WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Danio rerio CABZ00000000.1 (CABZ01) 214 35 1 39 105 28 6 0
Danio rerio CZQB00000000.1 (CZQB01) 221 39 0 31 114 19 9 9
Danio rerio LKPD00000000.1 (LKPD01) 95 18 0 5 45 20 5 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Danio rerio Vs268 trav CABZ01061539.1 4965 QSFGQSITALQSTKQAAESETVILSCKYDTRADNLQWYRHYPGSTPEYLLLVYESNTVFHAEPPFPRLNASVNKVEKQVNLTISSAAVTDSAVYYCALQ
Danio rerio Vs189 ighv CABZ01044330.1 16488 AHGQSLTSSGSEVKKPRESVTLSCVVSGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFTITKDTSKNMVYLEIKSLKAEDTAVYYCAKE
Danio rerio Vs188 ighv CABZ01044330.1 11410 CRSQTLVESEAVVIKPDQSHKLTCTASGFNFGDYWMAWIRQAAGKGPEWVATLSNGNSYIYYSDKVKGRFTISRDDNKNQLYLQMNSLKTEDTAVYYCAR
Danio rerio Vs187 ighv CABZ01044330.1 9660 VSGQSLTSSDSVVKRPGESVTLSCTGSGFSVGDYWMHWIRQKPGKGLEWIGGRYSSTVYFAQSLQGQFSISTDTSKNMVYLEIKSLKTEDAAVYYCARE
Danio rerio Vs186 ighv CABZ01044330.1 6537 VSGISLTSSPAQIKAAGQSVRLSCQISGYALTDYGTAWIRHPPGKAMEWIGIIWGRGSIDSGNSFKSRFTISRDTRKNELYLDISSLQTEDTAVYYCAKT
Danio rerio Vs185 ighv CABZ01044330.1 4060 CKGQTLTESESVIIKPGNEHKLTCTFSGLSVSSADISWIRQAEGKGLEWISHISAPSGSSKYYSKAVEGRFSISRDNSKMQVYLHMTKLQTEDTGVYYCARE
Danio rerio Vs184 ighv CABZ01044330.1 1487 IDCQVVLTQSEQSVNVAPGGFYKLSCACSGFSVSGTAMHWIRQAPGKGLEWIIYYYSDSYKSSAESVQGRFTASKDSSNFYLHMNQLKTEDTAVYYCA
Danio rerio Vs179 ighv CABZ01044329.1 35874 VRGQSLTSSDSVVKRPGESVTLSCTVSGFSMSSYWMHWIRQKPGKGLEWIGRIDRGTGTIFAQSLQGQFTITKDTSKNMLYLEVKQLKSEDTAVYYCARD
Danio rerio Vs182 ighv CABZ01044329.1 49865 YFCIELDQPLVTVVKPGETFTIPCKITGYSASGGGYTNWIRHSAGKPMEWIGWFQSSSSNGVKDSLKNKISFSSESSSNAVILTGKNFNTEDTAVYYCARN
Danio rerio Vs181 ighv CABZ01044329.1 38567 CWCQTLSESDAVVIKPGGSHRLTCTISGFGGNYAMSWIRQTAGGGLEWLAYISSGSGSIYYSQAVQRRFTISRDNSKNQMYLQMNNMKIEDTAVYYCARV
Danio rerio Vs180 ighv CABZ01044329.1 37096 CKGQTLTESESVVIKPGNEHRLTCTFSGIDVGDADISWIRQAEGKALEWISHISAPSGSGKYYSKAVEGRFSITRDNSKMQVYLHMTKLQTEDTGVYYCARR
Danio rerio Vs457 igkv CABZ01052991.1 59981 KVTQSPSEKTIEAGQSVTLTCSSNLVVGKWCNDTYCLSWYLIKAGEAPKLLIYQGNLRHSSAPSRFSGNGSVRSFQLTISGARGEDSGLYFCFGDYGGFR
Danio rerio Vs451 trav CABZ01048628.1 4738 SVFGSDIKSNITDVVYKEGSDGTIFCSHYPGTGDNIFWYRQYGGSKPEFLLATYGSAKDTETSKVDPRFSVKVEKKERNHADLKISSAAVSDSAVYYCALR
Danio rerio Vs450 trav CABZ01048628.1 5941 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYAGQTLFWYLQKLNGVPKYMLNKMTNTTGHTEEEFKERFHAAFSKTSVPLTIKDLRVSDSAVYYCALQ
Danio rerio Vs452 trav CABZ01048629.1 5047 SVFGNDIKPNSTDVYEEGSDGTIFCSHSPGAGDYIYWYRQYGGSKPEFLVFTFGSVKDAETSKVDPRFSVKIEKKEQNHADLKISSAAVSDSAVYYCALR
Danio rerio Vs156 ighv CABZ01044327.1 11805 LYCQGMDSIESSVQKKPGETLTLSCRGSGFSFDCCSMHWIRQQAGKPLVWMGLGYSSGNGHKAESFKERLEISRDDSKSMMYMKLSGLTEEDSAVYYCAKQ
Danio rerio Vs165 ighv CABZ01044329.1 2543 IKCQNMESIESSVQKKPGETLTLSCRGSGFSFDCCSMHWIRQQAGKPLVWIGYVSNGGVSQNYAESFKGRTEITRDNSKSMVYLKLSGLTAEDSAMYYCARQ
Danio rerio Vs167 ighv CABZ01044329.1 7641 VDSYELTQSDSLTVRPDDSLTINCKVSYSVTDYSTAWIRQPAGKALEWIGVIYYNGNLDYKDSLKSKFSITRDTSSNTITLQGKNVKAEDTAVYYCARR
Danio rerio Vs166 ighv CABZ01044329.1 4633 IKCQSMESIESSVQRKLGETLTLSCRGSGFSFSYYNMHWIRQQAGKPLVWIGRVYDSTDYSYAESFKSRAEITRDNSKSMTYLKLSGLTAEDSAVYYCARQ
Danio rerio Vs161 ighv CABZ01044328.1 12221 VNGQSLESIPSSSVTKKPGETLNLSCKGSGFDFGQYGMHWIRQPAGKALDWIGVIWYDASKTVYAKSVEGRIEITRDNSNNMVYLKLSGLKTEDSAVYYCAR
Danio rerio Vs160 ighv CABZ01044328.1 10474 VHCVELTQTDSIVLKPGEVLTLSCKISGYSVTDGSYWTHWIRQAAGKALEWIGQIGANGYTNYNDKLNSRFILTKHTSSNTETLSGQNMQTEDTAVYYCARER
Danio rerio Vs163 ighv CABZ01044328.1 16293 IKCESMESIESSVQKKPGETLTLSCRGSGFSFSSYYMHWIRQQAGKPLVWIGGTGYGYAESFKGRAEITKDNSKSMTYLKLSGLTAEDSAVYYCARQ
Danio rerio Vs162 ighv CABZ01044328.1 14008 SIVLRPGQVLTLSCKISGYSVTDSSYCTDFIRQAAGKALEWVGEICGSGNTYYSDKLKSRFTVSRDSSSSSVTLSGQNMQTEDTAVYYCARQTQ
Danio rerio Vs204 igkv CABZ01050233.1 1331 CIGQVTVTQTPSVLLSEPGRSLTVHCRTSSDPVNWCNSKQCVSWYLQKPGEAPKLLIHSTSSLQPGTASRFSGSGSNSDFTLSISAVQTEDAGHYYCQS
Danio rerio Vs205 igkv CABZ01050233.1 6267 CGGQISVTQSPSMTAEPDKTITITCRTSTDVYRYYDGDQTLAWYFQKPGEAPKLLIYWVNHLESGIASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs206 igkv CABZ01050233.1 7625 CAAQITVTQSPVETVKPGENVQMSCKLSSSETGCYPPCVSWYLQKPGEAPKLLIYRTSSRQSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs207 igkv CABZ01050234.1 4054 CIGQVTVTQTPSVLLSEPGRSLTVHCRTSSNPACCYSGDPAVSWYLQKPGEAPKLLIYYTDVLQSGTASRFSGRGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs201 igkv CABZ01050232.1 25426 CAAQITVTQSPVETVKPGENVQMSCKLSSSKTDCNPPCVSWYLQKPGKAPKLLIYYTNRRQSGTASRFSGSGSNLDFTLSISGVQTEDAGHYYCMSFNYGPVL
Danio rerio Vs202 igkv CABZ01050232.1 30145 CGGQISITQSPSMTAEPDQTAAITCKISRNVYNGNYLAWYLQKPGEAPKLLIYYTSSRQSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs203 igkv CABZ01050233.1 165 MSGQLSVTQTPSAAAPAGETVTINCQTSRGIGDRSRGCGSCLSWYLQKPGEAPKLLIYFIRSLQSGTPARFSGSGADYGSDFTLTISGVQTEDAGHYYCMG
Danio rerio Vs152 trbv CABZ01043010.1 9753 SSGEIIITQNEHLDRTELLIQLNKNISLRCNHNDANYYNMYWYIQRSQGEMSLVAFSLGKDTEEIVAPFEKTKYKMKRPDIKESSLEINSVVQEDSGIYFCASSI
Danio rerio Vs168 ighv CABZ01044329.1 8956 SIVLRPGQVVTLSCKISGYSVTERYCTHFIRQAAGKALEWVGAICGSGNTYYSDKLKSRFTVSRDSSSSSVTLSGQNMQTEDTAVYYCARESQ
Danio rerio Vs198 igkv CABZ01050232.1 19386 MSGQLSVTQTPSAAAPAGQTVTINCQTSRGIGDRTQGCGSCLFWYLQKPGEAPKLLIYYIRSLQSGTPARFSGSGADYGTDFTLTISGVQTEDSGHYYCMG
Danio rerio Vs199 igkv CABZ01050232.1 20556 CIGQVTVTQTPSVLLSEPGRSLTVHCRFSSDPECCYSGDSLVSWYLQRPGEAPKLLISYTSRLVSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs176 ighv CABZ01044329.1 23385 IDCQVVLTQSERSVNVAPGGFHKLSCACSGFTLRSTNMYWIRQAPGKGLEWIIYYYSDSDKSTAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCA
Danio rerio Vs194 igkv CABZ01050232.1 9338 CGGQISVTQSPSMTAEPDQTVTITCRTSRDVYRYDDGDDAFFWYLQKLGEAPKLLVRYAKSLESETPSRFSGRGSNSDFTLSINGVQTEDAGHYYCQS
Danio rerio Vs195 igkv CABZ01050232.1 11419 MSGQLSVTQTLSAAAPAGETVTINCQTSRGIGDRTQGCGSCLSWYLQKPGEAPKLLISYIRSLQSGTPARFSGSGEYYGTDFTLTISGVQTEDSGHYYCMG
Danio rerio Vs196 igkv CABZ01050232.1 12588 CIGQVTVTQTPSVLLSEPGRSLTVHCRFSSNPDCCYHVSWYLQKPGEAPKLLIYYTDVLQPGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs110 trbv CABZ01042992.1 8909 SLGNTVHQTPSKSIKTPNESAVFICTHNIGSYFQIMWYKQTKGKLGLKLMGYLNGETHNKEAEFSNKIILDGNGRRNGTLTIKELALNDSAEYFCAAY
Danio rerio Vs111 trbv CABZ01042992.1 10737 TAGDDGVLQYPKILWSTKESYAEMNCTHNKGLSYYQMYWYRQRPGETMRLIVFTMENSKPDFGDFDEKKYDASKEDPTSGSLTVKNLEPEDSAIYFCSVS
Danio rerio Vs444 trav CABZ01048626.1 1489 CRGQDRVEQPIREMTESIGDKVVISCIYSTTYTSLTLFWYKKLPNRSPTYILNQYSTEADFKERFSATLDSTEKSFPLTIKNLHVSDSAVYYCALR
Danio rerio Vs113 trbv CABZ01042993.1 4617 SVANDSVQQSPPNLVKNKGDSADLVCSHKITSYTMIFWYKQSLGQGFTLLGYTWNKNHFPEDHLSTKISLDGDGTAEAFLTIKDLEASDSTLYFCAAS
Danio rerio Vs114 trbv CABZ01042993.1 7391 TTGGRDVLQTPAFLYELKGKSAQIDCTHTKGSAYRQMYWYRQRQGQTMTLVVFTTSYTNPDYGDSEPNKFLANKKFVENGSLTVKNLEPEDTAIYFCSVSE
Danio rerio Vs115 trbv CABZ01042993.1 7986 ACLGETVDQTPDYFIKKRSESAVITCTHNIQNYNRILWYKQSADTFGFKLMGYLSFNDENKELGFDNIKLKGDAKSNGTLTIENLTVTDSAVYFCAAY
Danio rerio Vs440 trav CABZ01048626.1 10982 GVAYGNEIKPVKTEEFAKEDSSVTLSCSYSSARTLFWYRQYPGLAPQFLVFFIHGTSEAKESGVDPRFTAKPNGEKQSHVDLLLSSAAVSDSALYYCAME
Danio rerio Vs441 trav CABZ01048626.1 8125 SVSGNLIKPIQTDVFADEGSNVTLSCSYSSADYLFWYRQYPRGAPEFLVSIFEGERNSKSSDVDPRLSAKLTKSEHNHADLMLSCAAVSDSAVYYCALR
