WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Chrysochloris asiatica AMDV00000000.1 (AMDV01) 222 29 13 82 41 24 18 15
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Chrysochloris asiatica V23 trgv AMDV01021804.1 3650 SQKASNKVMRQKLIIKPTEASVVINCDLLDQSTNYVHWYQYQEGRALQRLLYYGFRDSKVVLDSGFSSEKYHVYEGTGRSCKFVLKNLEKSDSAVYYCATWN
Chrysochloris asiatica V24 trgv AMDV01021808.1 4279 SQKASNMEMRQKSIIRPAEASVAITCDLPDQSTKYIHWYRYQEGRALQRLLYYYFRESKAQLDSGFSSEKYHAYEGTGRSCKFMLRNLEKSDSAVYYCATWDF
Chrysochloris asiatica V25 trgv AMDV01021810.1 1861 SQKASNMEMKQKLIIRPTKASVIISCDLLGHNINYIHWYRYQEGRALQRLLYYNFPDSKVVLDSGFTLGKYNAYEGTGRSCKFVFNYLEKSDSGVYYCATWDL
Chrysochloris asiatica V26 trgv AMDV01021819.1 64 NQKTPNMEMRQKSIFRPTEAFVIIPCDLDQNANYVHWYRYQEGRALQRLLYYDFPKSKVVLESGFSSEKYHVYASSGKSYKFVLRNLEKSDSAVYYCATWT
Chrysochloris asiatica V27 trgv AMDV01021823.1 5202 SQKASSMEMRQKSIIKPTAASVTITCDLPGQNTNYVHWYRYQEGSALQRVLYYDFSKSKVVLDSGFSSGKYYAYADTGKIYKFLLHYLKDSDSGVYYCATWD
Chrysochloris asiatica V28 trgv AMDV01021824.1 270 SQKASNMEMRQKSIIKPTDTLVSLMCDIRNINYIHWYRYQEGRGLQRLLFYNLPKAQLVLDSGFSSAKYHAYEDSRKNSIFALKNLEKSDSGVYYCATWK
Chrysochloris asiatica V29 trgv AMDV01021826.1 1381 NQKVSKMDLKQKSIFRPTEASVIITCDLDQNTNYVHWYQYKEGRPLQRLLYYDFPKSKVVLDSGFSSEKYHVYAGTGRTCKFVLKNLGKSDSAVYYCATWEF
Chrysochloris asiatica V30 trgv AMDV01021827.1 1970 SQKASNLEMRQKSIIKPTDTFVSITCDIRNINNIHWYRYQEERGLQRLLFYNLPKAQQVLDSGFSSAKYRAYENAEKRGVFVLKTLEKSDSGVYYCATWK
Chrysochloris asiatica V31 trgv AMDV01021828.1 3641 SQKTSNMEMRQKSIIRPTGGSLVITCDFQNTLYVHWYRYQEGRALQRFLYYNFHNSKVMLDSGFSSGKYHAYEDARKSCVFVLSNLEKSDSGVYYCATW
Chrysochloris asiatica V32 trgv AMDV01021828.1 9781 NQKASNMEMRQKSIIRPTEASVAITCDLPDQNTKYVHWYRYQEGRALQRFLYYNFRDSKVVLDSGFSSGKYDAYEIARKSCVFVLSNLEKSDSGVYYCATWN
Chrysochloris asiatica V33 trgv AMDV01021831.1 52 GLGLSKVEQSPKTISTARMKTVDMHCSITSTRYEIEAVHWYQLTKSQTMEHLIHVTSTRVPAQKRLRGKDNKVEARKDAHSSTSIFTINFTEKEDEGIYYCAGWD
Chrysochloris asiatica V34 trgv AMDV01021832.1 10276 GLGQLKLEQPDVSITLASLKSAHITCKVSAENFANTVIYWYRLKPNQGIEYLIYVISVTDPAHGSLDKKGKKLEASKNVHTSASVLKINSVGKEDEAVYYCAGW
Chrysochloris asiatica V35 trgv AMDV01021834.1 959 GLGQLKLEQPDVSISIAKYKTAPITCKVSVENFANKVIHWYRLKPNQGIERLIYISSTTTPAQGSLGGKSNKLEARKISGTSTSILKIKSVEKEDEAVYYCAGW
Chrysochloris asiatica V36 trgv AMDV01021837.1 800 GLGQLKLEQPDVSIFIAKYKTARIICKVSVKNFANKVIHWYRLKPNQGIEHLILISSTTTPAQGSLGEKSNKLEAHKISGTSTSTLTIKSVEKEDEAVYYCAGW
Chrysochloris asiatica V37 trgv AMDV01021838.1 5968 GFGQLKLEQPDVSISIAKYKTALITCKVSVENFESEFIHWYRLKPNQGIEHLIFISSTTTPAQGSLGEKSNKLEAHKFSSISTSILKIKSIEKEDEAVYYCAGW
Chrysochloris asiatica V38 trgv AMDV01021838.1 26917 GLGLSKVEQSQISISTAIKKSVDMNCRITSTGFENEVVHWYRMKENQAMEHLIHVTSTKVPARKHLGGKDNKVETRKVSHSSTSIFTINFIEKEDEAIYYCAGWD
Chrysochloris asiatica V39 trgv AMDV01021839.1 3426 GLGQVKLEQPDVSTVTKLKSAHITCKVSTKNFADIIIHWYRLKPTQSIEYLIYIYSTTTPAQGSLGKKSKKVEASKNSHTSTSILKINSVEKEDEAMYYCACW
Chrysochloris asiatica V40 trgv AMDV01021844.1 4325 GDTKMRISQDQLSFTRKPNRTVHISCQLSGVPLETTIVHWYQEKEGGPLKRILYGSTKGYKQDKTDSRLETDEKENGFFYLIINKVTKEDEATYYCACWD
Chrysochloris asiatica V82 trdv AMDV01053029.1 4650 KGMLCDQITQSSTEQIVQIGSQVTLPCTYQVGYLNPYLYWYRMRPDHSFQFILYRDNTNSKDADFTQGRFSVTRSQTQKTFHLVISSVRAEDIATYYCAYD
Chrysochloris asiatica V83 trdv AMDV01053030.1 2953 KGMLCDKITQSSTEQIVQIGSQVTLPCTYQVGYSNPGLYWYRMRPDHSFQFILYRDNTNSKDADFTQGRFSVKRSQTQKTFHLVISSVRAEDIATYYCASD
Chrysochloris asiatica V176 trbv AMDV01101072.1 11637 STDTGVTQTPKYLVAGVGRKRSLTCAQSLGHNTMYWYRQLPDKPPELMFVYNYKAMSVNETIPSRFSPECPNSSHLHLHVNGLQPIDSAVYLCASSE
Chrysochloris asiatica V177 trbv AMDV01101072.1 13207 HSESGVRQTPSHQVTRMEQTVILRCDPIPGHLYLYWYRQIPGQNLEFLISFFNDKLSEKSEMFKDRFSAERPESSFSTLKIQPAKPGDSAVYLCASSK
Chrysochloris asiatica V178 trbv AMDV01101072.1 18142 PLESAVSQSPRYLVSLTGSRRSLSCEQNLGHQAMYWYRQDSMQPLRVMFSYNNRDLIVNESVPSRFFPQYPDNAHLNLHIDLLEPGDSAVYLCASSR
Chrysochloris asiatica V179 trbv AMDV01101079.1 12490 SVSAGNSGAGVSQAPRHRITQRGQAVVFKCDPVNGHTCLYWYRQTPGQGMEFLMYFQNTEAPDTSGMPDARFSAERPDGSSSTLKIQPVEPRDMAVYLCASSL
Chrysochloris asiatica V180 trbv AMDV01101079.1 18824 SVSAGTSGVGVSQAPRHRVSQRGQVVVLKCDPIWGHNRLYWYRKTLGQGLEFLIFFQNKDTPDTSGMPDARFSAERADGSSSTLKIQPVEPEDSAVYLCASSL
Chrysochloris asiatica V181 trbv AMDV01101081.1 10783 HTDAGITQTPRHQITKIGEKVVLQCTQDMNHNYMYWYRQDPGLGLRLVYNSVGTKMTNNGDFPDGYNASRPNTEHLLLTLGSAATSQTSVYFCASSE
Chrysochloris asiatica V182 trbv AMDV01101081.1 16566 HTDAGVTQTPRHKVAETGHEVTLRCEPISGHTTLFWYRQTSAQGLELLIFYQNRAVIEQADTIKGRFSADMPDGSSSTLKIKSTELGDSAVYLCASSL
