISNLLLEDSAKYFCALRE
Vicugna pacos V145 trav JEMW01028483.1 8385 VNGQQLKQFPEFISLQEGENFTTYCNTSSILSSLQWYKQQPGGRPVFLMLLTKGGDVKRQGRLTAWLGETKKDSFLRIPAAQTADVGTYFCAE
Vicugna pacos V146 iglv JEMW01029522.1 74439 ASSALTQPSTVSVSLGQTAKITCQGGSLESDYAHWYQQKPGQAPVLVIYRDSKRPSGIPEQFSGSSSGGTATLTISGAQAEDEADYYCQSYDSSGYN
Vicugna pacos V147 iglv JEMW01029522.1 65844 SVVSYELIQSPSVSVALRQTAKITCGGNNIGSKSAQWYQQKSGQTPVQVIYADSRRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSAN
Vicugna pacos V148 iglv JEMW01029522.1 61943 YVASSALTQPSTVSVSLGQTARITCQGGSLGSYDAHWYQQKPGQAPVLVIHDDNSRPSGIPERFSGSRSGGTATLTISGAQAEDEADYYCQSYDSSAN
Vicugna pacos V149 iglv JEMW01029522.1 41928 SWAQSALTQPPSVSRTPGQTVTISCAGTSNDIGRYNYVSWYQQLPGTAPKLLIYEGTSRTSGIPDRFSGSKSGNTASLSISGLQSKDEAGYFCASYTTS
Vicugna pacos V150 iglv JEMW01029522.1 31325 SVASSALTQPSALSVSLGQTARITCRGDSLERYGANWYQQKPGQARVQVIYGDDIRPSGIPERFSGSRLGGTATLTISGAQAEDEADYYCQSSDSNGYN
Vicugna pacos V151 trdv JEMW01030915.1 176681 KGVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPGLYWYRMRPGFSLEFVLYRDNTESLNADFAQGRFSVQHNETQETFHLVISSVWAEDSATYYCALEY
Vicugna pacos V152 iglv JEMW01073257.1 523 SFSQPVLSQPPSASASLGASAKLTCTLSSGYSSYSVDWYQQVPGKSPWFLMRVGSSGVGSKGSGVSDRFSGSSYGLERYLTIQNVQEEDEAEYICGADHGSYM
Vicugna pacos V0 igkv ABRR02049307.1 5454 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKNYLAWYQQRPGQSPRLLIYWASTRESGVPDRFSSSGSTTDFTLTISSFQPEDVAVYYCQQGYSA
Vicugna pacos V1 igkv ABRR02049309.1 7871 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVVSGSNQKSYLNWYQQRPGQSPRLLIYYASTQELGIPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Vicugna pacos V2 trbv ABRR02092482.1 13494 ALDTGVFQMPKYLISQMGNKMSLKCEQKLGYDSMYWYKQGSEQLLKIMFIYSNKELILNETVPRRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Vicugna pacos V3 trbv ABRR02092482.1 22769 PVDSGVTQTPRHLTKARGQQVTLRCFPISGHTSVSWYQQAPSEGPQFLFEFYGKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYLCASSL
Vicugna pacos V4 trbv ABRR02092482.1 26287 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQLLIQYYSGEERDRGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Vicugna pacos V5 trbv ABRR02092482.1 30159 PVNAGVIQTPKFQVLKIGQGVTLKCPQDLKHDYMYWYRQDPGHGLRLIHYSAGSGTTDKGDIPDGYSVSRSDVENFILTLESATPSQTSVYLCASSY
Vicugna pacos V6 trbv ABRR02092482.1 32535 HTEAGVSQSPRHRVTGRGQNVTLSCDPISGHNGLFWYQQTLGQGLEILTYFQNKDAVDTSGMPDARFSAKRPQGSSSTLEIQRVEPGDSAVYLCASSL
Vicugna pacos V7 trbv ABRR02092482.1 35534 PTDEEITQMPRYCIVPTGHKTVLECSQHMNHFGMFWYRQDPGQGPRLIHYSNDIGSTAEGEVTEGYRASRPEKAHFPLTLESASTNQTSLYLCASSV
Vicugna pacos V8 trbv ABRR02092482.1 40661 PLEAGVTQTPRHLIKTTGQTVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFSDSRSELNVSSLQLSDSALYLCASSL