Danio rerio Vs118 trbv CABZ01042994.1 971 SVANGSVKQSPSNLIKTKGDSVNLECGHSTTYTMIFWYKQSLGHGFTLLGYTWNKNSFPEDNLSKRISLDGDGTVKAFLRIKDLEASDSTLYYCAAS
Danio rerio Vs119 trbv CABZ01042995.1 488 SVLGKSVVQTPPDLLNKPDEFAEIQCSHNIQSYYVVLWYKQNLSITNLQLMGYLNVDQDTIENDFNGKIKMKGDGRNNVTLTIRDLTVTDSAVYFCAAY
Danio rerio Vs448 trav CABZ01048627.1 1978 FVSPDSVEQKTRVQTAVEGESVTINCTYSTTDTFPYLFWYQQQVNGIPQYMLKKFPGSGEIENQFKKRFDADLDSSTTSVLLRIKEVHVSDSAVYYCALK
Danio rerio Vs449 trav CABZ01048627.1 349 DTFAQTITPLENKIVKSEGETASLSCKYEGSVTNLHWYRQYPGSRPEFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio Vs279 trav CABZ01061539.1 21528 HTEADVIKPLSLDENSHVGDAVTLSCSYKDYTGNMQNLQWYRQFPRSKPEFILYIFESGTMSKDKPDRFSAQVNKGTKQVDLNISPAVETDSAMYYCALV
Danio rerio Vs278 trav CABZ01061539.1 20786 NVDADGHMINPLSLETHGPVGHNVTLSCNYSGRVHTLQWFRQYPGSRIEFLIFATELNDQSNAALRISNVVDKQKSMSLSIFHAEIQDSATYYCALE
Danio rerio Vs174 ighv CABZ01044329.1 20331 VYSQIVLTQSEQSVSVSPSGSVKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHFYSNSDNGAAQSVQGRFTASKDSSNFYLHMNQLKTEDTAVYYCARE
Danio rerio Vs175 ighv CABZ01044329.1 22535 CWCQTLTESEAVTIKPGESHKLTCTASSFDISGSWMAWIRQKSGKELEWLALIRYDSQDMYYFQSVQGRFTISRDNSKQQVYLQMNSLKDEDTAVYYCARE
Danio rerio Vs172 ighv CABZ01044329.1 17479 CFCIELDQPPFMVVKPGETFTIACKITGYSASDGSTCTNWIRHSAGKPMEWIGYFCSSSSKGVTDSLKNKISLSSESSNNAVILTGRNFITEDTAVYYCARY
Danio rerio Vs173 ighv CABZ01044329.1 19472 YFCIELDQHPAMEVKPEETFTIVCKITGYSASGGGYTNWIRHSAGKPMEWIGYFHTSSNNGVKDSLKNKISFSSESSSNAVILTGKNFNTEDTAVYYCVRN
Danio rerio Vs170 ighv CABZ01044329.1 13986 ELKKTGESFRLVCTASGFTFSSCYAAVVRQAPGKALEWIAYIGTYSSPIYYSQSVQGRFTVSRDDSSSQLYLQMNNLKTEDTAVYYCARAAL
Danio rerio Vs171 ighv CABZ01044329.1 15205 VYSIELNQPAFKLVKPAESFSLGCKITGYSASGGGCTNWIRHSAGKALEWIGWFCRSGDTGTSSTMKNKISFTAETSSNTVFLQGQNFQSEDTAVYYCARK
Danio rerio Vs271 trav CABZ01061539.1 10715 FFSNAIRPLSAEQQVLEGGKVILSCAYNGSNIKSLQWYKQHHSPAPEYLLQTFENAAPEQKDRLLAKAQKDKKQLDLEISKAEMSDSAVYYCALV
Danio rerio Vs270 trav CABZ01061539.1 7746 GIFANSVTPWSTKQQVLEGENVTLSCNYSGSNIQSLQWYRKYPSSTAPEYILQTFESAEPAQQGRHLAKAQKNKKQLDLLISKAEMTDSAMYYCALV
Danio rerio Vs273 trav CABZ01061539.1 14893 EVIGEVITSRGSKKEAQDGTKVTLSCNYTGVVYNLLWYRQYQRFKPELLLSITESGEAVKADPSSHWLSATVHKQSKLTELEISPAKVTDSAVYYCALK
Danio rerio Vs272 trav CABZ01061539.1 12622 IADAYTIESLSAEKQVSVGGNAVISCKYSGIGPSFQWYRQYPGSRPEYLIFNTETGAGSEPTLRLTSMAKKALTQVDLEISSTEVKDSAMYYCALQ
Danio rerio Vs275 trav CABZ01061539.1 16602 HTEADVIKPLSLDENSHVGDAVTLSCSYKDYTGTVNGLQWYRQLPRSKPEFILYIFESGTLSEDKPDRFSAQVNKDTKQVDLNISSAVETDSAMYYCALV
Danio rerio Vs141 trbv CABZ01043006.1 427 LSDCVQFDQPLSKFTEPGKKVVISCSHNDNNLDVMLWYQQLQSGGSLALIGYNYAKADPVYEPGFEKRFSLTRNSTETGSLTVSSPSLSDSAVYFCAAR
Danio rerio Vs277 trav CABZ01061539.1 19631 HTEADVIKPLSLDKNCHVGDAVTLSCSYKDYTGTVQNLQWYRQFPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDTKQVDLNISSAVETDSAMYYCALV
Danio rerio Vs27 trav CABZ01009088.1 55146 AVFGNVIKPINTDVFAEEGSNVTLSCSFTASGVTDYLHWYRQYGRSKPEFLVLTYSSATKAAQSDIDTRFTTNITKKEHVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs26 trav CABZ01009088.1 53178 CRSEEKVDQPDKHMTEVEGKSVTLRCTFTTTSNQPDLFWYIQKANDHPKYILRRDKYGAGENGTEFQERFHSELLTDSVPLLIRDLHVSDSAVYYCALR
Danio rerio Vs25 trav CABZ01009088.1 50950 FRSEDRVDQPEKEITVAEGGSVTLQCKYESYSVQKDIFWYVQRTNDFPKYILRRSNFGGENGTEFQERFHSELSLDSVPLLIRDLRVSDSAVYYCALR
Danio rerio Vs24 trav CABZ01009088.1 40481 IESQDNVEQKARVQTAVEGEAVEIDCTYQTQLTPTLFWYQQKTNTIPKYMLNRVGKTGGEDKEFKERFTANLNTFSKSVPLMIRDLHVSDSAVYYCALQ
Danio rerio Vs22 trav CABZ01009088.1 33645 CKAQDNVLQPKQVMTAYEDGTITLECTYKASSTQYPNLLWYQQMTNGSPKYMLMRLSGSSDTNEEFKQRFNAELNTSALSIPLTIKDLRASDSAVYYCALK
Danio rerio Vs28 trav CABZ01009088.1 57557 CRSEDRVDQPDKQLTEAEGGSVTLQCKYKTDSTQEDLFWYIQRTNDLPKYILRRSKYGGENGTEFQERFHSELSTNSVPLTIRDLHVSDSAVYYCALR
Danio rerio Vs284 trav CABZ01061540.1 5056 DSNGDIIRPEQTSVVVTDGSSITLSCTYDESAYSLHWYRQTPGSRPEFLLLIDESSKYVTKAEQPHPHMSIQLQNNKRVNLILSFAAVSDSAVYYCALQ
Danio rerio Vs285 trav CABZ01061540.1 8092 DAGEEVISSLSTEQIVLAGKNATLSCKYNGNVYNLQWYRQYPGSKPENIIFHTESKNQSDFKLRLLAVGEKGMKRMNLSIFHTEMQDSALYYCALQ
Danio rerio Vs286 trav CABZ01061540.1 10364 NAGEEVIRPLFKEKHVLEGDVVTLICSYSGSVQNLQWYHQFPGSKPENIFLYFENKPQTEGRMTAASDKAVKHMNLTITSTQLTDSAVYFCALV
Danio rerio Vs287 trav CABZ01061540.1 12924 NAGKEVISSLSTEQIVLAGKNATLSCKYNSNIRNLQWYRQYPGSKPENIIFHTESNNQSYSRLRLLAVAEKEIKRMNLSIFHTEMQDSALYYCALE
Danio rerio Vs280 trav CABZ01061539.1 25402 DSLGDIITSRGSEKAAQDGTNVTLSCNYTGAVYNLLWYRQYQRFKPELLLSITESGEAVKADPSAHWLSATVHKQSKLTELEISPAKVTDSAVYYCALK
Danio rerio Vs281 trav CABZ01061539.1 28122 DSNGNVIRPEKTSVVLTEGSNITLSCTFNITPYSLHWYRQMPGSRPEFLLLIVRSTKTKVAASPPQPHMSINLSEKRVDLEISSAAVSDSAVYYCALE
Danio rerio Vs282 trav CABZ01061539.1 28779 NSGEEVISTLPTNQYIIEEKNATLSCNYSGYVQNLQWYRQYPGSKPENIIFYTESNNQSDSKLRLLAVADKGQKLMNLSMYFTKVEDSALYYCALQ
Danio rerio Vs283 trav CABZ01061540.1 3577 TAGEEVISSLSTEQIVLAGKNATLSCKYNGNVYSLQWYRQYPGSKPENIIYHTESNKQSHSRLRLLAVTEKGMKRMNLSIFHTEMQDSALYYCALQ
Danio rerio Vs288 trav CABZ01061540.1 14134 VVNGNVITPARTSVVLTEGSNITLSCTFNTSPYRLLWYRQTPGSRPEFLLLIVRSTKTTIEASPPQPHMSINLSEKLVDLEISSVAVSDSAVYYCALE
Danio rerio Vs289 trav CABZ01061540.1 16536 ETTGDKIKPDNDTAQLMENSNITLSCTYEGSIDSLYWFQQKIGSRLEFLIMIDEASEYVTNAIPPHPRLSVQLHKAQKRVSLEMSSAAVTDSALYFCALR
Danio rerio Vs445 trav CABZ01048627.1 16416 SVLGNDIKPNITDVVYEEGSDGTIFCSHSPGAGDYIYWYRQYGGSKPEFLVLIFGSTKDTETSKVDPRFSVTVEKKERNHADLLLSSAAVSDSAVYYCALQ
Danio rerio Vs442 trav CABZ01048626.1 4454 NLFGDTIEPLFPDRHGSEGENVTFSCNYSLTSGTSVNLLWYRQYSGAKPEYLLSVTEYSNSSESDLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs443 trav CABZ01048626.1 2978 ASSEDTITADKTEEFADDGSNVTLSCTFSSAWSLLWYRQYPGSAPEFLVNIAERSKKVERSNTDHRFTTKIRIEKEKHVDLLLSPAAVSDSAVYYCALTSM
Danio rerio Vs143 trbv CABZ01043007.1 8463 GFSDGVLITQWPKYISNRLGSSVKMHCYQNDTDYEYKYWYRHIKGEGPVLIGSFNFNSDSNEKGFESGYKLSGTGKKEWTLEVDVKEGTDAVYLCAAS
Danio rerio Vs142 trbv CABZ01043007.1 5045 GFSDGVLITQWPKYISSLPGFSVDMHCYQNDTDYDYKYWYRQIKGEGPVLIATLIGTSESFEKGFETGFQLPDKETKKWTLKVDVKERADAVYLCAAS
Danio rerio Vs98 iglv CABZ01038528.1 28312 VRCAKVLTQKPSIMTEDKGRSVTLDCNIEKDYSYVSWYKQTLNAAPQFVLRYYHSLSSPDLYGDGFTSSRFTSKAQSKIDYSLIISNVAVSDSAVYYCKTWD
Danio rerio Vs261 trav CABZ01061538.1 35333 ECFAQNITPLQSTTQVTEGKTVTLSCKYDVSVQSLLWYRQYPGSGLEFLLLVIESPTKTVIHAKPPIPRVDGEMSMSDKRVNLEISSAEVTDSALYYCALV
Danio rerio Vs147 trbv CABZ01043008.1 2124 GFSDAVLITQWPKYISNRLGSSVKMHCYQNDTDYDYKYWYRHIKGEGPVLIGSYVVNSDSNEKGFESGYKLSGTGKKEWTLEVDVKEGTDAVYLCAAS
Danio rerio Vs144 trbv CABZ01043007.1 9491 YARCADVQQNPSKLANKNDRAEISCKYSDSGKPNMLWYQQKDSAMALIVLSYGATGDPMYEDGFKGRFELERKVTFNGTLKINNLSLSDSAVYYCAVS
Danio rerio Vs262 trav CABZ01061538.1 37483 DAFGEGIAPVSGYKTVPEEKTTTLSCIYNGSAATDALQWYRQYPRSRPDFLFLVNEAAFKQPANPPIPGISARLNEEKNCVYLDITSTAISDSAVYYCALQ
Danio rerio Vs263 trav CABZ01061538.1 40292 QSFGQSITALQTTKQAVESETVILSCKYDTQADSLHWYRQYPGSTPEYLLLVYESNTVFHAEPPFPRLNASVNKVEKQVNLTISSAAVTDSALYYCALQ
Danio rerio Vs260 trav CABZ01061538.1 33003 IIQTNMITSHDPQKQAFEGEYVKLACNYSGAPDNLHWYRQYPGSTPMFLLYIYESGLKSDNIPERLTPKINKTKKVVDLEISSATVSDSAVYYCALK
Danio rerio Vs148 trbv CABZ01043008.1 3197 KVNCVLVQQNVALFANKSDSAEIKCSHNDSSMLNMLWYQQKDTAAMALIGYKYASGDPSYETAFEGRFELEKTDTHNGTLKISELSQSDSAVYYCAVS
Danio rerio Vs266 trav CABZ01061538.1 47371 QSFGQSITALQSTKQAAESETVSLSCKYDTQANNLQWYRQYPGSTPEYLLLVYESNTVFHAEPPFPRLDASVNKVEKQVNLTISSAAVTDSAVYYCALQ