Chrysochloris asiatica V183 trbv AMDV01101081.1 21203 HADAGVIQTPRYKVAEKGHEVTLKCEPISGHTALFWYRQTSTQGLEFLIYFRNQAVIEQADTIKDRFSAKMPDGSSSTLKINSTELGDSAVYLCASSL
Chrysochloris asiatica V184 trbv AMDV01101081.1 28398 PMGAVVTQNPKYHVTRMGKSVTLSCSQNLNHNVMYWYQQKPTQALKLLFYYYNTEFNNETDTSDNFQPIRPNTSFFGLGIRSAHVGDSAMYLCASS
Chrysochloris asiatica V185 trbv AMDV01101083.1 634 AAGSGITQTPKYMVQEEGQRVTLECEQSLGHDSMYWYRQDPGQGLKLVYYSPITNGVQEGDASAGYSASREKKGHFPLTVTKTHGNQTALYLCASSL
Chrysochloris asiatica V186 trbv AMDV01101083.1 2519 PGFSAHVSQHPSRAIRRSGTMVEMDCHAKGIQASTMLWYRQLPGQTFTLIAVSNQGSDPTYEQGFTKTKFTINHPNLTFSALTVTNVKAEDSSLYFCAAS
Chrysochloris asiatica V187 trbv AMDV01101083.1 9834 SMDTEVIQTPGQLVKGTKQKARMECVPIKGHDDVYWYRQKPGEELKFLIRFQYQEAFDSSGMPEKRFSANCSKISPCSMEIEPTEPEDSAVYFCASSL
Chrysochloris asiatica V188 trbv AMDV01101084.1 3046 SMDTKVTQTPGQLVKGTKQKARMECVPIKGHIHVYWYRQKPGEELKFLIYLQNEDTIDSSGMPEKRFSAKCPQNSRCSMEIEPTEPEDSAVYFCASSQ
Chrysochloris asiatica V189 trbv AMDV01101084.1 13347 SMDTEVIQTPGQLVKGTKQKAKMECVPIKGHTYVYWYHQKLGEELKLLVYFGNEEPLDTTGMPGKRFSAKCPKNLPCIMEIEPTEPEDSAVYFCASSL
Chrysochloris asiatica V190 trbv AMDV01101084.1 17465 SMDTKVTQTPGQLVKGTKQKARMECVPIKGHTSVYWYRQKLEEELKFLVYMEREEAVDSSGMPEKRFSAKCPKNLPCIMEIEPTEPEDSAVYFCASSL
Chrysochloris asiatica V191 trbv AMDV01101084.1 35335 SMDTKVIQTPGQLVKGTKQKARMECVPIKGHDDVYWYRQKPGEELKFLVYFQYEKALDTSGMPEKGFLATCPQNAPCSLEIESVEIRDSAVYLCASSP
Chrysochloris asiatica V192 trbv AMDV01101085.1 5619 SMDTKVTQTPGQLVKGTKQKAKMECVPIKEHAYVYWYRQKPGEELKFLVYFQNEEAVDSSGMSDKRLSANCSKSSRCSMEIEPTEPEDSAVYFCASSQ
Chrysochloris asiatica V193 trbv AMDV01101085.1 11122 SLDTEVIQTPGQLVKGTKQKARMECMPIKGHQSVYWYHQKLGEEFKFLIRFQNKEAIDPSGMPEKRFSANFSKNSRYIMEIEPTEPEDSAVYFCASSL
Chrysochloris asiatica V194 trbv AMDV01101085.1 25075 STDTGITQTPRNRIAQTGRDITLECSQSKGLDSMYWYRQDPGLGLQLIYYSVDVDDINKGEASKGYSVSRKKLAQFSLSLQTASRNQTCFYLCAASI
Chrysochloris asiatica V195 trbv AMDV01101086.1 2818 PAGADISQTPQHYVTGTGEKVILECSQTMGHDNMYWYQKDPGKELQLIYYSYGVNSIEKEKLSSRWNVSRIKIEDFPLVLDSASSEDSAWYFCASSK
Chrysochloris asiatica V196 trbv AMDV01101086.1 8789 PTEAGVTQFPRHRIAKRGEMLTVDCMQDLNHDAMYWYRQDPGQGLRLLHYSINVNSKEKGELPNGYQVSREKKGSFPLTLESALPNQTSLYLCASSM
Chrysochloris asiatica V197 trbv AMDV01101087.1 312 LMDVQVIQIPRYLISRAGEKVLLECVQHLQHERMFWYRQDPVLGLRVIHYSVGIDITEKGDIPDGYTVSRKKKENFPLTLESARPNQSSVYLCASSY
Chrysochloris asiatica V198 trbv AMDV01101087.1 9250 SGFGVIITQEPSRAISQHGTSVTIHCQADTQLSSMFWYRQSLGESLTLIATSNQGSEATYEKGFTKDKFPISHPNLTFSTLTVREANLQDTSFYLCSAD
Chrysochloris asiatica V428 ighv AMDV01280720.1 30 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTDKYMNWVRQIPGHGFEWIGYINPSNGGTDYAPKFKGRVTITRETSTSTVYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V429 ighv AMDV01280722.1 20428 GSHSQVQLVQSGADLKKPGSSVKVSCKASAYTFTSYYMHWVRQIPGNGFEWMGLIYPGNGNTNYAQKFQGRVTMTRETSTNTAYMDLSSLRSEDIAMYYCMR
Chrysochloris asiatica V430 ighv AMDV01280730.1 6423 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTDNYVHWVRQIPGHGFEWIGWIYPSNGNTNYAQKFKGRVTMTSEKSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V431 ighv AMDV01280738.1 1923 GGHSQVQLVQSEGKLKKPGSSVKISCEASGYTFTSYSMHWVQQIPGHGFEWMGRIYTSNGETKYAQKFQGRVTMTLETSRSTAYMDLSSLSFKDTAMYYCVR
Chrysochloris asiatica V432 ighv AMDV01280741.1 3096 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTSYYMSWVRQIPGHGLEWIGWIYPGSGNTNYAQKFQGRVTITSEKSTSTAYMDLRSLSSEDTAMYYCAR
Chrysochloris asiatica V433 ighv AMDV01280752.1 27495 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTDYYMHWVRQIPGHGLEWIGRINPSNGGTNYAQKFQGRVTITSEKSTSTAYMDLNSLSTEDTAMYYCAI
Chrysochloris asiatica V434 ighv AMDV01280767.1 5610 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTSYIMHWVRQIPGHGFEWIGYIYPGNGGTNYAQKLKGRVTITSEKSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V435 ighv AMDV01280772.1 1578 GGHSQIQLVQSGAELKKPGLSVKISCKASGYTFTSYGMHWVWQITGHGFEWIRYIYPSNGGTSYAQKFQGRVTITRETSTSTAYMDLSSLSSEDMATYYCAR
Chrysochloris asiatica V436 ighv AMDV01280774.1 15821 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTSYYMHWVRQIPGHGFEWIGRIYPSSGNTHYAQKFQGRVTITSEKSTNTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V437 ighv AMDV01280781.1 4645 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTSYYIHWVRQIPGQGFEWIGYIYPGNGGTYYAQKFQGRVTITSEKSTSTGYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V438 ighv AMDV01280810.1 4842 GGQSQVQLVQSGAELKKPGSSVKVSCKTSGYTFTDHYMNWMHQISGHGFEWIGNIYPGTGGTNYAQKFQGRVTMTSEKSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V439 ighv AMDV01280812.1 9118 GGQSQIQLVQSGAELKKPGSSVKISCKTSGYTFTSYDMNWVRQIPGHGLEWIGYINPSNGRTNYAQKFKGRVTITSEKSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V440 ighv AMDV01280818.1 8809 GSHSQIQLVQSGAELKKPGPSVKISCKASGYTFTSYDMHWVRQSPVHGFEWIGYIYPSSGGTSYAQKFQGRVTITSEKSTSTAYMDLSSLSPEDTAMYYCAK