Vicugna pacos V9 trbv ABRR02092483.1 6206 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYFTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSVYLCASSN
Vicugna pacos V10 trbv ABRR02092486.1 4135 PTDAGVTQTPRHQVAGMGQAVTLECEPASGHTALFWYRQNSEQGLALLIYFRNQAPVDDTGMPKDRFLAKMPNDSFSTLNIQPAEPRDSATYLCASSI
Vicugna pacos V11 trbv ABRR02092488.1 4396 PTDAGVTQTPRHQVAGMGQAVTLGCEPASGHAALFWYRQTSEQGLALLIYFNNQDPVDDTGMPKDRFLAKMTNKSFSTLNIQPAEPRDSATYLCASSI
Vicugna pacos V12 trbv ABRR02092488.1 7731 HLLAGVAQFPSHRVIEKKQAMSLRCDPISGHEYLVWYQHAVGKEMKFLMSFLRDTVQDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Vicugna pacos V13 trbv ABRR02092488.1 9821 PVGAMVNQTPRYWVTRTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKLLLYYYDTQLNKEADTSDNFQSRQLSTSSCSLDIRSAGVGDSAVYLCASSR
Vicugna pacos V14 trbv ABRR02092488.1 14363 FLEAEVTQTPGHPVKGKGQKAEMCCVPKKGHSYVYWYQQIPAKEFKFLISFQNNNELDRTGMPKERFSAVCYQNSSCTLKIQPTALQDSAVYLCASSE
Vicugna pacos V15 trbv ABRR02092488.1 28250 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDAMYWYRQDPGQRLRLIYFSLSAKDVQKGDIAEGYSASREKKPLFSLTVTLTQKNQTAVYLCASST
Vicugna pacos V16 trbv ABRR02092488.1 31265 SGLGAHVSQHPSRAIREKGASVTFQCHAEDFQAMTVFWYRQFLEQGLTLIATSNQGSNATYEQGFTKDKFPINHPNLTFSSLMVTSVHPADSSLYFCSAS
Vicugna pacos V17 trbv ABRR02092488.1 38881 SMDTGVTQSPGHLVRGKEQRAKMHCVPIKGHNYVYWYRKKLEGAFEFLVYLRNGGNVMEEAEGFKQRFSAECPPNPPCSLEINSTQAGDSARYFCASSK
Vicugna pacos V18 trbv ABRR02092488.1 45095 SMDTGVTQSPGHLVRGKEQRAKMHCVPIKGHNYVYWYRKKLEGAFEFLVYLQNEHIIQKTEGFEQQFSHKCPKNSPCSLEINSTQPGDSARYFCASSK
Vicugna pacos V19 trbv ABRR02092488.1 59677 SMDTGVTQTPRNRITNTGNSVLLECSQTKGHDYMYWYRQDPGLGLRLIYSSYNVNDTNKGELSNGYRVSRMEKEKFFLFLETPVPSQTALYLCASSY
Vicugna pacos V20 trbv ABRR02092489.1 655 LTNADVNQTPRYAVIGTGKKITLECNQTMDHESMYWYRQDPGMEPQLIHYSHGVNITEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Vicugna pacos V21 trbv ABRR02092489.1 6939 LKDAAVTQSPRHRILKTQQKLILQCSQEMNHYSMYWYRQDPGFGLRLIYYSTVTGTTAEGDVPEGYHVSRDNQTDFPLTLESASTNQTSVYFCASSE
Vicugna pacos V22 trbv ABRR02092491.1 610 PVEADVTQSPTHRITETRKKLTVTCSQNMNHDAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKDKKDFSLTLESASITQTSLYLCASSV
Vicugna pacos V23 trbv ABRR02092494.1 2064 LMDAKVIQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDPALGLQLLHYSYGVDIVEKGDMPEEYNVSRKKKERFALTLESASTSQTSVYLCASSI
Vicugna pacos V24 trbv ABRR02092494.1 7714 SVFGALVSQKPRRAICQRGVSVTIDCEVNGELISMYWYRQRPEQSLSLMATANQGSQATYESGFAKEKFPISHPSLNFSVLTVSSVSPEDSSSYFCSA
Vicugna pacos V25 iglv ABRR02116782.1 1189 YVASSALTQPSTVSVSLGQMARITCQGGSLGSYDAHWYQQKPGQAPVLVIHDDNSRPSGIPERFSGSRSGGTATLTISGAQAEDEADYYCQSYDSSAN
Vicugna pacos V26 iglv ABRR02116782.1 5346 SVASSALTQPSALSVSLGQTARITCQGGNFGSSYAFWYQQKPGQAPVLIIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAQDEADYYCQSGSSSAN
Vicugna pacos V27 iglv ABRR02116784.1 6857 SWAQSALTQPPSVSRTPGQTVTISCAGTSNDIGRYNYVSWYQQLPGTAPKLLIYEGTSRASGIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Vicugna pacos V28 iglv ABRR02116784.1 12824 SWAQSALTQPPSVSGTLGKTVTISCAGTSSDVGSGNYVSWYQQLPGTAPKCLIYQVNKRASGIPDRVSGSKSGNTASMTISGLQSVDEADYYCASYRSG
Vicugna pacos V29 iglv ABRR02116785.1 2468 SVASSALTQPSAVSVSLGQTARITCRGDSLERYGANWYQQKPGQARVQVIYGDDIRPSGIPERFSGSRLGGTATLTISGAQAEDEADYYCQSSDSSGYN
Vicugna pacos V30 trav ABRR02141926.1 320 TVIEAEIDQPKSKDVAEGEDVTLPCNHATFGGSDYIHWYRQKPSQSPQYIIQGLQDTVSNHMASLTIATDRKSSTLVLPRVALRGSAVYYCALTE
Vicugna pacos V31 trav ABRR02141937.1 1052 ESTQQLEQSPRFLSIQEGENFTVYCNSSSTFTSFHWYRQSPEEGPVLLVILTKGGEMKTQKRLKARFGETRKDSSLSSTAAQPGDAGGYLCAG
Vicugna pacos V32 trav ABRR02141937.1 5835 LRVQMKVEQSPGVLTLQGGENSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Vicugna pacos V33 trav ABRR02141940.1 3126 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLNWYKQEEKGLAFLFVLISTGTEKKSGRFKGTLDKKELLGTLHITATEPEDSATYLCAVE
Vicugna pacos V34 trav ABRR02141941.1 3127 PGRADWMRPQETEVSGTVGKTVSLLCNYDTSSVGPVDLYWFRQYPNQAPEYILHRGWRHAGKGYASFATERFYSENTANTTSLYIRSVVPADAALYHCALYSE
Vicugna pacos V35 trdv ABRR02141942.1 2342 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDHYLFWYKQPPRGEMIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAVMYFCAYSG
Vicugna pacos V36 trav ABRR02141944.1 1429 LNAEVNVEQSPPSLSIQEGEDCTIYCNYSSSTSDQLHWYRQDPGKSLEFLFLLVSSGAVKQEGQLTASLDTKARRSTLHITASQPGFSATYFCALD
Vicugna pacos V37 trav ABRR02141947.1 1820 GTSGNSVQQTGQVTVSEGASVTMNCTYTSTGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNVKDKTSPITIYPTQIADSAVYYCLLRLTVPR
Vicugna pacos V38 trav ABRR02141947.1 5763 ISGENEVEQSPLYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPGDSAVYICAVA
Vicugna pacos V40 trdv ABRR02141948.1 42973 VSLGIILEPETQTLTALLGGPATFRCNVSGGDLVSYQMSWYKKNEDQSLTLVYRQGNHATEGARSKFKGKIDALKSQYILDIQNATAEDVGTYYCGSD
Vicugna pacos V41 trdv ABRR02141948.1 63360 IMSADVLVPQEAAVTVSVGGSVTLRCSMKGGSISDYYNYWYRKIPGSTMTFVFQEGGTYGPGFQENFRGEVDQVNNQVLLEILKASERDKGSYYCA
Vicugna pacos V43 trav ABRR02151930.1 1790 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSSFNGLSWYQQHDGGAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELRTKDSASYLCAVI
Vicugna pacos V44 trav ABRR02151940.1 5901 GLRAQSVTQLKEPITVAEGEPLTVKCTYSLSGTPYLFWYVQYPNQGLQFLLKYIAGDNLVKGNYGFEAEFNKSQTSFHLKKASVQGSDSALYFCAVT
Vicugna pacos V45 trav ABRR02151941.1 3879 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATNEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Vicugna pacos V46 trav ABRR02151942.1 2603 GAGAQSVTQPDRHGITVPEGARLELRCNYSSTYSPSLFWYVQYPNQGPQLLLKYVSGNSFVSGIKGFMAEFRRNETSFHLKKTSAHWSDSAEYFCVLG