Danio rerio Vs267 trav CABZ01061539.1 136 TLAQSIRPLQSDVHITEKTPVRLSCKYDGSANSLHWYRQHLGSKPEFLLLVMESVIRHVTYADPKIPGMDGEMSMSEKQVDLEIFSATISDSAVYYCALQ
Danio rerio Vs264 trav CABZ01061538.1 40986 TLAQSIRPLQSDVYITERTPVKLSCKYDGSVYSLHWYRQYSGAKPEFLLLVTESTSKIVTYADPKIPGMDGEMRMSEKQVDLEISSAAVSDSAVYYCALQ
Danio rerio Vs265 trav CABZ01061538.1 44024 TLAQSIRPLQGDVHITERTPVRLSCKYDGSAYSLHWYRQYPGAKPEFLLLVRESAKKSVTYADPKIPGMDGEMSMSEKQVDLEIFSAAVSDSAVYYCALE
Danio rerio Vs12 igkv CABZ01007639.1 88147 CIGQVTVTQTPSVLLSEPGQSLTVHCRFSRDPPCCYGSGTYLVSWYLQRPGEAPKLLIYYTTVLQSGTASRFSGSGSKTDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs13 igkv CABZ01007640.1 1745 CGGQISVTQSPSITAEPDKPVSITCRTSRDVQRWNDGDEGLFWYLQKHGEAPKLLIRYVKKLQSGTASRFSGSGSNRDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs16 igkv CABZ01007641.1 2034 CAAQITVTQSPVEPVKPGENVQMNCKLSQPAPCSPDSCVSWYLQKPGEAPKLLIYYTSSRYSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQT
Danio rerio Vs17 igkv CABZ01007641.1 3941 CGGQISVTQSPSITAEPDKPVTITCRTSTNVYSDSTYGPRLAWYLQKPGEAPKLLIHLTNRLQSGTASRFSGSGSNRDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs14 igkv CABZ01007640.1 3176 CAAQITVTQSPVEPVKPGENVEMRCKLNQYSNCSPYPCLYWYLQKPGEAPKLLIYYVNRLQSGTASRFSGSGSHVDFTLSISGVQTEDAGHYYCMS
Danio rerio Vs18 igkv CABZ01007641.1 5593 CAAQITVTQSPVEPVKPGENVQMSCKLSEPSNCSPNPCVSWYLQKPGEAPKLLIYKTDIRESGTASRFSGSGYDTDFTLSISGVQTEDAEHYYCQS
Danio rerio Vs370 igkv CABZ01030504.1 28972 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSSLTKYLAWYQKRPGQTHKLLFYYLGNRVSGVSDRFTNEKSGTNYMLKIRDVQPEDAGDYYCQQYYDLPR
Danio rerio Vs371 igkv CABZ01030504.1 26133 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSAFQSSLAWYQKRPGQTHKLLFSSLGNKRSGVSDRFTDERSGTNFMLKIRDVQPEDAGDYYCQQHYEWPR
Danio rerio Vs372 igkv CABZ01030504.1 23210 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSAVITALAWYQKRPGQTHKLLFYYLGNRVSGVSDRFTNEKSGTNFMLKIRNVQPEDAGDYYCQQYYEYPR
Danio rerio Vs373 igkv CABZ01030504.1 17772 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSVSHNLIWYQKRPGQTHKTLFYYLGNRVSGVSDRFTDEKSGTNYMLKIRDVQPEDAGDYYCQQYYD
Danio rerio Vs374 igkv CABZ01030504.1 14981 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSTAVTNGLVWYQKRPGQTHKLLFYYLNSRVSGVSERFTDEKSGTNFMLKIRNVQPEDAGDYYCQQYAQLPR
Danio rerio Vs316 igkv CABZ01089165.1 15541 SWGQVTVTQSPAVRSITQGETLTISCKTTPLVSGCSSCVSWYQQKPGETPKLLIYRINNRYSNTPSRFSGGGSSYGSDFTLSISGVQTEDAGDYYCLS
Danio rerio Vs317 igkv CABZ01089165.1 17975 SSGVTLTQPEVKTVQEGETATIECHIDVGIYSSYLHWYQQKPGEAPKLLIYYINNRYSNTPSRFSGGGSGSDFTLSISEVQTEDAGDYYCQS
Danio rerio Vs158 ighv CABZ01044328.1 2699 VDSLELTQPESLTVRPDDSLTINCRVSYSVTSEHTAWIRQPAGKALEWIGVIYHNGGLAYKDSLKSKFSISRDTSSNTITLQGKNMKAEDTAVYYCARH
Danio rerio Vs159 ighv CABZ01044328.1 8467 TKCQTFTQSEAVVKKPGESHSLTCSIAGFTFSSLYLHWIRQSPGKALEWIAYISTQSSPIYYSQSVQGRFTVSRDDSSSQLYLQMNNLKTEDTAVYYCAKE
Danio rerio Vs177 ighv CABZ01044329.1 29803 VRGQSLTSSDSVVKRPGESVTLSCTVSGISMSSYWMHWIRQKPGKGLEWIGYIDTGTTAYYAQSLQGQFTITKDTSKNMLYLEVKSLKSEDTAVYYCAR
Danio rerio Vs155 ighv CABZ01044327.1 9771 VVRGQNMESISSESVLKPGETLSLSCRGSGFTFGSNNMHWIRQQPGKALMWMGRVWYNAQGHDYANSFKGRIEITRDNSKSMVYLKLSALTEEDSAVYYCARE
Danio rerio Vs239 trav CABZ01061535.1 61712 GCHSDDTVDQPLKHVTALEGISVTLDCKYTTSSTSQELFWYIQRADGSLKLQRNSYGGGVNGTEFKERFYSEVKTSKSVPLLIQDTCVCDSAVYYCALR
Danio rerio Vs157 ighv CABZ01044328.1 1539 INGQGMESIESSVQKKPGETLTLSCRGSGFTFSSYHMHWIRQQAGKPLMWIGRVYSDGSGNDYAESFKGRAEITRDNSKSMTYLKLSGLTTEDSAVYYCARQ
Danio rerio Vs150 trbv CABZ01043010.1 3910 HTSADTVLQSRRFMAVLPGNNVTLDCSMAAGVSMSSYTMYWYKQVHSGQPIELVIKEYEQAVKNYEATLNNNMFRLIISSLTAQDSGTYFCAA
Danio rerio Vs237 trav CABZ01061535.1 50287 CGEQDSVDQPDRELTSAEGNEVILLCNYKLMSAANAYLYWYKQLPDTSPAFILSEFSIGKGKAEPEFKDRFSAKLDSKLETVPLTIKDVRVSDSAVYYCALQ
Danio rerio Vs318 igkv CABZ01089166.1 3096 QVTVIQTPAEHHVQHTHTVTLSCKTSSSIGRRSDGDCKSCVAWYLQKPGETPKPLVYNIRTLRAGTPSRFSGNGADHGTDFTLSISGVQTEDAGDYYCQS
Danio rerio Vs319 igkv CABZ01089166.1 5088 SSGQITVTQTPAVQTAGAGQTVEFRCSASSPLTGCSPPCLSWYFQRPGEAPKLLISLINRLQSGTQSRFSGGGSDSDFTLSISGVQTEDAGDYYCQS
Danio rerio Vs491 trgv CABZ01071764.1 17717 AVLGVTLNQGQKALSKAAGKTLYLPCKVAGLQSWNYIHWYQMRDGEAPSRLLYINEGGAVTYDTNNPQANDFTVDRRKLYDLKLGDAQQKHTAVYFCAYW
Danio rerio Vs490 trgv CABZ01071764.1 23097 KLDQGSKALVKAAGKTVYLPCKVTGLESSNYVHWYQVKDGKAPSRLLYISIDGAVVRDDKNPQTNDFTVDKTRLYDLKLSDTQSKHAAVYFCASWEYDSRT
Danio rerio Vs493 trgv CABZ01071764.1 6627 EGQVTLRQKISSTKSQDKTVVIDCDYPSDCRSYIHWYQLKGQTLKRILYAQISGGEPAKDAGFELFKIDRKQSNIALKIPELKTEHSAVYYCACWVSG
Danio rerio Vs492 trgv CABZ01071764.1 10524 VEGLSLIQSQKVFVKLTGKTVSFKCEVFGLGSTNFVHWYHKKDGETLKRLLYISYTGTATGEAADYVSEKNGNSYGIKLKEIKEEHAGMYYCAAWDG
Danio rerio Vs494 trgv CABZ01071764.1 4231 DGQAMLRQKISSTKSQDKTVVIDCDYPSDCYRYIHWYQLKGQTLKRILYAQISGGEPARDAGFELFKIDRKQSNIALKIPELKTEHSAVYYCACWDRSA
Danio rerio Vs447 trav CABZ01048627.1 5104 CDSQDKVDQHTKTQSAFEGDTVTTDCTYQTSSTGPTLFWYQQKVSGVPKHMLNKFSTTGNSEEELKKKRFHATLSKTSVPLTIQNLRVQDSAVYYCALK
Danio rerio Vs419 trav CABZ01048624.1 17050 CDCAESVDQNTRVVTFVEEGSVTINCTYQTSDPSPYLFWYQQKPNTIPKHMMTIITTTVQNDKDFEEERFGAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio Vs411 igkv CABZ01047226.1 2202 SHQEVQSPECLSIQAGESASISCSGTSGVGNDMSWYLQKPGKAPKLLIYGISHLEPGVSDRFIGSGSEPDFTLNIRAVQPEDAGVYYCMGYYGDDT
Danio rerio Vs413 igkv CABZ01047231.1 935 SHQEVQSPESLSVKAGDSASISCTGTSGVGYDMSWYLQKPGKAPKLLIYGVSYLESGVSDRFSGNGSEPAFTLNIRGVQPEDAGVYYCMGYYGGGR
Danio rerio Vs412 igkv CABZ01047227.1 2310 SVGQILTQSENQTVLPDQTVTIHCNHKPALNCWSLKNTSQYCMSWYHHFPGKTHKLLIYYTSNRASGVSSRYSGSENADHTVFTLTISGVQPKDSGVYYCQSQ
Danio rerio Vs128 trbv CABZ01042996.1 12799 FSHCNKVDQSPPDLIHEQGETAKIRCQHSVSSYNQINWYRQNQDGGFTLMGYLLGTEPYRENDFKDKIDMPGDGNRDGNLTIKVISSNDNAVYFCAAY
Danio rerio Vs121 trbv CABZ01042995.1 8402 ASNSQDIGQTPADVMNVTGQSEELHCSHSSSSYNVMLWYKQTRGESLELLGFLVGSEATVEDKFKDKVILKGNAYKNSVIKLEELSSDDSGVYFCAAS
Danio rerio Vs120 trbv CABZ01042995.1 4752 FADVNDITQSPNTMIPFKKNATLSCSHKKGDTYDRMYWFRQHNGQTMELIVYTTSYGTVEFGKLDKTKYSVNHESAVRGFLTVISLESLDSALYLCAVS
Danio rerio Vs127 trbv CABZ01042996.1 9622 ISHSNKVNQSPPGLIQKQGDDAKIRCQHSAGSSYNQINWYRQKQDGGLIFMGYLVGTEKTPEPDFSEKIDMSGNGRSDGTLTIKSLLSTDSAMYFCAAY
Danio rerio Vs126 trbv CABZ01042996.1 6819 FSQSNKVNQSPPDLIYNQGDDAKIRCQHSVGGNYNQINWYRQNQDLSFTFMGYLLLQGPNPEKEFSKKIDMSGNGQSDGYLTIKSLLYNDSAVYFCAAY
Danio rerio Vs178 ighv CABZ01044329.1 34219 ISGDEIRLDQSPSVTKRPGETVKISCKISGFTMTRYYMHWIRQKPGKALEWIGRVNSGSGSADYADSMKNQFTLSEDVSQNMQYLEAKSLREEDTAVYYCARE
Danio rerio Vs489 trgv CABZ01071764.1 26490 AVLGVDVDQGPKTLVKAAGKTVYLPCKATGLEYIHWYQVKDDEAPSRLLYISRDGVVTRDNNAQTHDFTVDKTRLYNLKLGDAQQKHAAVYFCAYWDSS
Danio rerio Vs257 trav CABZ01061538.1 28162 TSRQDSITPTSPAVHVKEKEAARISCEYKYTVSMNNLQWYRQYPNAKPEFLVLIMESGQNQTATPPHPRLTTSVNKDKKLVNLEIFPADVKDSAVYYCALQ
Danio rerio Vs256 trav CABZ01061538.1 26091 ECRCEDAVRQPTASVSAFTEETITLSCEYYTTDSMPALLWYRQTKNFPPQYILVRHNLGNGSNSKDFPNNRYQSRLDSAMGQVTLTVRNLLLSDSSVYFCALR
Danio rerio Vs255 trav CABZ01061538.1 23487 GKSDSPITSDQTEVFPRENANVTLSCSYSSAISLHWYRHLPRSAPEFLLLVLQTTGRVQTAQNLDSRFEAMLNEKKNKVHLIISSVKVTDSALYYCAME
Danio rerio Vs253 trav CABZ01061538.1 21246 ITFCAHIAPNTKFVIGREGESATLSCLYESSSSHVLLFWGRILPKQAPEFLLLKGARSETQFQSVDPRYDSATSKTATFLIINNLTLEDKASYYCVLE
Danio rerio Vs252 trav CABZ01061538.1 12552 FVIGNLAKDVITPYSDEIFASETESVKFSCNYTGSVDGLHWYRQYPDSPPHFLILDYYGSITHANPPIAGISIKHRKDNSSVDLEISSVAVSDSAVYYCALQ