Chrysochloris asiatica V441 ighv AMDV01280840.1 7027 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTNNYMSWVRQIPGHGFEWIWGINPSSGGTNYAQKFQGRVTITSEKSTSTAYMDLSSLSSEDIAMYYCVR
Chrysochloris asiatica V442 ighv AMDV01280855.1 5275 SHSQIQLVQSGAELKKPGSSVKISCKASGYTFTSYGMHWVRQISGHGFEHIGWISTNNGATGYAKKFQGRVTITMETSASTAYMDLSSLNSEDTAMYYCAR
Chrysochloris asiatica V443 ighv AMDV01280857.1 8129 GGLSQVQLVQSEAELKKPGISVKVYCKASGYIFTNYNMHWVRQIPGHGFEWIGVISPSSGGTSYAQKFQGRVTMTRETSTSTAYMDLSSLGSEDIAMYYCVR
Chrysochloris asiatica V444 ighv AMDV01280864.1 6889 GSHSQIQLVQSGAELKKPGSSVKISCKASGYTFTSNAMHWVRQSPGHGFEWIGYINPSNGGTNYAQKFQGRVTMTRETSTNTAYMDLSSLSSEDMAMYYCAR
Chrysochloris asiatica V445 ighv AMDV01280883.1 539 VQCEVQLVESGGDLRQPGQSLTLSCAASGFTFSSYWMSWVRQPPGQGLQWVGEINPDSNTKNYANSVKGRFTISRDNGKNTLYLKMDNLRVEDTALYYCAR
Chrysochloris asiatica V446 ighv AMDV01280888.1 766 SVWANTNRVRPRADDALTDPVSPCSVSGFSITTSGYCWHWICQIPGKGFQWMSEIYTDGSTYYDPSLKNRLSISMDTSTNKFFQQLRSMTPEDTAVYYCARD
Chrysochloris asiatica V447 ighv AMDV01280912.1 1852 VMSEPTLQESGPALVKPSQTLSLTCLVSGQSVTSSYYWNWIRQHPGKTLEWMGYWTGSTNYNPAFQGRISITADTAKNQFSLKLSSVTAEDTPVYYCAR
Chrysochloris asiatica V448 ighv AMDV01280914.1 13277 VLSQIILKESGPGLMKPTQTLSLTCTFSGFSFSSGIGVSWVRQLPGKSLEWLANIWWDDDKYYHPSLKSRLTISKDTSKSQVFLTMTNMGPGETGTYYCARI
Chrysochloris asiatica V449 ighv AMDV01280917.1 22878 VQCEVKLVESGGDLRQPGQSLRLSCEGSGFTFSNHYIYWIRQYPGNKLEWVSFIRNKANGGTQEYAASVKDRFTISRDDSRNIAFLQMTGLKPEDTAMYYCAR
Chrysochloris asiatica V450 ighv AMDV01280921.1 999 VHCEVTLVESGGDLKQPGQSLRLSCEGSGFTFSNAYISWIRQYPGNKLEWVSFIRNKANGGTQEYAASVKGRFTISRDDSRNIAFLQMTGLKPEDTAMYYCAR
Chrysochloris asiatica V451 ighv AMDV01280933.1 2899 VLSQVILKESGPGLMKPTQTLSLTCTFSGFSFSSGIGVSWVRQLPGKSLEWLANIWWDDDKYYHPSLKSRLTISKDTSKSQVFLTMTNMGPGETGTYYCARI
Chrysochloris asiatica V506 igkv AMDV01333501.1 4102 VNGDIVMTQSPASLAVSPGAMVSINCKANQSVGSYLNWYQQKPGQVPKRLIYGASNLDSGVPNRFRGSGSGTDFTLSISSFQPEDVAVYYCQQYNSL
Chrysochloris asiatica V509 igkv AMDV01338491.1 930 AMGDIVMTQSPASLSLSPGERASLTCKSSQSVGSALAWYQQKPGQAPRLLIYVASSRANGIPDRFSGSGSGTDYTLTISSLEDEDFGTYYCQQHGYSP
Chrysochloris asiatica V510 igkv AMDV01338491.1 7959 AMGDIVMTQSPASLSVSPGERVSLTCRSSESVSSYLAWYQQKPGQAPRFLIYDATDRADGIPDRFSGSGSGTEFTLTISSLEAEDFGTYYCQQNRYSP
Chrysochloris asiatica V511 igkv AMDV01338492.1 6889 SDTMEDIVMTQSPTSLSLSLGEKASLTCRSSQNVGNTLAWYQQKPGQAPKPLIYYTSYMADGIPDRFSGSGSGTDFTLTISSVEAEDFGTYYCQQAIYLP
Chrysochloris asiatica V512 igkv AMDV01338496.1 2815 AMGDIVMTQSPASLSLSPGERASLTCKSSESVYSALHWYQQKPGQAPRLLIYGASNRVDGIPERFSGSGSGTGYTLTISSLEAEDVGIYYCQHGLKTP
Chrysochloris asiatica V514 igkv AMDV01338499.1 281 TMGDIVMTQSPASLSLSPGERVSLTCRSSQSVRSYLSWYQQKPGQAPRLLIYAVSSRAHGISDRFSGSGSETDFTLTISSMKADDVGTYYCKHSTDFP
Chrysochloris asiatica V515 igkv AMDV01338499.1 6014 AMGDIVMTQSPASLSVSPGERVFFTCSSSQGVNSYLSWYQQKPGQAPRLLIYGASNRANGIPDRFIGNGYGKVYTLTISSLEAEDFGTYYCQQGYNLP
Chrysochloris asiatica V516 igkv AMDV01338501.1 905 ALGDIVMTQSPASLSVSPGERVSLNCRASQSVSSYLNWYQQKPGQAPRLLIYNADSREDGIPERFSGSGSGTDYTLTISSLKAEDFGTYYCLQHDDYP
Chrysochloris asiatica V517 igkv AMDV01338503.1 4553 AMGDIVMTQSPASLSLSPGETVSLNCRASQSVNNYLNWFQQKPGQAPRLLIYGASNRADGIPERFSGSGSGTDFTLTISSLKAEDFGTYYCLKHNNYP
Chrysochloris asiatica V518 igkv AMDV01338505.1 3123 TSGDIVMTQTPLSLSIMLGQPATLTCKSSQSLVHSDGKTYLYWIQQKPGQAPHPLIYQVSNRYTGVPDRFIGSGAITDFTLKINRVEAEDIAIYYCMQVIQTP
Chrysochloris asiatica V519 igkv AMDV01338508.1 1035 TSGDIVLTQTPFTEPITLGQPATISCKSSQSLVHSDGKTYLYWFQQKPGQAPRGLIYHVSNRYTVVSDRLIGSGAVTDFTLKISRVEAKDISVYYCFQAT
Chrysochloris asiatica V520 igkv AMDV01338510.1 1824 AMGDIVMTQSPASLSLSPGERVSLTCKSSQSISSALHWYQQKPGQAPRLLIYAASYRANGIPDRFSGSGSGTDFTLSINSLKAEDFGSYYCQQGYNYP
Chrysochloris asiatica V521 igkv AMDV01338510.1 13964 TSGDIVMTQTPLSLSITLGQPATITCKSSQSLVHSDEKTYLYWIQQKPGQSPRPLIYLVSNRHTGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCLQYRQD
Chrysochloris asiatica V522 igkv AMDV01338510.1 24744 TSGDIVLTQTPFTEPITLGQPASISCKSSQSLVHSDGKTYLNWIQQKPGQAPRALIYQVSNRYTGVPDRFTGSGAITDFTLKISKVEAEDIAVYYCWQDI