Vicugna pacos V47 trav ABRR02151944.1 235 GSNEDSVTQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNETGSNKGFKATYHRKPNSFHLEKASVQGADSAVYYCALS
Vicugna pacos V48 trav ABRR02151946.1 912 DARAQTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCHGLQLLLKYFSGDPLVQGIKGFEAEYKRSESSFNLRKSSVHWSDSAEYFCAVS
Vicugna pacos V49 trav ABRR02151958.1 817 SSIAQTVTQDQPPMLVQEKEAVTLNCTYETSEPTYSLFWYKQPSSGATTFLIGQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V50 trav ABRR02151959.1 5673 RTRGDSVMQTEGPVTLSESAALTMNCNYSTTGYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHKEQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V51 trav ABRR02151959.1 12379 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSNSDFFPWYKQEPGKSLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQPGDAAVYFCAAS
Vicugna pacos V52 trav ABRR02151963.1 61 RTRGDSVMQTEGPVTLSESAALTINCNYSTTGYPTLFWYVQYPGEGPQLLLKTSKDKEKVLKKGFEATYHREPNSFHLEKASVQGADSAVYYCALG
Vicugna pacos V53 trav ABRR02151973.1 913 RTRGDSVMQTEGPVTLSESAALTMNCNYPAAGYPTFFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHRAQTSFHLEKASVQESDSAVYYCALS
Vicugna pacos V54 trav ABRR02151984.1 1346 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSDFLFWYVQYLNKGPELLLKSSSENQKVVRGGFQATLVKSDRTFHLQKPSVQMSDSAVYYCALN
Vicugna pacos V55 iglv ABRR02160168.1 1032 SWAQSVLTQPPSVSGSPGQKFTISCTGSSSNIGDNYVNWYQHLPGTAPKLLIYSNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEADYYCSSWDDSLS
Vicugna pacos V56 iglv ABRR02160173.1 256 VDSQTVVTQKPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQVLHTLIYSTSSCLSGVPSRFSGSISGNKTTLTITGAQPEDEADYYCAVYIWVVAV
Vicugna pacos V57 iglv ABRR02160173.1 2672 SLSQLVLTQPPSLSASLGASTRLTCTLSSGISVGSYYISWNQQKAGSPPQYLLYDYTDSSKQQDSWVPSRFSGSSANAGLLLISGLQPEDESEYYCSAYISGS
Vicugna pacos V58 iglv ABRR02160173.1 8909 SLSQPVLTQPPSLSASPGASARLTCSLSSGTIVGGYHINWYQQKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGTYHS
Vicugna pacos V59 iglv ABRR02160175.1 887 SFSQPVLSQPPSASASLGASAKLTCTLSSGYSSYSVDWYQQVPGKSPWFLMRVGSSGVGSKGSGVSDRFSGSSSGLERYLTIQNVQEEDEAEYICGADHGSYM
Vicugna pacos V60 iglv ABRR02160179.1 11026 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTAPKLLIYNANNRASGVPNRFSGSKTGSLASLTITGLQAEDEADYYCGCYDSSLST
Vicugna pacos V61 iglv ABRR02160179.1 15090 VDSQTVVTQEPSLSASPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYSTSSRHSGVPSRFSGSISGNKAALTITGAQPEDEADYYCALDIGSYT
Vicugna pacos V62 iglv ABRR02160183.1 4697 SVASSALTQPSAVSVSLGQTARITCQGSSLGSSYAHWYQQMPGQAPVLVIYRDSERPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSADSSDN
Vicugna pacos V63 iglv ABRR02160183.1 8311 SVASSVTQPSAVSVSLGQTASITCQFGSLGSYYAHWLQQKPGQSPVLVIYNDNSRPSGIPERFSGSRSGDTATLTVSGSQAEDEADYYCQVWDSSGYN
Vicugna pacos V64 iglv ABRR02160184.1 1274 SVASYELTQSPSVSVALRQAAKITCGGDNIASKYAHWYQQKPGQSPVLVIYKDSNRPSGIPERFSGSNSGNTATLTVSGAQAEDEADYYCQVWDSSAN
Vicugna pacos V65 iglv ABRR02160190.1 854 YVASSALTQPSAVSVSLGQTARITCQGGNLGSYYGSWYQQKPGQAPVQVIYGNSNRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSYESSGYN
Vicugna pacos V66 ighv ABRR02161859.1 6024 VQAQVQLVESGGGLVQPGGSLRLSCAASGLTFSSYYMSWVRQAPGKGLESVSSIYSYSSNTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAT
Vicugna pacos V67 trav ABRR02163402.1 1060 VTGEDVEQSPPVLIVPEGAPSTLWCSFSSSLPNVHWYRQNPGSRLIHLFYVASGMKHDGRFSATAFAKERRSSLNISSSQTADSATYFCAVSTVLP
Vicugna pacos V68 trdv ABRR02163404.1 5700 SGVAQTVTQDQPAVSSHVGETVTLNCRYETSDSIYYIFWYKQPPSGEMTFLIRQDSSSGNAKSGRYSVNFWKAEKSLSLTISNLQLEDSAKYFCVLRE
Vicugna pacos V69 trav ABRR02163414.1 2488 VTGQDVEQSPPVLSLQEGATSTLWCKFSTTVSNVQWYCQNSGGRLIHLFYVASGTKHDGRFSATAVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Vicugna pacos V71 trav ABRR02163421.1 2981 RARGDSVMQTEGPVTLSESAALTMNCNYSAARYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREPSSFHLEKASVQGADSAVYYCALS
Vicugna pacos V72 trav ABRR02163422.1 2623 GVRGVNVEQSPSALSLQEGTSPTLRCNFSTTVNNVQWFRQNPGGGLIRLFYIASGMKQNGRLNSTLNSKERYSTLHITASQLEDSAAYLCAAE
Vicugna pacos V73 trav ABRR02163422.1 5896 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSNSEYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITAAQPGDAAVYFCAAS
Vicugna pacos V74 trav ABRR02163427.1 704 RTRGDSVMQTEGPVALSESSALTINCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKDKVLKKGFEATYHREQTSFHLEKASVQESDSAVYYCALS
Vicugna pacos V75 trav ABRR02163431.1 1776 MRSQQKGAAQSLNVPEGATASLTCSYSVSDFQYFMWYRQYSGRGPEWLMTFYSNNETKEGRFTAQVNKTSHYVSLLIRDSQPSDSAAYLCAES
Vicugna pacos V76 trav ABRR02163433.1 393 GAGAQSVTQPEDHVSVFARAPVQVKCNYSYSGSPLLFWYVQYPKRSLQLLLKHTSKESLKGFTADLNRREASFHLKKPSAQEEDSAMYYCALS
Vicugna pacos V77 trav ABRR02163434.1 515 GTSGDSVTQTEVPVTLSEQELLMLNCTYQTTDSDPYLFWYVQYVNKAPQLLLKGSTTNPRPEHQGFQATLDKSSRNFHLQKPSVQTSDSAVYYCALG
Vicugna pacos V78 trdv ABRR02165380.1 1330 SGVAQTVTQDQPAVSSHVGESATLNCRYETSYSTYYIVWYKQPPSGEMTFLIEQDSSSENAKSGRYSVNFWKAEKSLSLTISNLQLEDSAKYFCAFDG
Vicugna pacos V79 ighv ABRR02167421.1 3501 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITTSYYAWSWIRQPPGKGLEWMGVIAYDGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDTAVYYCAR
Vicugna pacos V80 iglv ABRR02168462.1 3004 YVASSALTQPSMVSVSLGQTARTTCQGGSLGSYGANWYQQKPGRAPVLVIYEDSKRPSGIPEWFSGSKSGGPATLTISGAQAEDEADYYCQVWDSSGYN
Vicugna pacos V81 iglv ABRR02168466.1 579 YVASSALTQPSALSVTLGQTAKITCQGGSLGSSYAHWYQQKPGQAPVLVIYDDDSRPSGIPERFSGSSSGGRATLTISGAQAEDEGDYYCQSADSSGN