Danio rerio Vs251 trav CABZ01061538.1 5369 NRAKDAITPYRDAVFASESERVKLSCNYTGSVDSLHWYRQYPGSRPHFLILDYSGFVTHANPPFDGISIKHRKENSSVDLLISSAAVSDSAVYYCALR
Danio rerio Vs250 trav CABZ01061537.1 411 VFADSIAPKKEGRNKTRKEGESVTLSCTFNRSDTAISLYWYMQYPNRELQYLLYKGHRSSEEGIVTDSRYKSTVSPTSTSLTINSVNLSDSALYYCALKKG
Danio rerio Vs400 trbv CABZ01043016.1 17627 AKDVTQTPVLWAPMGVNATMNCNHSYPSTYFYMYWFRQRQGETMKLIAFTMLNNKPDFGEFSEDKYSATKTEAQRGSFTVKKLQADDSGVYLCAVS
Danio rerio Vs259 trav CABZ01061538.1 30657 RFLGVSCGDVITPAQTEVYGKSGNKVTLSCNYSTALSLYWYRQYPGSNPHCLLLILTKSETSENMQPGMSVRLHKEKASMDLKISSAKLTDSAVYYCALK
Danio rerio Vs235 trav CABZ01061535.1 45768 CRAQDRVEQPTRKKTENEGDQITLMCNYTTTSTNADVYLFWYKQLPDRSPTFILNKFPFSEGTIEPEFNKRFSAKLNSTLRTVPLLIQDLRVSDSAVYYCALR
Danio rerio Vs234 trav CABZ01061535.1 39859 CKCKDSVHQKRVETAVEGTDLFISCSYTSTDPIPTLFWYQQKVNEFPKYMLSTFESKDDEFKKRFNARLNTSSTSAPLLIQDLRVSDSAVYYCALK
Danio rerio Vs138 trbv CABZ01043003.1 9570 CSLVIQQSPEHLLRSVKETEANLSCFHGDGSYTYLYWYQQKSSGGSVELIGRLNYEAPFLEDEFKSRFIISGHATKNAFLLISSLSAEDSAVYFCAASL
Danio rerio Vs139 trbv CABZ01043005.1 3471 CVVCSPVIQQSPEHLLRSVEEKQANLSCYHGDNDYPYLYWYQQKSSGGSMELIGMLNYGSATVEDKFKTRFIISGHAKEDAFLVISSMSAEDGAVYFCAAS
Danio rerio Vs231 trav CABZ01061535.1 22248 ATYGDEIKPVKTEKFADKGSSVKLSCTYSSANTLFWYRQYPGSAPQYLVLIPEGTKDDWKSDVDKRFTARITKDKEKHVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs230 trav CABZ01061535.1 18123 CRGQDRVEQPLRSISANERGQVIISCSYSTTDINIYLFWYKQLPNRSPTFILNKQTYGEGITAADFKERFSATLNSTAKSVPLMIRDLRVSDSAVYYCALR
Danio rerio Vs233 trav CABZ01061535.1 35945 CRGSSDNVEQPSGQITANEADSVHLQCSYSTTFTNAYLFWYKQLPNRSPTFILSEFTIGEGTTEDEFKGRFSATLNSTLKSVPLLIQDLRASDSAVYYCALR
Danio rerio Vs232 trav CABZ01061535.1 29890 CRGQNRVEQPSREMTADKGDTVTLPCNYSVTTTNAYLFWYKQLPNRSPTFMLSAFTVGKGTTEDEFKERFNATLDKTLRTVPLLIQDLQVSDSAVYYCALQ
Danio rerio Vs130 trbv CABZ01043000.1 3302 CSLFSSVEQTPALLIVRSGESCNISCSHGITSYNTILWYYQHEDGQGMHSIGYSFHSSHTLENVEDKRYELNGDGKSSVTLIISKLLLNDSAVYFCAAS
Danio rerio Vs136 trbv CABZ01043003.1 3904 CLVCSLVIQQSPKELLTVEVKDTNLSCHHGESSYPYMLWYQQKSNGGSLELIGLLTFGSFSPEDKFKSRFSTFGDSTKEAFLLISKVSAEDSAVYFCAAS
Danio rerio Vs137 trbv CABZ01043003.1 7320 CVVCSPVIQQSPEHLLRSVEEKQANFSCYHGDNNYQLLYWYQQKSSGGSVELIGMLNYGSATVEDKFKSRFIISGHATKDAFLLISSLSAEDSAVYFCAAS
Danio rerio Vs134 trbv CABZ01043002.1 9013 NSSIIQTPSDLLANNTESVSLHCSHSSSAFNVILWYKQLLNGEMQLMGHLYRTNNNTETLFTDKIELLGNGASSSSLKLKTLSSKDNAIYYCAAR
Danio rerio Vs135 trbv CABZ01043003.1 3269 LSMAVNVIQTPTELFLDTGATLNITCSHNDRSLDKIFWYQQFNGRNLELIGFLSFKQRLVDKKEFTITGDAEKEATLVLSSVKAEHSAVYFCAVSA
Danio rerio Vs437 trav CABZ01048625.1 6406 RVSLDKVEQNSRVKTAVEGEDVIINCQYETTDTSPYLFWYQQKVNSVPEYMLNRFSSDEEQFKGRFSSELNTSSKSFPLKIQDVRVSDSAVYYCALR
Danio rerio Vs436 trav CABZ01048625.1 42313 CRGQDKVQQPSGEMTENEGDQVSLMCNYTTTASDGNIFLFWYKQLSNRSPTFILNKIPFSEGTIEPEFNKRFTAKLNSTLRTVPLLIQDLRVSDSAVYYCALK
Danio rerio Vs435 trav CABZ01048625.1 43522 ISIADEIHPLSTDKHVAEGQNVTLSCNYSTSTGTVNSLQWYRQYPGAKPEFLLSLNEYSNSSKPDLRLVSNAVKALKRVDLLLSSAAVSDSAVYYCALQ
Danio rerio Vs434 trav CABZ01048625.1 49783 TAIADEIQPLSSDKRVAKGENVTLSCNYSTTVTVDSLQWYRQYSGAKPEFLLSLNEYSNSSKLDLRLVSNAVKALKRVDLLLSSAAVSDSAVYYCALQ
Danio rerio Vs433 trav CABZ01048625.1 67141 CRGQDRVEQPLRDITANEGDQVIIPCNYSTTDTNPYLFWYKQLPNRSPTFILNKLTYGEGTVEADFKDRFSATLNSTAKSVPLMIKDAQLSDSAVYYCALR
Danio rerio Vs432 trav CABZ01048625.1 74380 CRGQDRVEQPSIEMTESEVEEVIIRCNYSTLSTSPDLFWYKQLPNRSPTYILNQYSTEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALK
Danio rerio Vs431 trav CABZ01048625.1 77076 ATYADEIKPVKTEVFADEGSNVTLSCTYSSANNLQWYRQYPGSAPQYLVLIPDSSKEDWKSNVDDRFTARVTKNKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio Vs430 trav CABZ01048625.1 78121 CRGQDRVEQVEGEMSDSEGNHVIISCNYSTSQTAYLFWYKQLPNRSPTFILSQYSAEADFTKRFSATLDSKEKSFPLTIKNLQVSDSAVYYCALR
Danio rerio Vs439 trav CABZ01048625.1 3559 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSSTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKKRFNATLSKTSVPLTIKDLRVSDSAVYYCALR
Danio rerio Vs438 trav CABZ01048625.1 4524 TSSADEIHPLFLDKQVAEGQNVTLSCNYSISIGILRSLQWYRQYSGAKPEFLLMLNEYYNKSKLDLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALQ
Danio rerio Vs240 trav CABZ01061535.1 64827 CDCAESVDQNTRVETAVEGGSVTINCTYQTSDPSPYLFWYQQKPNTIPKYMMMIFATTVQNDKDFEEERFSAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio Vs241 trav CABZ01061535.1 68606 CRAQDSVTQTATVQTATEGQAVTIECTYKTNAFPTLYWYQYKANQFPKYMLKRYAGSSDEDDNFKDRFNANLNSSSTSVPLTITDVRVSDSAVYYCALQ
Danio rerio Vs242 trav CABZ01061535.1 71268 VSSAEEIIFPNNKTVIAKADEKVLLSCSYTGTVYDLYWYRQSPGSAPQFLIMESSGVIIHATPQVPGIKIINKKNTKHVELEIFSASVEHSAVYYCAAR
Danio rerio Vs243 trav CABZ01061535.1 72833 SRAQDSVYQPKTLQSANEEDAAVTLDCKYSTSSSNPTLLWYRQDDYGSPKYILLRYKFGDGDEATEFKGRFGSRLDSASKSVPLTIQHPHASDSAVYFCALL
Danio rerio Vs244 trav CABZ01061535.1 76748 VTFGNDITPVQTEVFGAEMDNITVSCKYSSAVSLQWYRQYPGSAPDFLLTIHRTGSVSRSSTIVNEDPWYYGKLNKEKTHVFLEISTAKVSDSAVYYCALQ
Danio rerio Vs245 trav CABZ01061535.1 83201 SRALEAIDPKTDREFAVEGDNVTLSCNYSGSVRGVHWYRQYAASPPQFLILEDSGVTTPANPPVPGISINHRKAEKHVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs246 trav CABZ01061535.1 84765 VSFGNVITSVETRLIHTEGDVISVSCSYSSARTLFWYFQNPGSVPQFLFIILHSNGEVLQKSEAVKDPRFSAKVNEKKTHVFLEISSAKVTDSAIYYCALE
Danio rerio Vs247 trav CABZ01061535.1 85984 SSATEAITPYRAYEFAFKDDRVILSCNYTGSARGLHWYRQYPGLPPHFLILDYYGAVTHAKPPIAGISIKHRKDDSSVDLEISSAAVSDSALYYCALE
Danio rerio Vs248 trav CABZ01061535.1 92059 VSFGNVITSVETRLLHSEGDVISVSCSYSSARTLFWYRQNPGTVPQFLFVILESNGDVLQKSEAVKDPRFSAKVNEKKTHVFLEISSAKVTDSAIYYCALE
Danio rerio Vs249 trav CABZ01061536.1 1392 SRASEVITPKTDREFAVEGDNVTLSCNYSGSVRSVHWYRKYSGSPPQFLILEYSGVITPADPPVPGISINHRKKQSHVDLLLSSAAVSDSAVYYCALQ
Danio rerio Vs226 trav CABZ01061535.1 4857 ETFAQSITPLENKTLKSEGETVTLSCKYEGVVNNLHWYRQYPGFRPEFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio Vs227 trav CABZ01061535.1 11838 RVSLDKVEQNSRVETVVEDEDVIINCQYETTDTLPYLFWYQQKVNRFPEYMLNRFSSDEEQFKDRFSSELNTSSKSFPLKIQDVRVSDSAVYYCALR
Danio rerio Vs225 trav CABZ01061535.1 3049 CDSQDKVDQDTKTQSAFEGDTVTIDCTYQTSTNPTLFWYQQKVKGVPKHMLNKITNTTGHIEEEFNERFHATLSKTSVPLTIKDLRVSDSAMYYCALR
Danio rerio Vs274 trav CABZ01061539.1 15613 NANENSIRPDEEFVSLNEGSNTTLSCTFDGSAYRLHWYRQKTGSLLEFLVLIDKSTKVVVTASPPHPHVSINLHDNRVDLEITPAAVSDSAVYYCALQ
Danio rerio Vs169 ighv CABZ01044329.1 13125 GVYCVELTQPSSMVVKPQESFSISCRISESSYCINWIRQSAGRPLEWLGYLCSGGSTNIKDSVENKISFTQDTSKNTVFLQGRNFQTEDTAVYYCARQ
Danio rerio Vs228 trav CABZ01061535.1 14470 ETFAQSITPLENKTLKSEGETVTLSCKYEGVVNNLHWYRQYPGFRPKFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio Vs229 trav CABZ01061535.1 17057 VIFGDEISPDSSEVFAAVASKVTLSCRYSSAYNLQWYRHYPGSAPQNLVLISEGLTETKISEVDSRFTTKLRKENQAGKEIKRVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs269 trav CABZ01061539.1 5627 TLAQSIRPLQSDVYITERTPVKLSCKYDGSVYSLHWYPQYPGAKPEFLLLVLKSATKSVTYADPKIPGMDGEMSISEQQVDLEISSAAVSDSAVYYCALQ
Danio rerio Vs420 trav CABZ01048624.1 14910 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTTPTLFWYQQKVNGVPKHMLNKISTSGHTEEEFKERFHATLSKTSVPLTIKDLRVSDSAVYYCALR
Danio rerio Vs421 trav CABZ01048624.1 12489 CDCAESVDQNTRVETSVEEGSVSISCTYQTSDPSPNLFWYQQKPNTIPKHMMTIITTTVQNDKDFEEERFGAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio Vs422 trav CABZ01048624.1 10295 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKERFHATLSKTSVPLTIQDVRVSDSAVYYCALR