Chrysochloris asiatica V523 igkv AMDV01338514.1 609 TSGDIVMTQTPLSLSITLGQPATLTCKSSQSLVYSDGKTYLSWFQQKPGQAPRLLIYKVSNRYTGVPDRFIGSGAVTDFTLKISRVEADDIAVYYCVQAIQTP
Chrysochloris asiatica V524 igkv AMDV01338517.1 3671 TSGDIVMTQTPFSLSITLGQPATLTCKSSQSLVYSNGKTYLNWFQQKPGQAPRALIYWVSNRHTGVPDRFIGSGAVTDFTLKISRVEAEDIADYYCIQGIQRP
Chrysochloris asiatica V525 igkv AMDV01338518.1 1657 TSGDIVMTQTPLSLSITLGQPATISCKSSQSLVHSDGKTYLYWIQQKPGQTPRALIYWVSNRHNGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCMQA
Chrysochloris asiatica V526 igkv AMDV01341270.1 4417 SNGETVLTQSPLTLSITLGESATISCKSSQSLVHSNGNTYLNWYRQEPGQAPKPLIYKVSNRFTGVPDRFSGSGSVTDFTLKISRVEAEDVAVYYCQQSTKV
Chrysochloris asiatica V527 igkv AMDV01341271.1 13801 SSGDIVMTQSPLTLPITLGESATISCKSSQSVVHSNGNTYLLWYQQKPGQATRLLIHQISKRFTGVPERFSGSGSVTDFTFKISRIEAEDIAIYYCMQATENP
Chrysochloris asiatica V528 igkv AMDV01341278.1 8889 STCDIVLTQSPGSLSVAPGNTASISCRTSESIESLGTSLFNWYQQKPGQPPKLLITFTSTREPGVPVRFSGSGSGTTFSFTIDPVEADDAANYYCQQVHKYP
Chrysochloris asiatica V529 igkv AMDV01341278.1 13637 SSGDVALTQSPASMAFSPRESVTISCKASSSINAGHLHWYQQKPGAPPKLLIYSTSNLASGVPDRFSGRGSETDYFLTISSVEDKDAATYYCLQKDSI
Chrysochloris asiatica V530 igkv AMDV01341288.1 5390 ACGDIIMTQSPASQAVSLGETVTINCKSSQSLINYGYHRLAWYQQKVGQAPKRLIYDASSRASGVPDRFSGSGSGTDFTLTISRVQAEDVADYYCQQYY
Chrysochloris asiatica V531 igkv AMDV01341289.1 2065 ACGDIIMTQSPASRAVSLGETVTINCKSSQSLTSSSNYHYLAWYQQKAGQAPKLLIYGGSNRASGVPDRFSGSGSRTDFTLTISRVQAEDVANYYCQQYYST
Chrysochloris asiatica V532 igkv AMDV01341293.1 2536 SGACGDIIMTQSPASRAVSLGETVTINCKSSQSLAYSGYHRLAWYQQKAGQVPKLLIYRGSTVQSGVPDRFSGSGSGTDLTLTISRVQAEDVAQYYCQQSHSA
Chrysochloris asiatica V533 igkv AMDV01341294.1 4194 ACGDIIMTQSPPSWAVSLGETVTINCKSSQSLTIGSYQLLAWYQQKAGQAPKLLIYGGSNRVSGVPDRFSGSGSGTDFTLTISRVQAEDVAQYYCQQAR
Chrysochloris asiatica V534 igkv AMDV01341296.1 2044 ACGDIVMTQSPGSRTVSLGETVTINCKSSQSLTYYGYHFLAWYQQKAGQAPKLLIYGGSNWASGKPDRFSGSWSGTDFTLTVSMVQAEDVAHYFCLQTR
Chrysochloris asiatica V535 igkv AMDV01341299.1 2088 ACGDIVMTQSPASRAVSLGEAVTINCKSSQSLTIGRYHRLAWYQQKAGQAPKRLIYDASIRAFGVPDRFSGSGSGTDFTLTISRVQAEDAASYYCQQYYST
Chrysochloris asiatica V536 igkv AMDV01341299.1 15725 ACGDIIMTQSPASRAVSLGETVTINCKSSQSLTIGSYQFLAWYQQKAGQAPKLLIYLGSNRASGVPDRFSGSGSGTDFTLTISRVQAEDVANYYCQQYHSY
Chrysochloris asiatica V537 igkv AMDV01341299.1 56410 ACEDIIMTQSPASRAVSLGETVTINCKSSQSLTYYASQYLAWYQQKAGQAPKLFIYQISKRVSGVPDRFSGSGSGTDFTLTISRVQAEDVADYYCQQGNIT
Chrysochloris asiatica V538 igkv AMDV01344407.1 2560 AMGDIVLTQSPASLSVFLGERVSLSCKASQSVSSYLAWYQQKPGQAPRLLIYDASNRADGIPDRFSGSGSGTDFTLSISSLKAEDFGTYYCQQRNNYP
Chrysochloris asiatica V539 igkv AMDV01344408.1 1808 TSGDIVLTQTPFTEPITLGQPATISCKSSQSLVHSDGKTYLYWFQQKPGQAPHALIYQVSNRYSGVPDRFIGSGAVTDFTLKISKVEAEDVAVYYCWQGI
Chrysochloris asiatica V540 igkv AMDV01344413.1 4822 AMGDIVLTQSSASLSLSPGERASITCKASESVFSTIHWYQQKPGQAPRLLINYANNREDGIPERFSGNGSGTDFTLTISSLEAEDFGIYFCQHSSNSH
Chrysochloris asiatica V541 igkv AMDV01344415.1 2677 FSQDIVLTQSPVSLPVTLGDSATIKCKSSENLPEDEDGDILLYWYQQKPGQAPRLLIYYVSIRDTGVPDRFIGSGAGTDFTLKISRVEAEDIAVYYCMQAVQDP
Chrysochloris asiatica V542 igkv AMDV01344416.1 5605 TSVDIVMTQTPRSLSITLRQPATLTCKSSHSLVHSDEKTYLNWSQQKPGQVPHALIYEVSNQYTGVPDRFIGSEEVTDFMLKISGVEAEDIAVYYCW
Chrysochloris asiatica V543 igkv AMDV01344421.1 163 AMGDIVMTQSPASLSVSPGERASITCRASQSVNSNLHWYQQKPGQAPRLLIYYANSRADGIPERFSGSGSGTDYTLTISSLEAEDFAMYYCQQGYSS
Chrysochloris asiatica V544 igkv AMDV01344424.1 723 AMGDIVLTQSPASLSLSPGERVSLTCKSSQSVNSYLNWYQQKLGQPPRLLIYYASKRADGIPERFSGSGSGTDYTLTISSLEAEDLGTYYCQQYNNFP
Chrysochloris asiatica V549 ighv AMDV01350957.1 5727 GDQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTSNGIQWVRQIPGHGFEWIGEIYPSIDITNYAQKFKGRVTITSETSTSTAYMDLSGLSSEDTAIYYCAR
Chrysochloris asiatica V550 ighv AMDV01351007.1 1006 GGLSQVQLVQSGAELKKPGSSVKISCKTSGYTFNDYDISWVHQILGHGFEWIEDINPSNGGTGYAPKFKGRVTITRETSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V555 igkv AMDV01360867.1 1258 ACGDIAMTQSPAFQAVSLGETVTINCKSSQSLTNASYQLLSWYQQKAGQAPKLLIYQGSNRPSGVPDRFSGSGSGTDFTLTISRVQAEDVAIYFCQQYI
Chrysochloris asiatica V558 igkv AMDV01371955.1 970 TSGDIVMTQTPLSLSITLGQPATLTCKSSQSLVHSDGKTYLSWFQQKPGQTPRALISWASNRYTGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCMQY
Chrysochloris asiatica V630 trdv AMDV01053039.1 5987 VSLDINLEPDARILTVLAGEPATFRCSVTGGDLKNYQVSWYKKNEDNSLILVYKLNSSSNDNLRDNFKGKINVLKNQFILEIQKTTTKDVGTYYCGSD
Chrysochloris asiatica V632 trav AMDV01053048.1 4529 TSSKNEVEQSPSYVSAQEGQLITINCSYSIGMTSLQWLQQNPGGSIVSLFILSLEMKKKGRLRATLNTKERYSSLHITASQPRDSATYFCAV