Vicugna pacos V82 iglv ABRR02171824.1 5014 SVTSYELTQQASVSVDLQQTASITCSGDLLDKKYTQWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGKTATLTISGAQAEDEADYYCHSADSSDN
Vicugna pacos V83 ighv ABRR02172586.1 2356 AHSQVQLVQSGAELRNPGASVKVSCKASGYTFTSYYIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTADTSTSTAYVELSSLRSEDTAVYYCAR
Vicugna pacos V84 ighv ABRR02173559.1 457 VQAEVQLVESGGGLVQAGGSLRLSCAASGFTFDDYAIGWFRQAPGKEREGVSCISSSDGSTYYADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYYCAA
Vicugna pacos V85 trav ABRR02174346.1 2489 VTGQDVEQSPPVLSLQEGATSTLWCKFSTTVSNVQWYRQNPGGRLIHLFYVASGTKHDGRFSATAVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Vicugna pacos V86 trav ABRR02174955.1 1107 VTGQDVEQSPPVLSLQEGATSTLWCKFSSSVNSLQWYSQNPGGRLIHLFSVASGTKRDGRFSATTVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Vicugna pacos V87 ighv ABRR02176102.1 1394 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGPEWVSAINSGGGSTSYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAK
Vicugna pacos V88 trav ABRR02180820.1 61 RTRGDSVMQTEGPVTLSESAALTINCNYSTTGYPTLFWYIQYPGEGPQLLLKTSKDKEKVLKKGFEATYHREPNSFHLEKASVQGADSAVYYCALS
Vicugna pacos V89 trav ABRR02183514.1 562 VTGEDVEQSPPALSVQEGVTSTLWCKFSTTVSNLNWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSRTTDSATYFCAVSTVLP
Vicugna pacos V90 ighv ABRR02188007.1 44 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSAISWNGGSTYYAESMKGRFTISRDNAKNTLYLQMNSLKSEDTAVYYCAK
Vicugna pacos V91 trav ABRR02194217.1 118 TVIEAEIDQPKSRDVAEGEDVTLPCNHATIGGSDYVHWYRQNPTQSPQYIIHGLRDTVTNHMASLTIATDRKSSTSVLPRVTLRGSAVYYCALTE
Vicugna pacos V93 ighv ABRR02199730.1 173 VLSQVQLQESGPGLVKPSQTLSLTCAVYGGSITTSCYAWSWICQPPEKGLEWMAAIYSGSTYYSPSLKSHTSISRDMSKNQFSLQLSSVTPEDTAVYYCAR
Vicugna pacos V94 iglv ABRR02208247.1 265 SVASYELTQTPSVSVALRQTAKITCGGDNIGSKSAQWYQQKPGQAPVLVIYADSRRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCHVWDSSAN
Vicugna pacos V95 iglv ABRR02210073.1 273 YVASSALTQPSAVSVSLGQTARITCQGDSLESYGANWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAEDEGDYYCQSEDSSVSN
Vicugna pacos V96 iglv ABRR02218558.1 257 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYRTSNRLSGVPSRFSGSISGNKAALTIMGAQPEDEAEYYCAVYVGSGS
Vicugna pacos V97 trav ABRR02235687.1 220 MRSQQKGAAQSLTVPEGATASLICSYSVSDPQNFMWYRQYSGRGPEWLMTFYPNNEKKEGRFTAQVNKTSRYVSLLIRDSQPSDSATYLCAES
Vicugna pacos V98 trav ABRR02235867.1 220 MRSQQKGAAQSLTVPEGATASLICSYSVSDPQNFMWYRQYSGRGPEWLMTFYPNNDKKEGRFTAQVNKTSRYVSLLIRDSQPSDSAAYLCAES
Vicugna pacos V99 trdv ABRR02258994.1 134 SGVAQTVTQDQPAVSTPVGKTVTLICRYETSVSIYYIFWYKQPPSGEMTFLIRQDSSSGNAKSGRYYVNFRKAEKSLSLSISNLLLEDSAKYFCALRE