Danio rerio Vs423 trav CABZ01048624.1 6105 AVFGNVIKPINTDVFTEERSNVTLSCSFTASGGSDYLHWYRQYGGSKPEFLVLIYGSATKAAQSDIDTRFTANITKKEHVDLLLSSAAVSDSAVYYCALQ
Danio rerio Vs424 trav CABZ01048624.1 5275 CRSEDRVDQPDKQLTEAEGGSVTLQCKYKTDSVQENLFWYIQRTNDLPKYILRRSKYGGENGTEFQERFHSELSTNSVPLTIRDLHVSDSAVYYCALK
Danio rerio Vs425 trav CABZ01048624.1 4099 SVYGNVIIPDETEAVHAKGSDVKLSCSFLASGYTDYVYWYRQYRRSKPEYLVQIISNSNKAQQSLVDPRFTAYIENRDKIHVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs426 trav CABZ01048625.1 88183 ASNGDTITPDKTEEFADEDSNLTLSCSYSSAWNLLWYRQYPGSALEYLVLTVDTVNEARTSDVDVRFATKTRKENANHVDLEISSAAVSDSAVYYCALK
Danio rerio Vs427 trav CABZ01048625.1 85194 AIYADEIKPVKSEEFADGGSNVTLSCTYSSAYYLYWYRQYPGSAPQHIVLIPESRKDDTKSDVDHRFIARVTKDKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio Vs428 trav CABZ01048625.1 84151 CRGQDKVEQPIREITEGEGAHVFVQCNYTSSNPTLFWYKQLPNRSPTLILSQYSAEADKKRFSATLNSKEKSFPLLIQDLQVSDSAVYYCALE
Danio rerio Vs429 trav CABZ01048625.1 80911 CRGQDRVEQAEGEMTESERNHVIISCNYITTSTTVYLFWYKQLPNRSPTYILSQYSAEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALR
Danio rerio Vs183 ighv CABZ01044329.1 50742 VYSQIVLTQSDQSVSVSPRGSVKLTCACSGFTLSSFRMFWIHQTPGKGLELILNYLSDSDKSSAQSVQGRFTASKDSSNFYLHMNQLKTEDTGVYYCAT
Danio rerio Vs500 igkv CABZ01078634.1 7295 CRGQVTVTQTPLITAQPGQDVRISCKASRPVHLNDHVAWYLSKPGEAIKILIYRAKHRFTGVPSKVTGSGHGADFTLTISGVQPKDAGLYICQS
Danio rerio Vs507 igkv CABZ01089166.1 7828 CRGQITVTQSPSVTAQAGQAVSITCKTSTRVYAGDRLAWYQQKPGETPKLLIYYISRRYSNTPSRFSGGGSDYGSDFTLSISGVQIEDAGDYYCQS
Danio rerio Vs506 igkv CABZ01089166.1 10074 SWGQVTVTQSPAVKSITQGETLTISCKTTPLTSDCSDCVSWYQQKPGEAPKLLIYYINRRYSNTPSRFSGGGSSYGSDFTLSISGVQTEDAGDYYCQS
Danio rerio Vs509 igkv CABZ01089167.1 1245 SWGQVTVTQSPAVKSITQGETLTISCKTSQPISGCNDCVSWYQQKPGEAPKLLIYYISSRYSNTSSRFSGGGSDYGSDFTLSISGVQIEDAGDYYCLS
Danio rerio Vs508 igkv CABZ01089167.1 4403 SSGVTLTQPESKTVQQGETATIECRMDVALTSNDLAWYQQKPGEAPKLLIYYISSPYSNTPSRFSGGGAYYGSDFTLSISGVQTEDAGDYYCQS
Danio rerio Vs236 trav CABZ01061535.1 46414 MSFSDEIHPLSSDKHVAEGQNVTLCCNYRASTGNVDSLLWYRQYPGANPEYLLLLNEYSNSTKSYLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALR
Danio rerio Vs164 ighv CABZ01044328.1 18751 VNGQSLESIPSSSVTKKPGETLNLSCKGSGFDFGQYGMQWIRQPAGKALDWIGVIWSDGSKTVYAKSVEGRIEITRDNSNNMVYLKLSGLKTEDSAVYYCAR
Danio rerio Vs200 igkv CABZ01050232.1 22203 SRGITVTQPELLTVPEGQNARIECKTDPGIDDWGLAWYQQKHGEAPKLIITGVNDLHDRSFSRFSGNGRSGGKDFTLSISAVQTKDAGHYYCQS
Danio rerio Vs197 igkv CABZ01050232.1 17285 CGGQISVTQSPSMTAEPDKPVTITCRTSRDVQRWSDGDEGLAWYLQKPGEAPKLLIRYVKKLLSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio Vs276 trav CABZ01061539.1 18041 QHTEADVIKPLSLDENKHVDDTFTLSCSYKDYTDTVRNLQWYRQLPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDSKQVDLNISSALETDSAMYYCALV
Danio rerio Vs23 trav CABZ01009088.1 37287 TVFGNTIKPDETNVVAQKDSDVKLSCSYSSTTTDTLYWYRQYERSKPEFLVLIYSSAKAAEKSKVDPRFFVKVEKRQQIHVDLLLSSTAVSDSAVYYCALQ
Danio rerio Vs15 igkv CABZ01007641.1 816 CGGQISVTQSPSITAEPGKPVTITCRTSTNVYRDSDGDDYLFWYLQKPGEAPKLLIRYVKKLQSGTASRFSGSGSNRDFTLSISGVQTEDAGQYYCQS
Danio rerio Vs446 trav CABZ01048627.1 11206 SVFGNDIKPNSTEVVLKEGSDGTIFCSHSPGTGDYIHWYRQYGGSKPEFLVLIYGTANKGETSKVDPRFSVKVEKKERNHADLKISSAAVSDSAVYYCALQ
Danio rerio Vs254 trav CABZ01061538.1 22685 VTHADAITPDRPEVNVNETESITLSCQYSSAFSLHWYRQHDASGPQFLMLIQQSTGQMIQRSDDRLSGKLNKEKNRVDLQISSSTIKDSALYFCALQ
Danio rerio Vs258 trav CABZ01061538.1 28811 AFGDTIGPDEPLIFRSETDRVTLSCSYQTNSEHVDLYWYRHYPKSEPQYLLWKGARARDGEKHMPDSHFESSTSRTSTELIIKVAALTDSALYYCALWK
Danio rerio V215 trav CZQB01168510.1 5163 KVDQPDKHMTEVEGKSVTLRCTFTTTSNQPDLFWYIQRANDHPKYILRRDKYGAGENGTEFQERFHSEFLTDSVPLLIRDLHVSDSAVYYCALR
Danio rerio V7 igkv CZQB01102418.1 7433 CAAQITVTQSPVEPVKPGENVQMSCKLSEPSNCSPNPCVSWYLQKPGEAPKLLIYKTDIRESGTASRFSGSGYDTDFTLSISGVQTEDAEHYYCQS
Danio rerio V6 igkv CZQB01102418.1 3872 CAAQITVTQSPVEPVKPGENVQMNCKLSQPAPCSPDSCVSWYLQKPGEAPKLLIYYTSSRYSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQT
Danio rerio V5 igkv CZQB01102418.1 2654 CGGQISVTQSPSITAEPGKPVTITCRTSTNVYRDSDGDDYLFWYLQKPGEAPKLLIRYVKKLQSGTASRFSGSGSNRDFTLSISGVQTEDAGQYYCQS
Danio rerio V4 igkv CZQB01102417.1 4284 CAAQITVTQSPVEPVKPGENVEMRCKLNQYSNCSPYPCLYWYLQKPGEAPKLLIYYVNRLQSGTASRFSGSGSHVDFTLSISGVQTEDAGHYYCMS
Danio rerio V3 igkv CZQB01102416.1 10736 TQTPSVKTVRPGENIQMYCKLSKHSTCGPPCVYWYLQKPGEVHKLLIYDASSLASGTLSRFSGSGSHSDYTLSISGVQTEDAGHYYCQSYYWMNSKNV
Danio rerio V2 igkv CZQB01102416.1 7845 CIGQVTVTQTPSVLLSEPGQSLTVHCRFSRDPPCCYGSGTYLVSWYLQRPGEAPKLLIYYTTVLQSGTASRFSGSGSKTDFTLSISGVQTEDAGHYYCQS
Danio rerio V1 trgv CZQB01060324.1 34143 CSSGLEVVQENNVKIAAAGEEVNLTCTFKGLVQATKAWFKQTADGKSLQIVSLYSNDNPIWSNISENHFNVMKGDGYFNLTILKTKPSDSATYYCVISTF
Danio rerio V0 igkv CZQB01058134.1 44719 KVTQSPSEKTIEAGQSVTLMCSSNLDVGKWCNDTYCLSWYLIKAGEAPKLLIYQGNLRHSSAPSRFSGNGSVRSFQLTISGARGEDSGLYFCFGDYGGFR
Danio rerio V45 trbv CZQB01007396.1 30040 AVRQPTASVSAFTEETITLSCEYYTTDSMPALLWYRQTKNFPPQYILVRHNLGNGSNSKDFPNNRYQSRLDSAMGQVTLTVRNLLLSDSSVYFCALRPTV
Danio rerio V44 trav CZQB01007396.1 33471 VTHADAITPDRPEVNVNETESITLSCQYSSAFSLHWYRQHDASGPQFLMLIQQSTGQMIQRSDDRLSGKLNKEKNRVDLQISSSTIKDSALYFCALQ
Danio rerio V43 trav CZQB01007395.1 12 NANENSIRPDEEFVSLNEGSNTTLSCTFDGSAYRLHWYRQKTGSLLEFLVLIDKSTKVVVTASPPHPHVSINLHDNRVDLEITPAAVSDSAVYYCALQ
Danio rerio V42 trav CZQB01007395.1 729 VIGEVITSRGSKKEAQDGTKVTLSCNYTGVVYNLLWYRQYQRFKPELLLSITESGEAVKADPSSHWLSATVHKQSKLTELEISPAKVTDSAVYYCALK
Danio rerio V41 trav CZQB01007395.1 3009 IADAYTIESLSAEKQVSVGGNAVISCKYSGIGPSFQWYRQYPGSRPEYLIFNTETGAGSEPTLRLTSMAKKALTQVDLEISSTEVKDSAMYYCALQ
Danio rerio V40 trav CZQB01007395.1 4904 FFSNAIRPLSAEQQVLEGGKVILSCAYNGSNIKSLQWYKQHHSPAPEYLLQTFENAAPEQKDRLLAKAQKDKKQLDLEISKAEMSDSAVYYCALVPTVTG
Danio rerio V39 trav CZQB01007394.1 1150 QHTEADVIKPLSLDENKHVDDTFTLSCSYKDYTDTVRNLQWYRQLPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDSKQVDLNISSALETDSAMYYCALV
Danio rerio V38 trav CZQB01007393.1 579 DSLGDIITSRGSEKAAQDGTNVTLSCNYTGAVYNLLWYRQYQRFKPELLLSITESGEAVKADPSAHWLSATVHKQSKLTELEISPAKVTDSAVYYCALKPTVTG
Danio rerio V37 trav CZQB01007393.1 4466 HTEADVIKPLSLDENSHVGDAVTLSCSYKDYTGNMQNLQWYRQFPRSKPEFILYIFESGTMSKDKPDRFSAQVNKGTKQVDLNISPAVETDSAMYYCALV
Danio rerio V36 trav CZQB01007393.1 5217 NVDADGHMINPLSLETHGPVGHNVTLSCNYSGRVHTLQWFRQYPGSRIEFLIFATELNDQSNAALRISNVVDKQKSMSLSIFHAEIQDSATYYCALE
Danio rerio V35 trav CZQB01007393.1 6363 HTEADVIKPLSLDKNCHVGDAVTLSCSYKDYTGTVQNLQWYRQFPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDTKQVDLNISSAVETDSAMYYCALV
Danio rerio V34 trav CZQB01007393.1 7950 QHTEADVIKPLSLDENKHVDDTFTLSCSYKDYTDTVRNLQWYRQLPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDSKQVDLNISSALETDSAMYYCALV
Danio rerio V33 trav CZQB01007393.1 9392 HTEADVIKPLSLDENSHVGDAVTLSCSYKDYTGTVNGLQWYRQLPRSKPEFILYIFESGTLSEDKPDRFSAQVNKDTKQVDLNISSAVETDSAMYYCALV
Danio rerio V32 trav CZQB01007392.1 1311 NSGEEVISTLPTNQYIIEEKNATLSCNYSGYVQNLQWYRQYPGSKPENIIFYTESNNQSDSKLRLLAVADKGQKLMNLSMYFTKVEDSALYYCALQ
Danio rerio V31 trav CZQB01007392.1 1962 DSNGNVIRPEKTSVVLTEGSNITLSCTFNITPYSLHWYRQMPGSRPEFLLLIVRSTKTKVAASPPQPHMSINLSEKRVDLEISSAAVSDSAVYYCALE
Danio rerio V30 trdv CZQB01007391.1 96767 ETTGDKIKPDNDTAQLMENSNITLSCTYEGSIDSLYWFQQKIGSRLEFLIMIDEASEYVTNAIPPHPRLSVQLHKAQKRVSLEMSSAAVTDSALYFCALR