Chrysochloris asiatica V633 trdv AMDV01053056.1 1145 FSMAQTVTQSQRQISVQKAQTVTLECTYDTSATNYLLLWYKQLPSGKMTFIIRQDSYYQQTASQNRFSVNFQKAAKSFNLIISNSQLEDSAMYFCAYSI
Chrysochloris asiatica V634 trdv AMDV01053058.1 4172 FSMAQTVSMSQRQISVQEAQTVTLECTYDTSATDYLLFWYKQLPSGKMILIIRQESYYQQTAPQNRFSVNFQKAAKSINLTISNSQLEDAAMYFCAYSI
Chrysochloris asiatica V635 trav AMDV01053060.1 17004 FSMAQTVTQSQRQISVQEAQTVTLECTYDTSDSYYYLFWYKQPSSREMIFIIQQESFNPQTAPQNRYSVNFQKAAKSINLMISDSQLEDAAMYFCAYSI
Chrysochloris asiatica V636 trav AMDV01053063.1 689 FSMAQTVTQSQRQISVQEAQTVTLECTYDTTESYYYLFWYKQPSSREMIFIIRQYNLNPQTGPQNRFSVNFQKAAKSINLIISDSQLKDAAIYFCAYST
Chrysochloris asiatica V637 trav AMDV01053065.1 38011 PRRADWIRSQETEVSQTEGESVTLLCHYEISVKTVDLFWYRAYPTRAPEYILFRTWGSTGKGKGEASFAKERFNSKITSNMTTLSIKNLAFTDTATYYCAMQR
Chrysochloris asiatica V638 trav AMDV01053065.1 29559 FSKSQSIIQFPPEIFTQEEESVTLNCKFTIDNPNYVLGWYGKNSRNNIFYLISQSSVGSRNTRNGRFSLNFEKAAKTITLAISAVKSEDSGKYFCAINI
Chrysochloris asiatica V639 trav AMDV01053065.1 1216 FSMAQTVTQSQRQISVQKAQTATLECTYDTSATNYYLFWYKQPSSGEMIFIIRQESFNPQTAPQNRYSVNFQKAAKSINLMISDSQLEDAAMYFCAYSI
Chrysochloris asiatica V640 trav AMDV01053066.1 33916 ITGDAKATQPNSMECTEGEPVNLPCNHSTISGNEYIYWYRQILHQGPEYMIHGLKNNVTNKMAYLSIPTDRKSSTLILSHVTLRDTAVYYCIVR
Chrysochloris asiatica V641 trav AMDV01053066.1 26177 VCSQELEQSPQSLIIQEGEDFLINCNSSKSVYVLYWYKQKHGEQPIFFMMLQKTGEKKSHGKVTATLDEKKQQSSLHVTASEPRQSGIYLCAAD
Chrysochloris asiatica V642 trav AMDV01053066.1 13664 VNGQLLNQSPQSLSIQEGEDFTMYCNSSSTLNSLVWYKQSPEEGLVLLITLYKAGELTRNEKLTAQFGRSRKDSILHSSVSTSDEAGIYFCAG
Chrysochloris asiatica V643 trdv AMDV01053067.1 686 CSLAQTVTQAPTTVTMQEGEDANLGCKFEARWSAYLLYWYKQLPSGGMFFLIQQEYSKSNAKQDRYSVNFQKTSKSINLTISSLQLVDSAKYFCVLWH
Chrysochloris asiatica V644 trav AMDV01053068.1 2637 VGGQNADMVQSPLILNAWEKEMAIINCSYKDGTLDYFLWYKKEAGKGLNLLIDIRSNREMKQDRRFTVFLNKKEKHFSLHISAAQPGDSALYFCAA
Chrysochloris asiatica V645 trav AMDV01053070.1 25511 ENTQQMEQSPRFLSIQEGENFTLYCNSSSVYTNFQWYRQKPGEGPVHLIMLTKGGQVKNQKGLTAQFGEARKDSFLHSTAAQSEDTGLYFCAG
Chrysochloris asiatica V646 trav AMDV01053070.1 11653 LRVETKVEQSPRFLFLQEGKNSSLLCNFSISVTSVQWFQQNPAGHLIPLFYITLEMKQKGRLKSTLNIKERYSQLYIRDSQPEDSATYFCAIE
Chrysochloris asiatica V647 trav AMDV01053074.1 1179 EARTQSVTQPDNHISVSDGDPLELRCNYSTTGSPYLFWYVQYPQKGLQFLLKYYSGDTLIKGIKGFEAEFKKSETSFHLKKHSAHWSDSAEYFCAVS
Chrysochloris asiatica V648 trav AMDV01053077.1 4191 VNGQQINQIPEFLFIHEGEKFFIYCNSSSTFNSLQWYKQKPGGSPVLLIMLLKAGEVKEQNSLTAQFGKTRKDSSLHIKDAHPADTGTYFCAM
Chrysochloris asiatica V649 trdv AMDV01053079.1 15884 SILAQNVIQDQSDISMQEGRNAILNCRCETSQSVYYILWYKLLSSGEIVFLIRQSSSTQDSQSGRYATVFQKEGKSISLIISTLQLDDSGKYFCALWE
Chrysochloris asiatica V650 trav AMDV01053079.1 4667 VSCEVTVEQSPDSLHVQEGETTNFTCKFPPSSFYALLWYRWESAQSPKVLFLLRTNGDEKEEGRLRVTLNTKEGYSYLYIKGFQLEDSATYLCAF
Chrysochloris asiatica V651 trdv AMDV01053082.1 34179 SIVAQNVIQDQSDKFMQEGITVTLDCQYETSSSGYYIFWYKLLSSGEIIFLIRQSSSSQNSKSGRYSTIFQKEKKSISLIISTLQLDDSAKYFCALWE
Chrysochloris asiatica V652 trdv AMDV01053082.1 10860 SILAQNVIQIQSDESMQEGTTVTLDCQYETSQSVYYILWYKLLSSGEIIFLIRQSSSSQNSKSGRYSTIFQKKGKSISLIISTLQLDDSAKYFCALRE
Chrysochloris asiatica V653 trdv AMDV01053082.1 8952 SIVAQNVIQVQSDQSMQEGTTATLDCQYETSWSAYYISWYKLLSSGEIIFLISQSSSSQNSKSGRYSTNFQKKKKSISLIISTLQLDDSAKYFCALRE
Chrysochloris asiatica V654 trav AMDV01053084.1 65372 KTNGDSVTQTEGSVTLSEGAYVILNCTYQSSYTNVFLFWYVQYLNKSPQLLLKSATDRQGTENDGFQASLVKSEKSFHLKKHSLHVSDSAVYYCALS
Chrysochloris asiatica V655 trdv AMDV01053084.1 59992 SSMAQKVTQAQPAISVSEKESVTLKCAYEVATSDFYLFWYKQTPTGKMIFLIRQEYYNEQNATEGRYSLNFQKATKSISLTITVLQLEDSAVYFCALRD
Chrysochloris asiatica V656 trav AMDV01053084.1 50622 LNGEDQVEQSPQALIIQEGDNPSLNCSFSVSNFRGLQWYKQEPGKGPELLFLLYSVGDEKQKEGLKATLSKKESSLHITTAKSEDSATYLCAI
Chrysochloris asiatica V657 trav AMDV01053084.1 35730 MSSKQEVQQSPPALTIQEGETLALNCSYTDSAMYFLQWFRQDPGKGLKSLLVIQSNQREQKNRRLKALLDKSSRHSVLYIATSQTDDSTTYFCAV
Chrysochloris asiatica V658 trav AMDV01053084.1 25436 GTRAQSVTQPDIHVTVSEGDPLELRCNYSSSVLPYLFWYIRYPNQNFQLLLKYTSGNVLVSGIKGFQAELKKTENSFHLKKLSTHWSDTAEYFCALS
Chrysochloris asiatica V659 trav AMDV01053084.1 15903 LKGEQVEQSPAVLSLPEGASCTMLCNFSTSVNNLQWFRQNPGGPLISLFYIPSGSKKNGILSATTVAEERHSSLYISSSQTTDSAIYLCAVQTQCSP
Chrysochloris asiatica V660 trav AMDV01053089.1 835 RTNGDLVTQEKGPVTLPERAPLFLNCTYQTSYPASLFWYVQYESKAPELLLKSSSGNQDVDNRGFQANHVKSDRSFHLKKLTVQQSDKAVYYCGLR
Chrysochloris asiatica V661 trav AMDV01053091.1 19636 VLGQQKKVEQHPGSLSIPEGATVHINCTYEDRASQYFSWYRQYSGKGLELLIFIYSNSIKKEGRFTAQLNKGSQYVSLLITDSQLDDSATYLCAVS