Vicugna pacos V100 trgv ABRR02020980.1 16380 DQEEVRLVQPALVMARTRGSTTLPCQAYGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNKDGRSCFLSLMKLEKADEGMYYCAAWD
Vicugna pacos V101 trgv ABRR02020993.1 13517 GLMLPQLEQPEVSVTGVRDKSVLLSCKVTSDSFDNDYIHWYQQKPDQGLKQLMYISTASALGDLGGKKNKLEARKYASTSTSTLKISFLKKEDEATYYCALWIS
Vicugna pacos V102 trgv ABRR02020994.1 10910 HLEQPQLSSTKQLSKTARLECVVSGVTISTTSVYWYRERPGQAVQHLLHVSADNTVSVELGIRPGKFEADKTPDTSTSTLTIHSVGEQDAATYYCALWD
Vicugna pacos V103 trgv ABRR02020994.1 3854 GLGLSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQRRNQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDAGIYYCAGWY
Vicugna pacos V105 igkv ABRR02049305.1 3837 NRAETVPTQSPALASATPGDKVTLTCKVSQDTDDDIMWYQQKPGQAPRLITKYDSTVISGLPSRFSGSGYGTDFTLTIDNMKSEDAAYYFCQQDDNIP
Vicugna pacos V106 igkv ABRR02049309.1 30844 SSGDLVLTQIPGSLSVTPGEPASISCRSTENLEDSEGDTYLSWYLQKPGQSPQMLIFAGSSRAPGIPDRFTGSGSETAFTLKISGVKAEDAGVYYCAQSL
Vicugna pacos V107 igkv ABRR02049309.1 25187 CWGQIALTQFPESLAASHGSLVSITCRSSMEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Vicugna pacos V108 igkv ABRR02049309.1 20985 ARCATQMTQSSSSLSASLGDRVTITCQASQSISNELSWHQQKPGQTPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYYS
Vicugna pacos V109 igkv ABRR02049309.1 13029 ASGSAELTQTPAILSVSLRESISITCTASESVSDYVSWYQQKPGQAPRLLIYDTDDRYSGVPDRFVGLQSGTQFILTINNVEADDTASYYCFHD
Vicugna pacos V110 igkv ABRR02049309.1 4824 ARCATQVTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCLQHKLP
Vicugna pacos V111 igkv ABRR02049314.1 2909 ARCATQMTQSPSSLSASLGDRVTITCQASQSISTELSWYQQKPGQTPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEDLATYYCLQDYSWP
Vicugna pacos V112 trbv ABRR02092498.1 9352 VRAQTIHQSPPTVVQPMGSSLSLECTVKGTSNPRLYWYRQAAGGALQLLFYSFSADRVESEEPQNFEASISQDGPFILSSKKLLLNNSGFYLCAWS
Vicugna pacos V113 trdv ABRR02141954.1 5114 KGVLSAKVTQTSRDQTVASGSEVTLPCTFEAEYSDPGLYWYRMRPGFSLEFVLYRDNTESLNADFAQGRFSVQHNETQKTFHLVISSVRAEDSATYYCALEY
Vicugna pacos V114 iglv ABRR02147036.1 3349 TVAQARLTQPRSVTASPGQTATLTCTGDSHSVGNEGAAWLQQHPGQAPRLLTLRNNQRPSGVSERFSGSRSGSTATLSISGLQAEDEADYYCSAWDSSLSA
Vicugna pacos V115 iglv ABRR02147052.1 3156 SWAQSVLTQLPSVSGSPGQKVTISCTGSSSNIGGGYSVQWFQQLPGTPPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEADYYCECYDNSLSG
Vicugna pacos V116 iglv ABRR02147053.1 10415 SLSQPVLTQLSSLSASLGASARLTCTLSSGFKVGDFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFSGSSDASANAGLLLISGLQHEDEADYYCAT
Vicugna pacos V117 ighv ABRR02161861.1 551 VQAQVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA
Vicugna pacos V118 trdv ABRR02173114.1 3028 SGVAQTVTQDQPAVSSHVGETVTLNCRYETTYSTYYIFWYKQPPSGEMTFLIRQDYNRGNAKSGRYSVNFRKAEGSLSLTISNLQLEDSAKYFCALWD