Danio rerio V29 trav CZQB01007391.1 99175 VVNGNVITPARTSVVLTEGSNITLSCTFNTSPYRLLWYRQTPGSRPEFLLLIVRSTKTTIEASPPQPHMSINLSEKLVDLEISSVAVSDSAVYYCALE
Danio rerio V28 trav CZQB01007391.1 100376 NAGKEVISSLSTEQIVLAGKNATLSCKYNSNIRNLQWYRQYPGSKPENIIFHTESNNQSYSRLRLLAVAEKEIKRMNLSIFHTEMQDSALYYCALEPTVTG
Danio rerio V27 trav CZQB01007391.1 102957 NAGEEVIRPLFKEKHVLEGDVVTLICSYSGSVQNLQWYHQFPGSKPENIFLYFENKPQTEGRMTAASDKAVKHMNLTITSTQLTDSAVYFCALV
Danio rerio V26 trav CZQB01007391.1 105208 DAGEEVISSLSTEQIVLAGKNATLSCKYNGNVYNLQWYRQYPGSKPENIIFHTESKNQSDFKLRLLAVGEKGMKRMNLSIFHTEMQDSALYYCALQPTVTG
Danio rerio V25 trav CZQB01007391.1 108250 DSNGDIIRPEQTSVVVTDGSSITLSCTYDESAYSLHWYRQTPGSRPEFLLLIDESSKYVTKAEQPHPHMSIQLQNNKRVNLILSFAAVSDSAVYYCALQ
Danio rerio V24 trav CZQB01007391.1 109723 TAGEEVISSLSTEQIVLAGKNATLSCKYNGNVYSLQWYRQYPGSKPENIIYHTESNKQSHSRLRLLAVTEKGMKRMNLSIFHTEMEDSALYYCALEPTVTG
Danio rerio V23 trgv CZQB01007213.1 3956 DGQAMLRQKISSTKSQDKTVVIDCDYPSDCYRYIHWYQLKGQTLKRILYAQISGGEPARDAGFELFKIDRKQSNIALKIPELKTEHSAVYYCACWDRSA
Danio rerio V22 trgv CZQB01007213.1 6355 QVTLRQKISSTKSQDKTVVIDCDYPSDCRSYIHWYQLKGQTLKRILYAQISGGEPAKDAGFELFKIDRKQSNIALKIPELKTEHSAVYYCACWVSG
Danio rerio V21 trgv CZQB01007213.1 10255 VEGLSLIQSQKVFVKLTGKTVSFKCEVFGLGSTNFVHWYHKKDGETLKRLLYISYTGTATGEAADYVSEKNGNSYGIKLKEIKEEHAGMYYCAAWDG
Danio rerio V20 trbv CZQB01007213.1 17428 AVLGVTLNQGQKALSKAAGKTLYLPCKVAGLQSWNYIHWYQMRDGEAPSRLLYINEGGAVTYDTNNPQANDFTVDRRKLYDLKLGDAQQKHTAVYFCAYWDTS
Danio rerio V19 trbv CZQB01007213.1 22815 AVGAKLDQGSKALVKAAGKTVYLPCKVTGLESSNYVHWYQVKDGKAPSRLLYISIDGAVVRDDKNPQTNDFTVDKTRLYDLKLSDTQSKHAAVYFCASWEYDSRT
Danio rerio V18 trbv CZQB01007213.1 26209 AVLGVDVDQGPKTLVKAAGKTVYLPCKATGLEYIHWYQVKDDEAPSRLLYISRDGVVTRDNNAQTHDFTVDKTRLYNLKLGDAQQKHAAVYFCAYWDSS
Danio rerio V17 igkv CZQB01177207.1 2201 VSGVTVVTQSPVITASKGQTAQLNCNVGTVTDYPAVWYKQTPAGVPQYVLRFRHDWRLTYYGSGFSAPKFTSTHSSKSDYSLIISNVDVSDSAVYYCKTWDGSASEWV
Danio rerio V16 trav CZQB01168933.1 6242 AAHSRIDQPDKVLAVELGSTVTLRCISWKENIFWYKQVAGQQPRVISAFQKLMEPIFYKEFKNERFWGIRLRSSTNLTISDIIQSDEAVYYCASRAFYIEFGSG
Danio rerio V15 igkv CZQB01126589.1 9343 CIGQVTVTQTPSVLLSEPGRSLTVHCRTSSNPACCYSGDPAVSWYLQKPGEAPKLLIYYTDVLQSGTASRFSGRGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio V14 igkv CZQB01126589.1 3156 CAAQITVTQSPVETVKPGENVQMSCKLSTSSYSGCYPPCVSWYLQKPGEAPKLLIYKTSSLQSGISSRFSGSGSNVDFTLSISAVQTEDAGHYYCMS
Danio rerio V13 igkv CZQB01126589.1 1310 CAAQITVTQSPVETVKPGENVQMSCKLSSSETGCYPPCVSWYLQKPGEAPKLLIYRTSSRQSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQS
Danio rerio V12 igkv CZQB01126588.1 5790 QITVTQSPVETVKPGENVQMSCKLSSSKTDCNPPCVSWYLQKPGKAPKLLIYYTNRRQSGTASRFSGSGSNLDFTLSISGVQTEDAGHYYCMSFNYGPVL
Danio rerio V11 igkv CZQB01126588.1 3689 TQTPSVLLSEPGRSLTVHCRFSSDPRCCCNSNQCVNWYVQKPGEAPKLLIYGINTRQSGIASRFSGSGSVFDFTLSISGVQTEDAGYYYCQGYDYISSNHE
Danio rerio V10 igkv CZQB01126588.1 2621 ITVTQPELLTVPEGQNARIECKTDPGIDDWGLAWYQQKHGEAPKLIITGVNDLHDRSFSRFSGNGRSGGKDFTLSISAVQTKDAGHYYCQS
Danio rerio V9 igkv CZQB01126588.1 965 CIGQVTVTQTPSVLLSEPGRSLTVHCRFSSDPECCYSGDSLVSWYLQRPGEAPKLLISYTSRLVSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Danio rerio V8 igkv CZQB01126586.1 444 TVSQTPAEKLVHPGDKVTISCKTSPQVYQGWSVQPLHWYLQKPGEAPKLLIYHASSLQSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQSFHVINSKYV
Danio rerio V85 trav CZQB01007418.1 600 CRGQNRVEQPSREMTADKGDTVTLPCNYSVTTTNAYLFWYKQLPNRSPTFMLSAFTVGKGTTEDEFKERFNATLDKTLRTVPLLIQDLQVSDSAVYYCALQPTVTQ
Danio rerio V84 trav CZQB01007412.1 3492 CKCKDSVHQKRVETAVEGTDLFISCSYTSTDPIPTLFWYQQKVNEFPKYMLSTFESKDDEFKKRFNARLNTSSTSAPLLIQDLRVSDSAVYYCALK
Danio rerio V83 trav CZQB01007412.1 7387 NVEQPSGQITANEADSVHLQCSYSTTFTNAYLFWYKQLPNRSPTFILSEFTIGEGTTEDEFKGRFSATLNSTLKSVPLLIQDLRASDSAVYYCALR
Danio rerio V82 trav CZQB01007410.1 2913 SVYQPKTLQSANEEDAAVTLDCKYSTSSSNPTLLWYRQDDYGSPKYILLRYKFGDGDEATEFKGRFGSRLDSASKSVPLTIQHPHASDSAVYFCALL
Danio rerio V81 trav CZQB01007410.1 4472 EEIIFPNNKTVIAKADEKVLLSCSYTGTVYDLYWYRQSPGSAPQFLIMESSGVIIHATPQVPGIKIINKKNTKHVELEIFSASVEHSAVYYCAARPTVKG
Danio rerio V80 trav CZQB01007410.1 7149 QDSVTQTATVQTATEGQAVTIECTYKTNAFPTLYWYQYKANQFPKYMLKRYAGSSDEDDNFKDRFNANLNSSSTSVPLTITDVRVSDSAVYYCALQ
Danio rerio V78 trav CZQB01007410.1 14034 DTVDQPLKHVTALEGISVTLDCKYTTSSTSQELFWYIQRADGSLKLQRNSYGGGVNGTEFKERFYSEVKTSKSVPLLIQDTCVCDSAVYYCALR
Danio rerio V77 trav CZQB01007410.1 21468 SVNQPDTHVTKSEDGAVTLQCKYTATSTATPELYWYIQREHEIPKYILRKNKYEGENGTEFHKRFHVELTTDSVPLLIKDLRVSDSAVYYCALK
Danio rerio V76 trav CZQB01007410.1 25428 SVDQPDRELTSAEGNEVILLCNYKLMSAANAYLYWYKQLPDTSPAFILSEFSIGKGKAEPEFKDRFSAKLDSKLETVPLTIKDVRVSDSAVYYCALQPTVTQ
Danio rerio V75 trav CZQB01007410.1 29309 EIHPLSSDKHVAEGQNVTLCCNYRASTGNVDSLLWYRQYPGANPEYLLLLNEYSNSTKSYLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALRPTVTG
Danio rerio V74 trav CZQB01007410.1 29958 CRAQDRVEQPTRKKTENEGDQITLMCNYTTTSTNADVYLFWYKQLPDRSPTFILNKFPFSEGTIEPEFNKRFSAKLNSTLRTVPLLIQDLRVSDSAVYYCALR
Danio rerio V73 trav CZQB01007407.1 1834 VFADSIAPKKEGRNKTRKEGESVTLSCTFNRSDTAISLYWYMQYPNRELQYLLYKGHRSSEEGIVTDSRYKSTVSPTSTSLTINSVNLSDSALYYCALKKG
Danio rerio V72 trav CZQB01007407.1 2777 SEVITPKTDREFAVEGDNVTLSCNYSGSVRSVHWYRKYSGSPPQFLILEYSGVITPADPPVPGISINHRKKQSHVDLLLSSAAVSDSAVYYCALQ
Danio rerio V71 trav CZQB01007407.1 6224 VSFGNVITSVETRLLHSEGDVISVSCSYSSARTLFWYRQNPGTVPQFLFVILESNGDVLQKSEAVKDPRFSAKVNEKKTHVFLEISSAKVTDSAIYYCALE
Danio rerio V70 trav CZQB01007407.1 12309 SSATEAITPYRAYEFAFKDDRVILSCNYTGSARGLHWYRQYPGLPPHFLILDYYGAVTHAKPPIAGISIKHRKDDSSVDLEISSAAVSDSALYYCALE
Danio rerio V69 trav CZQB01007407.1 13519 VSFGNVITSVETRLIHTEGDVISVSCSYSSARTLFWYFQNPGSVPQFLFIILHSNGEVLQKSEAVKDPRFSAKVNEKKTHVFLEISSAKVTDSAIYYCALE
Danio rerio V68 trav CZQB01007407.1 15092 LEAIDPKTDREFAVEGDNVTLSCNYSGSVRGVHWYRQYAASPPQFLILEDSGVTTPANPPVPGISINHRKAEKHVDLLLSSAAVSDSAVYYCALR
Danio rerio V67 trav CZQB01007407.1 21534 VTFGNDITPVQTEVFGAEMDNITVSCKYSSAVSLQWYRQYPGSAPDFLLTIHRTGSVSRSSTIVNEDPWYYGKLNKEKTHVFLEISTAKVSDSAVYYCALQ
Danio rerio V66 trav CZQB01007404.1 808 NRAKDAITPYRDAVFASESERVKLSCNYTGSVDSLHWYRQYPGSRPHFLILDYSGFVTHANPPFDGISIKHRKENSSVDLLISSAAVSDSAVYYCALR
Danio rerio V65 trdv CZQB01007404.1 2762 DVLGNVIIPVHSEVYKTEKETISLSCNYSSASSLYWYRQYPKSTPEFLFVILHATGKVLQKSDIVDQDPRFSGKLNEEKTHTSLNISSAKVTDSAMYFCAME
Danio rerio V64 trav CZQB01007402.1 2366 NRAKDAITPYRDAVFASESERVKLSCNYTGSVDSLHWYRQYPGSRPHFLILDYSGFVTHANPPFDGISIKHRKENSSVDLLISSAAVSDSAVYYCALR
Danio rerio V63 trdv CZQB01007402.1 4320 DVLGNVIIPVHSEVYKTEKETISLSCNYSSASSLYWYRQYPKSTPEFLFVILHATGKVLQKSDIVDQDPRFSGKLNEEKTHTSLNISSAKVTDSAMYFCAME
Danio rerio V62 trav CZQB01007398.1 864 GKSDSPITSDQTEVFPRENANVTLSCSYSSAISLHWYRHLPRSAPEFLLLVLQTTGRVQTAQNLDSRFEAMLNEKKNKVHLIISSVKVTDSALYYCAME
Danio rerio V61 trav CZQB01007398.1 1672 VTHADAITPDRPEVNVNETESITLSCQYSSAFSLHWYRQHDASGPQFLMLIQQSTGQMIQRSDDRLSGKLNKEKNRVDLQISSSTIKDSALYFCALQ
Danio rerio V60 trgv CZQB01007398.1 3108 ITFCAHIAPNTKFVIGREGESATLSCLYESSSSHVLLFWGRILPKQAPEFLLLKGARSETQFQSVDPRYDSATSKTATFLIINNLTLEDKASYYCVLE
Danio rerio V59 trav CZQB01007398.1 11790 NLAKDVITPYSDEIFASETESVKFSCNYTGSVDGLHWYRQYPDSPPHFLILDYYGSITHANPPIAGISIKHRKDNSSVDLEISSVAVSDSAVYYCALQ
Danio rerio V58 trgv CZQB01007396.1 493 GIFANSVTPWSTKQQVLEGENVTLSCNYSGSNIQSLQWYRKYPSSTAPEYILQTFESAEPAQQGRHLAKAQKNKKQLDLLISKAEMTDSAMYYCALV