Chrysochloris asiatica V662 trav AMDV01053091.1 13494 GIRAQTVTQPEDHIFVFEGATVQIKCNYSYSGSPVLSWYVQYPKKRLQLLLRHTSRETIKGFTADLDKGKMSFHLKKPSAEEEDSAMYYCALS
Chrysochloris asiatica V663 trav AMDV01053091.1 3571 VKSQVEQNPEALHIQEGENAIMNCSYKSTLNNLQWYRQDSGRRIFLLLLIRSNERVKQSGRLRATLDNSIKNSSLFITTSNTADSATYFCAT
Chrysochloris asiatica V664 trav AMDV01053092.1 6191 GTSGDSVTQQEGQVILSEEALLTMNCTYTATGYPTLFWYVQYPNEGLQLLLKATKANEKGKSKGFEATYHKETSSFHLKKASVQDSDSAVYYCALS
Chrysochloris asiatica V665 trdv AMDV01053094.1 3494 FSVAQKVTQAQSTMTVNEKEAAVLSCTYETSDTTFYLFWYKQPSSGKMIFLIRQDSYSQHNATEGRYSLNFQKAMKSIHLVISVSQLGDSAVYFCALRE
Chrysochloris asiatica V666 trav AMDV01053095.1 2607 LCRGETVEQHPSTLSILKGSSLVINCTYSDSASSFFVWYKQEAGRGLQHLINIFSHMDKKQDQRLTILLDKRAKHISLHITDAQQEDSAVYFCAAS
Chrysochloris asiatica V667 trav AMDV01053096.1 3940 GVRGIKVEQSPSDLSLQEGTSSTLRCNYSSTVENVQWFWQKPGEGLIRLFYMTSGMKQNGRLQYTMNSKERYSTLTITASQLEDSATYLCAVE
Chrysochloris asiatica V668 trav AMDV01053098.1 6252 GSYADTVTQTEGQITLSEGFSLTLNCSYTTTQYPALFWYVQYPNEGLQLLLKVTKAGEKGSNKGFEAIYNKEASSFHLEKASVQDSDSAVYYCVLS
Chrysochloris asiatica V669 trav AMDV01053100.1 12197 EARAQSVTQPDVRVSVTEGLPLELKCNYSYSTTPSLFWYVKHPNEGLQLLLKYYSGNTLVKGNKDFEAELKKSESSFNLRKHSAHWDDSAEYFCAVS
Chrysochloris asiatica V670 trav AMDV01053102.1 1246 EARAQSVTQPDVQVSVTEGLPLELKCNYSIRGAPSLFWYVKHPNEGLQLLLKYLSGNTLVKGSKDFEAEFKKSESSFNLRKRSAHWDDSAEYFCAVN
Chrysochloris asiatica V671 trav AMDV01053103.1 6724 EARGQSVTQPDVQISVTEGLPLELKCNCSYSTTPYLFWYVKYPNEGLQLLLKYYSGNTLVKGNKDFEAEFKKSESSFNLRKRSAHLDDSAEYFCAVS
Chrysochloris asiatica V672 trav AMDV01053105.1 880 EARAQSVTQPDIRVSITEGLPLELKCNYSYSGTPDLYWYVKHPNEGLQLLLKYYSGNTLVKGSKGFEAEFKKSESSFNLRKGSAHWDDSAEYFCAVS
Chrysochloris asiatica V673 trav AMDV01053108.1 1740 EARAQSVTQPDVQVSVTEGLPLELKCNYSYSAASSRFWYVKYPNQGLQLLLKDYSGQTRVKGSKDFEAEFKKSESSFNLKKQSAHWDDSAEYFCAVS
Chrysochloris asiatica V674 trav AMDV01053110.1 7457 EARAQSVNQPDVQVSVTEGLPLEFRCNYSYGATLYLYWYVKYPNKGLQLLLKYYSGNTLVKGINDFEAEVKKSESSFNLRKRSAHWDDSAEYFCAVS
Chrysochloris asiatica V675 trav AMDV01053110.1 3420 EAGAQSVTQPDVRVSVTEGLPLELKCNYSYSGTPYLYWYVKYPNEGLQLLLKYFSGNTLVKGINDFEAEVKKSESSFNLRKHSAHWDDSAEYFCAVS
Chrysochloris asiatica V676 trav AMDV01053114.1 1194 GNNGDTVTQTEGQITLYEGFFLTLNCSYTSTIYPTLFWYVQYPDEGLQPLLKVTKAGEKGSNKGFEAIYNKEASSFHLKKASVQDSDSAVYYCAMS
Chrysochloris asiatica V677 trav AMDV01053116.1 6321 VNSQKVEQSPPALSMQEGEKAVLICNFTSSPTYLQWYRQDPGRGLVFLVRIRENDGDKLEGRLRVTFERTIKQSSLQIPASQPEDSATYFCAV
Chrysochloris asiatica V678 trav AMDV01053122.1 2323 VGRGEKVEQTPSDLSVEERKSCVFNCTYTDSASTYFFWYKQEPGKGLQFLIRILSNEVNKHDQRFTFTLNKKEKHLSVHIEDAHPEDSATYFCAAS
Chrysochloris asiatica V679 trav AMDV01053123.1 8873 VGRGEKVEQTPSDLSVEERKSCVFNCTYTDSTSYYFFWYKQEPGKGLQFLIRVASSDVKNQDQRFTVTLNKKEKHLSLHIEDAHPEDSATYFCAVR
Chrysochloris asiatica V680 trav AMDV01053128.1 5255 VGRGEKLEQTPSDLSVEERKSCFFNCTYTESTSTYFFWYKQEPGKGLQFLIRILSSENKKQDKRFTVTLNKKEKHFSLRIEDAHPEDSATYFCAVR
Chrysochloris asiatica V681 trav AMDV01053134.1 1218 VVELKILQPTELVAMEGTSIQMNCTYQTFGFNGLFWYQQTDGGTPTFLIYNVQSGMEKKGRLYSFLNQSSTYNYLLHTKLQINDSACYLCAVR
Chrysochloris asiatica V756 trbv AMDV01101089.1 33311 IDARTVRQWPVVLVRRVGSPVSLHCSVTGTSNPNLYWYWQAAGGSPQMLFYSIGVGDIQSEAPGHLSASRPQDSEFTLSADKLQPGDSGVYLCAWD
Chrysochloris asiatica V987 iglv AMDV01296192.1 2219 SVVSYELIQASSVSVILGQTATISCSGELLPKKYASWFLQKPGQAPVHVIYKDSERPSGIPDRFSGSSSGTTATLTISNTQAEDEANYYCQSWDSSDN
Chrysochloris asiatica V988 iglv AMDV01296196.1 5613 YVVSYELIQTPSVSVTLGQTVTLSCSGEKLSERYAYWYQQKSGQAPVLVIYKDSERPSGIPDRFSGSSSGTTATLTISNTQAEDEADYYCLTSDSSGN
Chrysochloris asiatica V989 iglv AMDV01296204.1 26895 SVVSYELTQTPSVSVTLGQTVTLSCSGELLPKKYAYWYQQKPGQAPELVIYEDSKRPSGIPERFSGSSSGTTATLTIISTLAEDEADYYCQSTDSSNN
Chrysochloris asiatica V990 iglv AMDV01296204.1 19939 SVVSYELTQKPSVSVTLGQTATISCSGEKLSERYAHWYQQKSGQAPVLVIYKDSERPSGIPDRFSGSSEGTTATLTISSTQADDEADYYCQQ
Chrysochloris asiatica V991 iglv AMDV01296204.1 8614 SVVSYELTQPPSVSVTLGQTVTLSCSGELLPKKYAYWYQQKPGQAPVCVIYKDSERPSGIPDRFSGSSSGTTATLTISNTQADDEADYYCLSLDSSDN
Chrysochloris asiatica V992 iglv AMDV01296243.1 2749 LSSQAVVTQEPSLVVSPGGTITLTCGSSTGIVTDGHYPYWFQQKSGLAPRVLIYNTNNKVSWTPARFSGSLTGGKAALTISGAQPEDEAEYYCWLVYSGI
Chrysochloris asiatica V993 iglv AMDV01296252.1 4205 SWAQAVLSQTPSVSGNPGQQVSISCIGSSTNIGADYYVHWYQQLPDTAPKPVIYDDSKRPSGIPDRFSGSKSGNSASLTIAGLQPEDEAIYFCQSYDNSLSG
Chrysochloris asiatica V994 iglv AMDV01296263.1 7430 SWAQSVLTQTPSVSGKPGERVRISCIGSSTNIGDGYSVHWYQQFSDMAPKLLIYGNSNRPSGIPDRFSGSKSGNTGSLTISELQPEDESIYFCQSYDSSLN