Vicugna pacos V119 iglv ABRR02173122.1 546 SVASSALTQPSTVSVSLGQTAKITCQGGSLESYYAHWYQQKPDQAPVLVIYRDSNRPSGIPERFSGSRSGGTATLTISGIQAEDEADYYCLSADSSDYN
Vicugna pacos V120 iglv ABRR02175277.1 890 SWANSALTQPPSVSGTLGKTVTISCAGTSSDIGGYNYVSWYQQLPGTAPKLLIYVVNKRASGIPDRFSGSKSGNTASLSISGLQSEDEADYFCASYTTS
Vicugna pacos V121 trav ABRR02176868.1 2526 VNGQQIKQIPEFVLLQEGENFTTYCNTSSTIDSLQWYKQQPGGRPVLLMLLTKGGDVKTQGRLTARFGETRKYSLLHIPAAQTADVGTYFCAE
Vicugna pacos V122 trav ABRR02177322.1 1314 SSIAQKVTQEQPPMLAQEKEAVTLNCTYDTSDPTYSLFWYKQPSSGAMTFLIRQDTYNQQNAKEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V125 trav ABRR02178554.1 1042 RTRGDSVMQTEGPVALSESAALTINCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHKEQTSFHLEKASVQGADSAVYYCALS
Vicugna pacos V126 trav ABRR02179922.1 765 SSIAQTVTQDQPPMLVQDKEAATLDCTYDTSDPTYSLFWYKQPSSGETTFLIGQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Vicugna pacos V127 iglv ABRR02180035.1 766 YVASSALTQPSAVSVSLGQTARITCQGGNFGSYYGSWYQQKPSQAPVLVIFKDSERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCLSYESSGYN
Vicugna pacos V128 iglv ABRR02185186.1 750 SWAQSALTQPPSVSGTLGKTLTISCAGTSSDIGGYNSVSWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSKSGNTASLSISGLQSEDEADYYCASYRSSNN
Vicugna pacos V129 trav ABRR02186463.1 731 GAGAQSVTQPDRHGITVPEGAHLELRCNYTSTYSPYLFWYVRYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRKNETSFHLRKMSAYWSDSAEYFCALG
Vicugna pacos V130 trav ABRR02186963.1 497 VSSLLSMKQGPPRVHVQEGESTSATCSFPSSCFHAFHWYRWEPAKSPQNLLVMILNGDEKEEGWVRVTLSTKDGYSYLHIKGPQAEDSATYLCA
Vicugna pacos V131 trav ABRR02187554.1 377 RTRGDSVMQTEGPVALSESSALTINCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVFKKGFEATYHREPSSFHLEKASVQGADSAVYYCALS
Vicugna pacos V132 trav ABRR02187680.1 818 VTGQDVEQSPPVLSLQDGATSTLWCKFSSSVTSVQWYRQNPGGRLIHLFYVASGTKHDGRFSATTVIQERRSSLNISSSQTADSATYFCAVSTVLP
Vicugna pacos V133 trav ABRR02189743.1 311 RTRGDSVMQTEGPVALSESSALTINCNYSAAGYPTLFWYIQYPGEGPQLLLKASRDKDKVLKKGFEATYHREQTSFHLEKASVQESDSAVYYCALS
Vicugna pacos V134 trav ABRR02190327.1 416 MRSQQKGAAQSLNFPEGATASLTCSYSDSNSQSFMWYRQYSGRGPERLMTFYPNNDKKEGRFTAQVNKTSRYVSLLIRDSQPSDSAAYLCAES
Vicugna pacos V135 trav ABRR02191713.1 295 GAGAQSVTQPEDHVSVFARAPVQVKCNYSTSGSPVLFWYVQYPKQSLQLLLKHISKESVKGFTADLNTGETSFHLKKPSAQEEDSAMYYCALS
Vicugna pacos V137 trav ABRR02214222.1 581 GTSGDSVTQTEVPVTLPEEALLILNCTYQTTYSDAYLFWYVQYVNRAPQLLLKGSAANPRPEHQGFQATLDKSSRTFHLQKPSVQTSDSAVYYCALS
Vicugna pacos V138 trav ABRR02217463.1 562 GTSGDSVTQTEVPVTLPEEALLILNCTYQTTYSDVYLFWYVQYVNRAPQLLLKGSAANPRPEHQGFQATLDKSDRTFHLQKPSVQTSDSAVYYCALG
Vicugna pacos V139 trav ABRR02296297.1 314 GTSGDSVTQTEVPVTLPEEALLILNCTYQTTYPDAYLFWYVQYVNRAPQLLLKGSTANPRPEHQGFQATLDKSSRTFHLQKPSVQTSDSAVYYCALG