Danio rerio V57 trav CZQB01007396.1 2603 TLAQSIRPLQSDVYITERTPVKLSCKYDGSVYSLHWYPQYPGAKPEFLLLVLKSATKSVTYADPKIPGMDGEMSISEQQVDLEISSAAVSDSAVYYCALQ
Danio rerio V56 trav CZQB01007396.1 3268 QSFGQSITALQSTKQAAESETVILSCKYDTRADNLQWYRHYPGSTPEYLLLVYESNTVFHAEPPFPRLNASVNKVEKQVNLTISSAAVTDSAVYYCALQ
Danio rerio V55 trav CZQB01007396.1 8095 TLAQSIRPLQSDVHITEKTPVRLSCKYDGSANSLHWYRQHLGSKPEFLLLVMESVIRHVTYADPKIPGMDGEMSMSEKQVDLEIFSATISDSAVYYCALQ
Danio rerio V54 trav CZQB01007396.1 8783 QSFGQSITALQSTKQAAESETVSLSCKYDTQANNLQWYRQYPGSTPEYLLLVYESNTVFHAEPPFPRLDASVNKVEKQVNLTISSAAVTDSAVYYCALQ
Danio rerio V53 trav CZQB01007396.1 12112 TLAQSIRPLQGDVHITERTPVRLSCKYDGSAYSLHWYRQYPGAKPEFLLLVRESAKKSVTYADPKIPGMDGEMSMSEKQVDLEIFSAAVSDSAVYYCALEPTVTG
Danio rerio V52 trav CZQB01007396.1 15165 TLAQSIRPLQSDVYITERTPVKLSCKYDGSVYSLHWYRQYSGAKPEFLLLVTESTSKIVTYADPKIPGMDGEMRMSEKQVDLEISSAAVSDSAVYYCALQ
Danio rerio V51 trav CZQB01007396.1 15862 QSFGQSITALQTTKQAVESETVILSCKYDTQADSLHWYRQYPGSTPEYLLLVYESNTVFHAEPPFPRLNASVNKVEKQVNLTISSAAVTDSALYYCALQ
Danio rerio V50 trav CZQB01007396.1 20813 ECFAQNITPLQGTTQVTEGKTVTLSCKYDVSVQSLLWYRQYPGSGLEFLLLVIESPTKTVIHAKPPIPRVDGEMSMSDKRVNLEISSAEVTDSALYYCALV
Danio rerio V49 trav CZQB01007396.1 23155 IIQTNMITSHDPQKQAFEGEYVKLACNYSGAPDNLHWYRQYPGSTPMFLLYIYESGLKSDNIPERLTPKINKTKKVVDLEISSATVSDSAVYYCALK
Danio rerio V48 trav CZQB01007396.1 25492 VSCGDVITPAQTEVYGKSGNKVTLSCNYSTALSLYWYRQYPGSNPHCLLLILTKSETSENMQPGMSVRLHKEKASMDLKISSAKLTDSAVYYCALK
Danio rerio V47 trdv CZQB01007396.1 27341 AFGDTIGPDEPLIFRSETDRVTLSCSYQTNSEHVDLYWYRHYPKSEPQYLLWKGARARDGEKHMPDSHFESSTSRTSTELIIKVAALTDSALYYCALWK
Danio rerio V125 trav CZQB01007439.1 10545 SVSGNLIKPIQTDVFADEGSNVTLSCSYSSADYLFWYRQYPRGAPEFLVSIFEGERNSKSSDVDPRLSAKLTKSEHNHADLMLSCAAVSDSAVYYCALR
Danio rerio V124 trav CZQB01007439.1 13400 VAYGNEIKPVKTEEFAKEDSSVTLSCSYSSARTLFWYRQYPGLAPQFLVFFIHGTSEAKESGVDPRFTAKPNGEKQSHVDLLLSSAAVSDSALYYCAME
Danio rerio V123 trdv CZQB01007439.1 16637 DTFAQTITPLENKIVKSEGETASLSCKYEGSVTNLHWYRQYPGSRPEFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio V122 trav CZQB01007439.1 18257 FVSPDSVEQKTRVQTAVEGESVTINCTYSTTDTFPYLFWYQQQVNGIPQYMLKKFPGSGEIENQFKKRFDADLDSSTTSVLLRIKEVHVSDSAVYYCALK
Danio rerio V120 trav CZQB01007439.1 27484 SVFGNDIKPNSTEVVLKEGSDGTIFCSHSPGTGDYIHWYRQYGGSKPEFLVLIYGTANKGETSKVDPRFSVKVEKKERNHADLKISSAAVSDSAVYYCALQ
Danio rerio V119 trav CZQB01007439.1 32694 SVLGNDIKPNITDVVYEEGSDGTIFCSHSPGAGDYIYWYRQYGGSKPEFLVLIFGSTKDTETSKVDPRFSVTVEKKERNHADLLLSSAAVSDSAVYYCALQ
Danio rerio V118 trav CZQB01007439.1 38248 FGSDIKSNITDVVYKEGSDGTIFCSHYPGTGDNIFWYRQYGGSKPEFLLATYGSAKDTETSKVDPRFSVKVEKKERNHADLKISSAAVSDSAVYYCALR
Danio rerio V117 trav CZQB01007439.1 39443 CDSQDKVDQHIKTQSAFEGDTVTIDCTYQTSYTTPTLFWYQQKVNEVPKHMLNKFSTTGNSEEEFKKRFNAALSKTSVPLTIKDLHVSDSAVYYCALKPTVTQ
Danio rerio V116 trav CZQB01007438.1 795 QDRVEQVEGEMSDSEGNHVIISCNYSTSQTAYLFWYKQLPNRSPTFILSQYSAEADFTKRFSATLDSKEKSFPLTIKNLQVSDSAVYYCALR
Danio rerio V115 trav CZQB01007438.1 3582 CRGQDRVEQAEGEMTESERNHVIISCNYITTSTTVYLFWYKQLPNRSPTYILSQYSAEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALR
Danio rerio V114 trav CZQB01007438.1 7614 CRGQDRVEQAEGEMTESERNHVIISCNYITTSTTVYLFWYKQLPNRSPTYILSQYSAEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALR
Danio rerio V113 trav CZQB01007438.1 10864 CRGQDKVEQPIREITEGEGAHVFVQCNYTSSNPTLFWYKQLPNRSPTLILSQYSAEADKKRFSATLNSKEKSFPLLIQDLQVSDSAVYYCALE
Danio rerio V112 trav CZQB01007438.1 11889 AIYADEIKPVKSEEFADGGSNVTLSCTYSSAYYLYWYRQYPGSAPQHIVLIPESRKDDTKSDVDHRFIARVTKDKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio V111 trav CZQB01007437.1 4331 QDRVEQPSIEMTESEVEEVIIRCNYSTLSTSPDLFWYKQLPNRSPTYILNQYSTEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALKPTVTG
Danio rerio V110 trav CZQB01007437.1 7033 ATYADEIKPVKTEVFADEGSNVTLSCTYSSANNLQWYRQYPGSAPQYLVLIPDSSKEDWKSNVDDRFTARVTKNKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio V109 trav CZQB01007437.1 8090 QDRVEQVEGEMSDSEGNHVIISCNYSTSQTAYLFWYKQLPNRSPTFILSQYSAEADFTKRFSATLDSKEKSFPLTIKNLQVSDSAVYYCALR
Danio rerio V108 trav CZQB01007437.1 10877 CRGQDRVEQAEGEMTESERNHVIISCNYITTSTTVYLFWYKQLPNRSPTYILSQYSAEADFKERFSATLDSKEKSFPLTIKNLRVSDSAVYYCALR
Danio rerio V107 trav CZQB01007433.1 1696 RVEQPLRDITANEGDQVIIPCNYSTTDTNPYLFWYKQLPNRSPTFILNKLTYGEGTVEADFKDRFSATLNSTAKSVPLMIKDAQLSDSAVYYCALR
Danio rerio V106 trav CZQB01007432.1 727 TAIADEIQPLSSDKRVAKGENVTLSCNYSTTVTVDSLQWYRQYSGAKPEFLLSLNEYSNSSKLDLRLVSNAVKALKRVDLLLSSAAVSDSAVYYCALQ
Danio rerio V105 trav CZQB01007429.1 3014 QQPSGEMTENEGDQVSLMCNYTTTASDGNIFLFWYKQLSNRSPTFILNKIPFSEGTIEPEFNKRFTAKLNSTLRTVPLLIQDLRVSDSAVYYCALKPTVTQ
Danio rerio V104 trav CZQB01007429.1 4234 EIHPLSTDKHVAEGQNVTLSCNYSTSTGTVNSLQWYRQYPGAKPEFLLSLNEYSNSSKPDLRLVSNAVKALKRVDLLLSSAAVSDSAVYYCALQPTVTG
Danio rerio V103 trav CZQB01007424.1 876 CDCAESVDQNTRVETSVEEGSVSISCTYQTSDPSPNLFWYQQKPNTIPKHMMTIITTTVQNDKDFEEERFGAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio V102 trav CZQB01007424.1 3291 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTTPTLFWYQQKVNGVPKHMLNKISTSGHTEEEFKERFHATLSKTSVPLTIKDLRVSDSAVYYCALRPTVTQ
Danio rerio V101 trav CZQB01007424.1 5436 CDCAESVDQNTRVVTFVEEGSVTINCTYQTSDPSPYLFWYQQKPNTIPKHMMTIITTTVQNDKDFEEERFGAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio V100 trav CZQB01007424.1 18690 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSSTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKKRFNATLSKTSVPLTIKDLRVSDSAVYYCALRPTVTQ
Danio rerio V99 trav CZQB01007424.1 19651 TSSADEIHPLFLDKQVAEGQNVTLSCNYSISIGILRSLQWYRQYSGAKPEFLLMLNEYYNKSKLDLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALQPTVTG
Danio rerio V98 trav CZQB01007424.1 21554 RVSLDKVEQNSRVKTAVEGEDVIINCQYETTDTSPYLFWYQQKVNSVPEYMLNRFSSDEEQFKGRFSSELNTSSKSFPLKIQDVRVSDSAVYYCALR
Danio rerio V97 trav CZQB01007424.1 22207 KVQQPSGEKTENEGDQVNLMCNYTTTASDTNIYLFWYKQLPNRSPTFILNKSPFSEGTIEPEFNKRLSATLNSTSKTVRLLIQDLRVSDSAVFYCALR
Danio rerio V96 trav CZQB01007423.1 1029 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKERFHATLSKTSVPLTIQDVRVSDSAVYYCALR
Danio rerio V95 trav CZQB01007422.1 5143 RVDQPDKQLTEAEGGSVTLQCKYKTDSVQENLFWYIQRTNDLPKYILRRSKYGGENGTEFQERFHSELSTNSVPLTIRDLHVSDSAVYYCALK
Danio rerio V94 trav CZQB01007422.1 10232 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKERFHATLSKTSVPLTIQDVRVSDSAVYYCALR
Danio rerio V93 trav CZQB01007422.1 12417 CDCAESVDQNTRVETSVEEGSVSISCTYQTSDPSPNLFWYQQKPNTIPKHMMTIITTTVQNDKDFEEERFGAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio V92 trav CZQB01007421.1 1626 ATYGDEIKPVKTEKFADKGSSVKLSCTYSSANTLFWYRQYPGSAPQYLVLIPEGTKDDWKSDVDKRFTARITKDKEKHVDLLLSSAAVSDSAVYYCALR
Danio rerio V91 trav CZQB01007421.1 5730 CRGQDRVEQPLRSISANERGQVIISCSYSTTDINIYLFWYKQLPNRSPTFILNKQTYGEGITAADFKERFSATLNSTAKSVPLMIRDLRVSDSAVYYCALRPTVTG
Danio rerio V90 trav CZQB01007421.1 6802 VIFGDEISPDSSEVFAAVASKVTLSCRYSSAYNLQWYRHYPGSAPQNLVLISEGLTETKISEVDSRFTTKLRKENQAGKEIKRVDLLLSSAAVSDSAVYYCALR
Danio rerio V89 trdv CZQB01007421.1 9410 ETFAQSITPLENKTLKSEGETVTLSCKYEGVVNNLHWYRQYPGFRPKFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio V88 trav CZQB01007421.1 12042 RVSLDKVEQNSRVETVVEDEDVIINCQYETTDTLPYLFWYQQKVNRFPEYMLNRFSSDEEQFKDRFSSELNTSSKSFPLKIQDVRVSDSAVYYCALR