Chrysochloris asiatica V995 iglv AMDV01296266.1 1884 SWAQSVLTQTPSVSGKPGEQVSISCTGSSTNIGGYSVQWYQQFPDMAPKLLIYDNSKRPSGVPDRFSGSKSGNTGSLTISGLQPDDEADYFCHSYDSSLN
Chrysochloris asiatica V996 iglv AMDV01296268.1 4768 SWAQSVLTQTPSVSGNPGQRVSISCTGSSTNVGGSYGVLWYQQFPDSAPKLLIYGNSNRPSGIPDRFSGLKSGSSGSLTITGLQPEDEAVYYCHSYDVSLN
Chrysochloris asiatica V997 iglv AMDV01296271.1 7427 SWAQSGVSQTPSVSGNPGQQVSISCTGSSTNIGGYHVHWYQQLPGLAPKQVIYADSNPRSGVQDRFSGSKSGNTASLTITGLQPEDEAVYYCHFYDNSLD
Chrysochloris asiatica V998 iglv AMDV01296275.1 3162 SVTQAGLTQPSSVSKGLTETIKITCIGDSNNVGYEGAGWVQQRESQAPQTLIYRNNNRLPGISERFSGSRSGNVATLTISDVQVEDEADYYCTAWDKGINV
Chrysochloris asiatica V1018 igkv AMDV01306789.1 10486 ACGDIVMTQSPASRAVSLGETITINCKSSQSLTYSGYQLLSWYQQKAGQAPKLLIYWGSNRESGVPDRFSGSGSGTDFTLTISSVQAEDVGDYFCLQGHSA
Chrysochloris asiatica V1019 igkv AMDV01306796.1 6130 TCGDIIMTQSPPSWAVSLGETVTINCKSSQSLTIPSYQVLSWYQQKAGQAPKLLIYQGSKQASGVPDRFSGSGSGIDFTFTISRVQAEDVAHYYCQQGLNAP
Chrysochloris asiatica V1020 igkv AMDV01306799.1 6930 ACGDIVMTQSPASRAVSLGETVTINCKSSQSLTIGSYQLLAWYQQKAGQAPKLLIYGGSNRVSGVPDRFSGSGSGTDFTLTISRVQAEDVAQYYCQQAVSA
Chrysochloris asiatica V1021 igkv AMDV01306801.1 9847 ACGDIIMTQSPASRAVFLGETVTINCKSSQSLTGSSDYQRLAWYQQKAGQALKLLISWASTRAPGVPDRFIGSGSGTDFTLIVSRVQAEDVAHYYCQQGLN
Chrysochloris asiatica V1022 igkv AMDV01306804.1 780 ACGDIVMTQSPASWAVSLGETVTINCKSSQSLTSSNNQYLAWYQQKAGQAPKLLIYWGSTLISGVPDRFSGSGSGTDFTLTISRVQAEDVAQYYCQQYHSYP
Chrysochloris asiatica V1023 igkv AMDV01306812.1 5942 ACGDIIMTQSPASRAVSLGETVTINCKSSQSLTFGSYQALSWYQQKAGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTLSRVQAEDVGDYFCLQGR
Chrysochloris asiatica V1047 igkv AMDV01333498.1 10460 SSRDIVLTQRPLTLTITLGESATISCKSSENLEDSDGHMFLNWYQQKSGQAPQLLIYEFSNQYTGAPDRFRGSGSDTDFTLKISRVEAEDVAVYYCMQNIENP
Chrysochloris asiatica V1048 igkv AMDV01333498.1 4188 SSGDIVLTQSPLTLPITLGDSATINCKSSESLEDSDGDTYLNWYQQKPGQVPRLLIYEVSNRFTGVPDRFSGSGSERDFTLKISRVEAEDVAVYYCMQDKEDP
Chrysochloris asiatica V1049 igkv AMDV01333499.1 9358 SSGDIVLTQSPLTSPITLGESATISCKSSQSLKYSNGYTYLNWFQQKPSQAPRPLIYGVSNRFTGVPDRFSGSGSDRDFTLKISRVEAEDVAVYYCQQTIDTP
Chrysochloris asiatica V1050 igkv AMDV01333510.1 3490 ATGDVVMTQSPASLAVSPGEMVTINCKASQSVGSYLNWYQQKPGQAPKRLIYRASNLGSGIPNRFHGSGSGREFTLSISSFQPEDAAVYFCQQYNSL
Chrysochloris asiatica V1051 igkv AMDV01333516.1 11152 SSGQIVLTQSPASMEFSPGERVTMNCKASSSVSTSYLHWYQQKPGASPKLLIYGTSNLASGIPGRFSGSGSGTDYSLTISSVQAEDAAMYYCHCAY
Chrysochloris asiatica V1052 igkv AMDV01333522.1 2544 SSGDIVLTQSPASMAFSPGERVTMNCKASSSVSTSYLHWYQQKPGASPKLLIYGTSNLASGIPGRFSGSGSGTDYSLTISSIQAEDDGIYYCHQWDSS
Chrysochloris asiatica V1053 igkv AMDV01333579.1 8364 FSQDIVLTQSPVSLSITLGDSATITCKTSLPEDYGDYAYLNWYQQKPGQALKPLIYTVSNRGPGVPDRFIGSGSGADYMLKINTVEDEDAAVYYCQQNERFP
Chrysochloris asiatica V1054 igkv AMDV01333580.1 6513 FSQDIVLTQSPVSLPVSLGDSATIKCKSSENLPEDEDGDIFLHWYQQKPGQAPRLLIYTVSNRETGVPDRFIGSGSGTDYMLKINRVEAEDAAVYYCQQNERSP
Chrysochloris asiatica V1055 igkv AMDV01333583.1 1675 TSGDIVMTQTPLSLVIIPGEPATISCKASESMVHPDGNTYLHWYQQKPGQSPQQLIYQVSKRPSGVPDRFSGSGAVSDFTLRISQVKAEDAAVYYCQQYRKYP
Chrysochloris asiatica V1056 igkv AMDV01333585.1 7068 VRGDAVLTQSPVHIFVSVGESVSIICRSSEDISDYLTWYQKKPGQIPKILIYDADNLYSEAPDRFAGIQSGRDFILKINNVEIDDAADYYCQQDYTIP
Chrysochloris asiatica V1057 igkv AMDV01333588.1 20335 SSGDIVMTQTPSTLSVTLGEPATISCKSSQSLLHSNGDTYLEWYQQKSGKAPQLLIYRVSNLFSGVPDRFSGSGAVSDFSLKISRVAAEDAAVYYCKQH
Chrysochloris asiatica V1058 iglv AMDV01333588.1 14392 CMGHIILAQVPETLVTIQGAFVSITCRTSSGVGTSMAWYQQKHKESPRLLFFGASALAAGTPDRFQGSGSGQDFSLTIHGVHDEDTGMYYCQ
Chrysochloris asiatica V1059 igkv AMDV01333589.1 3707 SKADIVLTQTPLTLSITIGEPATITCKSSQSLVHSNGKTYLHWFQQKPGQAPRLLIYEVSNRFTGVPDRFIGSGSVTDFALKISRVEAEDVAVYYCEQD
Chrysochloris asiatica V1060 igkv AMDV01333591.1 4211 SGDITLNQTPASQSVSPGERITISCRASADVHKEISWVRIKLGQRLEPLISHHSLAPGVPARFSSSESGTDYVLSISPVQPGDSGEYYCLHDYGWP
Chrysochloris asiatica V1061 igkv AMDV01333597.1 907 TSGNIVMTQSPLSLSMLGQTATLTCKSSQSLVHSDGKTYLNWIQQKPVRAPRSLIYQVSNWYPGVPARYIGSGAVTDFTLKISRVEAEDIAVYYCMQGIQHP
Chrysochloris asiatica V1062 igkv AMDV01333598.1 3976 TSGDIVLTQTPFSVSIMLGQPATISCKSSQSLVDSDGKTYLYWLQQKPGQAPRRLIYQVSNRDTGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCAQATGLP
Chrysochloris asiatica V1063 igkv AMDV01333602.1 782 TSGDIVMTQTPLSLSITLGQPATLTCKSSQSLVYSDGKTYLYWFQQKPGQAPRPLINFVSNRYTGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCWQFVAYP
Chrysochloris asiatica V1064 igkv AMDV01333606.1 3094 VSCDIQMTQSPASLAVSLGEKVTMTCRSSQNINNELDWYLQRPGEPPKLLIYHASNLHSGVPSRFSGSGYGTDFTLTISTLNAEDVGTYYCQHDYGTP
Chrysochloris asiatica V1065 igkv AMDV01333617.1 4281 TSGDIVMTQTPLSLSITLGQPATITCKSSQSLVNTDGKTYLNWFQQKPGQAPRALIYLVSNRHTGVPDRFIGSGAVTDFTLKISRVEAEDIAVYYCFHYREYP
Chrysochloris asiatica V1071 igkv AMDV01341252.1 1741 AMGDIVMTQSSASLSVSPGERVSLTCMASQSVYSYVAWYQQKPGQAPRLLIYYANSRADGIPERFSGSGYGTDFTLTISSLKAEDFGTYYCQQHGYSP
Chrysochloris asiatica V1072 igkv AMDV01341259.1 1751 AMGDIVMTQSPASLSVSPGERVSLNCKSSETVYSIAWYQQKPGQAPRLLIYGANSRADGIPDRFSGSGSGTDFTLTISSLKAEDLGTYYCQEGYSS
Chrysochloris asiatica V1073 igkv AMDV01341264.1 1232 AMGDIVMTQSPASLSLSPGERASITCRASQSVSNALHWYQQKPGQAPRLLIYYANSRADGIPDRFSGSGSGTDFTLTISSLKAEDFGTYYCQQGYIP
Chrysochloris asiatica V1074 igkv AMDV01341268.1 5342 TMGDVVMTQFPASLSLSPGQRSFFTCKSSQDVGDNVAWYQQKPGQAPRLLVYEVSSMASGIPGRFSGSGYRQAYNLIISSVEAEDVGTYYCQQYEEYP
Chrysochloris asiatica V1075 igkv AMDV01341276.1 732 SRGDTVLTQSPLTLPLTLGESATISCKSSESLVHSNGYTYLHWFQQKPGQAPRGLIYLVSNRHTGISDRFSGSGSVTYFTLKISRVEAEDIAIYYCTQSTKVP
Chrysochloris asiatica V1076 igkv AMDV01341279.1 4011 SSGDIVLTQSPASMAFSPGERVTISCKASSSVSTNSLHWYQQKPEASPKLLIYGTSNLASGVPGRFSGSGSGTDYSLTISNIQAEDTGIYYCQQGYSY
Chrysochloris asiatica V1077 igkv AMDV01341300.1 2417 ACGDIVMTQSPASRAVSLGETVTINCKSSQSVTSSNYHYLAWYQQKAGQAPKLLIYLGSNRASGVPDRFSGSGSGTDFTLTISRVQAEDVGDYFCQQTR
Chrysochloris asiatica V1078 igkv AMDV01341311.1 1270 ACGDIVMTQSPASQAVSLGETVTINCKSSQSLTSDGIEYLTWHQQKAGQAPKLLIYGGSKRASGVPDRFSGSGSGTDFTLTISRVQAEDVASYYCQQAYSA
Chrysochloris asiatica V1080 igkv AMDV01344426.1 3384 SSGDTVLTQSPLTLPITLGDSATISCKLSESLEDSYGYTYLNWYQQKPGQAPRLLIYEVSNRFTGVPDRFSGSGSVRDFTLKISRVEAEDVAVYYCQQDIESP
Chrysochloris asiatica V1081 igkv AMDV01344435.1 697 SSGDIVLTQSPLTLPIALGESATITCKSSQSLKHSNGYTYLNWFQQKPGQAPRLLIYLVSNRYTGVPDRFSGSGSERDFTLKISRVEAEDVAVYYCQQNIVNP
Chrysochloris asiatica V1082 igkv AMDV01344437.1 1388 ARGDIVMTQSPASLAVSPGETVSLSCKASQSVSSYLNWHQQKPGQAPKRLIYWASNLDSGVPNRFSGSGSGTDFTLSISSFQPEDAAVYFCHQYNSL
Chrysochloris asiatica V1083 igkv AMDV01344443.1 426 SSGQIVLTQSPSSMEFSPGERVTMNCKASSSVSTSWLHWYQQKPGASPKLLIYGTSNLASGIPARFSGSGSGTDYSLTISSVQAEDAAMYYCHYAY
Chrysochloris asiatica V1086 igkv AMDV01348891.1 9079 AMGDIVMTQSPASLSLSPGDRASLTCRASQSVGSYLAWYQQKPGQAPRLLIYDASNREVGIPERFSGSRSGQDFTLTISSLEAEDFGTYYCHQYYSG
Chrysochloris asiatica V1087 igkv AMDV01348891.1 2014 TSGDIVMTQTPLSLSITLGQPATLTCKSSQSLVHSNGKTYLNWIQQKPGQAPRLLIYYVSNRYTGVPDRFIGSGAVTDFTLKISRVESEDIAVYYCWQAIGYP
Chrysochloris asiatica V1088 igkv AMDV01348905.1 34660 TSGDIVMTQTPLSLSITLGQSATLTCKSSQSLVHSDGKTCLHWFQQKPGQVPRALIYEVSNQYTGVPDRFIGSGAATDFTLKISRVEAEDIAVYYCW
Chrysochloris asiatica V1089 igkv AMDV01348905.1 22136 TMGDIVLTQSPASSLSLSPGERVSLTCKSSQSISNNLHWYQQKPGQAPRLLIYYATSRANGIPERFSGSGYGTDFTLTISSLEAEDFGIYYCQQSNTYP
Chrysochloris asiatica V1090 igkv AMDV01348905.1 5746 VMGDIVMTQSPASLSLSPGERVSLTCKSSQSISNDLNWYQQKPWQASRLLISYATSRADGIPERFSGSGSGTDFTLTISSLEAEDFGTYYCQKGYTP
Chrysochloris asiatica V1091 ighv AMDV01350311.1 332 GGQSQIQLVQSGAELKKPGSSVKISCKTSGYTFTGNSINWVRQIPGHGFEWIGYINPSSGGTGYAQKFQGRVTITSEKSTSTAYMDLSSLSSEDTAMYYCAR
Chrysochloris asiatica V1092 ighv AMDV01350317.1 7240 GGQSQVQLVQSGAELKKPGSSVKISCKTSGYTFTDYYMHWVRQIPGHGFEWIGDINPSSGGTGYAQKFQGRATITSEKSTSTAYMDLRSLSSDDTAMYYCTR
Chrysochloris asiatica V1093 ighv AMDV01350320.1 4441 GGQSQVQLVQSGAELKKPGLSVTISCKTSGYTFSDYTMHWVRQIPGLGFEWIGWIYPSNGNTNYAQKFKGRVTFTSETSTSTAYIDLFSLSSEDTAMYYCA
Chrysochloris asiatica V1095 igkv AMDV01351913.1 1293 AMGEIVMTQSPASLSVSPGERVSLNCRASQTVSSYLNWYQQKPRQAPRLLIYHASRRADDIPERFSGSGSGTGFTLTISSVEAEDFGIYYCQQHNNLP
Chrysochloris asiatica V1099 trdv AMDV01354488.1 8505 KGMLCDKITQSSTEQIVQIGSQVTLPCTYQVGHPNPDLYWYRMRPDHSFQFILYRDNTKSKDADFTQGRCSVTRSQTQKTFHLVISSVRAEDIATYYCAYD
Chrysochloris asiatica V1100 trdv AMDV01354488.1 3681 KGMLCDQITQISTEQIVQIDSQVTLLCSYQLEYSNPDLFWYRMRPDHSFHFILYRDNTRSKDADFTQGRFSVTHSQTQKAFHLVISSVRAEDSATYYCAYV
Chrysochloris asiatica V1101 trdv AMDV01354488.1 1687 KGMLCDQITQSSMEQIVQIGSQVTLPCTYQLPYTDPDLYWYRMRPDHSFQFILYRDNTNSKDADFTQGRFSVTRSQTQKTFHLVISSVRAEDSATYYCAYI
Chrysochloris asiatica V1105 igkv AMDV01357522.1 3551 ALGDIVLTQSPASLSLSPGERASLTCKSSENVFSAIHWYQQKPGQGPRLLINYATNREDGIPERFSGSGSGTDFTLTISSLEAEDFGTYYCQENSNDP
Chrysochloris asiatica V1110 igkv AMDV01375491.1 1833 AMGDIVMTQSPASLSVSPGERVSLTCRASQSVCSGLAWYQQKPGQAPRLLIYGANSRADGIPERFSGSGSGTDFTLSISSLKAEDFGIYYCQQGYVP