Danio rerio V87 trdv CZQB01007421.1 19014 TFAQSITPLENKTLKSEGETVTLSCKYEGVVNNLHWYRQYPGFRPEFLAYIYEHGATSKPLPPRLLPKVDKNSKRVSLEISEAEVTDSALYYCALT
Danio rerio V165 ighv CZQB01055060.1 21942 VDSLELTQPESLTVRPDDSLTINCRVSYSVTSEHTAWIRQPAGKALEWIGVIYHNGGLAYKDSLKSKFSISRDTSSNTITLQGKNMKAEDTAVYYCARH
Danio rerio V164 ighv CZQB01055060.1 23093 INGQGMESIESSVQKKPGETLTLSCRGSGFTFSSYHMHWIRQQAGKPLMWIGRVYSDGSGNDYAESFKGRAEITRDNSKSMTYLKLSGLTTEDSAVYYCARQ
Danio rerio V162 ighv CZQB01055060.1 31347 VRGQNMESISSESVLKPGETLSLSCRGSGFTFGSNNMHWIRQQPGKALMWMGRVWYNAQGHDYANSFKGRIEITRDNSKSMVYLKLSALTEEDSAVYYCARE
Danio rerio V161 ighv CZQB01055058.1 248 VDSYELTQSDSLTVRPDDSLTINCKVSYSVTDYSTAWIRQPAGKALEWIGVIYYNGNLDYKDSLKSKFSITRDTSSNTITLQGKNVKAEDTAVYYCARR
Danio rerio V160 ighv CZQB01055057.1 6189 CWCQTLSESDAVVIKPGGSHRLTCTISGFGGNYAMSWIRQTAGGGLEWLAYISSGSGSIYYSQAVQRRFTISRDNSKNQMYLQMNNMKIEDTAVYYCARV
Danio rerio V159 ighv CZQB01055057.1 7654 CKGQTLTESESVVIKPGNEHRLTCTFSGIDVGDADISWIRQAEGKALEWISHISAPSGSGKYYSKAVEGRFSITRDNSKMQVYLHMTKLQTEDTGVYYCARR
Danio rerio V158 ighv CZQB01055057.1 8882 VRGQSLTSSDSVVKRPGESVTLSCTVSGFSMSSYWMHWIRQKPGKGLEWIGRIDRGTGTIFAQSLQGQFTITKDTSKNMLYLEVKQLKSEDTAVYYCARD
Danio rerio V157 ighv CZQB01055057.1 10528 ISGDEIRLDQSPSVTKRPGETVKISCKISGFTMTRYYMHWIRQKPGKALEWIGRVNSGSGSADYADSMKNQFTLSEDVSQNMQYLEAKSLREEDTAVYYCARE
Danio rerio V156 ighv CZQB01055057.1 14956 VRGQSLTSSDSVVKRPGESVTLSCTVSGISMSSYWMHWIRQKPGKGLEWIGYIDTGTTAYYAQSLQGQFTITKDTSKNMLYLEVKSLKSEDTAVYYCAR
Danio rerio V155 ighv CZQB01055057.1 16667 ISGDEIRLDQSPSVTKRPGETVKISCKISGFTMTSSYMHWIRQKPGKALEWIGRVDSGSSSSSDYLIYADSVKNHFTMSEDVSQSTQFLEAKSLREEDTAVYYCAR
Danio rerio V154 ighv CZQB01055057.1 21372 IDCQVVLTQSERSVNVAPGGFHKLSCACSGFTLRSTNMYWIRQAPGKGLEWIIYYYSDSDKSTAQSVQGRFTASKDSSNLYLHMNQLKTEDSAVYYCATQ
Danio rerio V153 ighv CZQB01055057.1 22218 CWCQTLTESEAVTIKPGESHKLTCTASSFDISGSWMAWIRQKSGKELEWLALIRYDSQDMYYFQSVQGRFTISRDNSKQQVYLQMNSLKDEDTAVYYCARE
Danio rerio V152 ighv CZQB01055057.1 24425 VYSQIVLTQSEQSVSVSPSGSVKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHFYSNSDNGAAQSVQGRFTASKDSSNFYLHMNQLKTEDTAVYYCARE
Danio rerio V151 ighv CZQB01055057.1 25281 YFCIELDQHPAMEVKPEETFTIVCKITGYSASGGGYTNWIRHSAGKPMEWIGYFHTSSNNGVKDSLKNKISFSSESSSNAVILTGKNFNTEDTAVYYCVRN
Danio rerio V150 ighv CZQB01055057.1 27266 CFCIELDQPPFMVVKPGETFTIACKITGYSASDGSTCTNWIRHSAGKPMEWIGYFCSSSSKGVTDSLKNKISLSSESSNNAVILTGRNFITEDTAVYYCARYT
Danio rerio V149 ighv CZQB01055057.1 29548 VYSIELNQPAFKLVKPAESFSLGCKITGYSASGGGCTNWIRHSAGKALEWIGWFCRSGDTGTSSTMKNKISFTAETSSNTVFLQGQNFQSEDTAVYYCARK
Danio rerio V148 ighv CZQB01055057.1 30816 ELKKTGESFRLVCTASGFTFSSCYAAVVRQAPGKALEWIAYIGTYSSPIYYSQSVQGRFTVSRDDSSSQLYLQMNNLKTEDTAVYYCARA
Danio rerio V147 ighv CZQB01055057.1 31621 GVYCVELTQPSSMVVKPQESFSISCRISESSYCINWIRQSAGRPLEWLGYLCSGGSTNIKDSVENKISFTQDTSKNTVFLQGRNFQTEDTAVYYCARQ
Danio rerio V146 ighv CZQB01055057.1 35813 SIVLRPGQVVTLSCKISGYSVTERYCTHFIRQAAGKALEWVGAICGSGNTYYSDKLKSRFTVSRDSSSSSVTLSGQNMQTEDTAVYYCARE
Danio rerio V145 ighv CZQB01055057.1 37102 VDSYELTQSDSLTVRPDDSLTINCKVSYSVTDYSTAWIRQPAGKALEWIGVIYYNGNLDYKDSLKSKFSITRDTSSNTITLQGKNVKAEDTAVYYCARR
Danio rerio V144 ighv CZQB01055052.1 1465 ISGDEIRLDQSPAVTKRPGETVKISCKISGFTMTEHYMHWIRQKPGEALEWIGKINTGSSSCSDYLVYADYIKNTTMSEDVSQSTQYLEAKSLREEHTAIYYCAREP
Danio rerio V143 ighv CZQB01055052.1 2582 VSGISLTSSPAQIKAAGQSVRLSCQISGYALTDYGTAWIRHPPGKAMEWIGIIWGRGSIDSGNSFKSRFTISRDTRKNELYLDISSLQTEDTAVYYCAKT
Danio rerio V142 ighv CZQB01055052.1 4955 CKGQTLTESESVIIKPGNEHKLTCTFSGLSVSSADISWIRQAEGKGLEWISHISAPSGSSKYYSKAVEGRFSISRDNSKMQVYLHMTKLQTEDTGVYYCARE
Danio rerio V141 ighv CZQB01055052.1 7534 IDCQVVLTQSEQSVNVAPGGFYKLSCACSGFSVSGTAMHWIRQAPGKGLEWIIYYYSDSYKSSAESVQGRFTASKDSSNFYLHMNQLKTEDTAVYYCATQ
Danio rerio V140 ighv CZQB01055052.1 9696 VYSQIVLTQSDQSVSVSPRGSVKLTCACSGFTLSSFRMFWIHQTPGKGLELILNYLSDSDKSSAQSVQGRFTASKDSSNFYLHMNQLKTEDTGVYYCAT
Danio rerio V139 ighv CZQB01055051.1 16055 AHGQSLTSSGSEVKKPRESVTLSCVVSGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFTITKDTSKNMVYLEIKSLKAEDTAVYYCAKE
Danio rerio V138 ighv CZQB01055051.1 21131 CRSQTLVESEAVVIKPDQSHKLTCTASGFNFGDYWMAWIRQAAGKGPEWVATLSNGNSYIYYSDKVKGRFTISRDDNKNQLYLQMNSLKTEDTAVYYCAR
Danio rerio V137 ighv CZQB01055051.1 22884 VSGQSLTSSDSVVKRPGESVTLSCTGSGFSVGDYWMHWIRQKPGKGLEWIGGRYSSTVYFAQSLQGQFSISTDTSKNMVYLEIKSLKTEDAAVYYCARE
Danio rerio V136 ighv CZQB01055051.1 24887 ISGDEIRLDQSPAVTKRPGETVKISCKISGFTMTEHYMHWIRQKPGEALEWIGKINTGSSSCSDYLVYADYIKNTTMSEDVSQSTQYLEAKSLREEHTAIYYCAREP
Danio rerio V135 ighv CZQB01055051.1 26004 VSGISLTSSPAQIKAAGQSVRLSCQISGYALTDYGTAWIRHPPGKAMEWIGIIWGRGSIDSGNSFKSRFTISRDTRKNELYLDISSLQTEDTAVYYCAKT
Danio rerio V134 trav CZQB01007440.1 695 CRSEDRVDQPDKQLTEAEGGSVTLQCKYKTDSTQEDLFWYIQRINDQPKYILRRSKYGGENGTEFQERFYSELSTNFVPLTIRDLHVSDSAVYYCALR
Danio rerio V133 trav CZQB01007440.1 3100 AVFGNVIKPINTDVFAEEGSNVTLSCSFTASGVTDYLHWYRQYGRSKPEFLVLTYSSATKAAQSDIDTRFTTNITKKEHVDLLLSSAAVSDSAVYYCALR
Danio rerio V132 trav CZQB01007440.1 5071 KVDQPDKHMTEVEGKSVTLRCTFTTTSNQPDLFWYIQKANDHPKYILRRDKYGAGENGTEFQERFHSELLTDSVPLLIRDLHVSDSAVYYCALR
Danio rerio V131 trav CZQB01007440.1 14505 IESQDNVEQKARVQTAVEGEAVEIDCTYQTQLTPTLFWYQQKTNTIPKYMLNRVGKTGGEDKEFKERFTANLNTFSKSVPLMIRDLHVSDSAVYYCALQ
Danio rerio V130 trav CZQB01007440.1 17693 TVFGNTIKPDETNVVAQKDSDVKLSCSYSSTTTDTLYWYRQYERSKPEFLVLIYSSAKAAEKSKVDPRFFVKVEKRQQIHVDLLLSSTAVSDSAVYYCALQ
Danio rerio V129 trav CZQB01007440.1 21335 QDNVIQPKQVMTAYEDGTITLECTYKASSTQYPNLLWYQQMTNGSPKYMLMRLSGSSDTNEEFKQRFNAELNTSALSIPLTIKDLRASDSAVYYCALK
Danio rerio V128 trav CZQB01007439.1 3904 RVEQPIREMTESIGDKVVISCIYSTTYTSLTLFWYKKLPNRSPTYILNQYSTEADFKERFSATLDSTEKSFPLTIKNLHVSDSAVYYCALRPTVTQ
Danio rerio V127 trav CZQB01007439.1 5392 ASSEDTITADKTEEFADDGSNVTLSCTFSSAWSLLWYRQYPGSAPEFLVNIAERSKKVERSNTDHRFTTKIRIEKEKHVDLLLSPAAVSDSAVYYCALTSM
Danio rerio V205 trbv CZQB01149659.1 14946 FSHCNKVDQSPPDLIHEQGETAKIRCQHSVSSYNQINWYRQNQDGGFTLMGYLLGTEPYRENDFKDKIDMPGDGNRDGNLTIKVISSNDNAVYFCAAY
Danio rerio V204 igkv CZQB01145824.1 261 TVTQSPAVRSITQGETLTISCKTTPLVSGCSDCVSWYQQKPGETPKLLIYYISSRYSNTPSRFSGGGSNYGSDFTLSISGVQTEDAGDYYCLS
Danio rerio V203 igkv CZQB01145085.1 4133 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSAVITALAWYQKRPGQTHKLLFYYLGNRVSGVSDRFTNEKSGTNFMLKIRNVQPEDAGDYYCQQYYEYPR
Danio rerio V202 igkv CZQB01145085.1 7054 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSAFQSSLAWYQKRPGQTHKLLFSSLGNKRSGVSDRFTDERSGTNFMLKIRDVQPEDAGDYYCQQHYEWPR
Danio rerio V201 igkv CZQB01145085.1 9413 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSSSLTKYLAWYQKRPGQTHKLLFYYLGNRVSGVSDRFTNEKSGTNYMLKIRDVQPEDAGDYYCQQYYDLPR
Danio rerio V200 igkv CZQB01145084.1 18162 CFAEIILTQSPSVDLVSVGSSVTLNCRSSSTAVTNGLVWYQKRPGQTHKLLFYYLNSRVSGVSERFTDEKSGTNFMLKIRNVQPEDAGDYYCQQYAQLPR
Danio rerio V198 trbv CZQB01118639.1 4489 VCLGETVHQTPGNFIKARSESAVITCTHKIQNYDRMLWYKQDTLGLKLMGYLFLDQTKEPEFENKIYLEGDAKKNGTLTIKNLTGNDSAVYFCAAYYTQ
Danio rerio V197 trdv CZQB01118639.1 7215 TAGDDGVLQYPKILWSTKESYAEMNCTHNKGLSYYQMYWYRQRPGETMRLIVFTMENSKPDFGDFDEKKYDASKEDPTSGSLTVKNLEPEDSAIYFCSVS
Danio rerio V196 trbv CZQB01118639.1 9045 SLGNTVHQTPSKSIKTPNKSAVFICTHNIGSYFQIMWYKQTKGKLGLKLMGYLNGETHNKEAEFSNKIILDGNGRRNGTLTIKELALNDSAEYFCAAY
Danio rerio V195 trbv CZQB01118637.1 1356 ACLGETVDQTPDYFIKKRSESAVITCTHNIQNYNRILWYKQSADTFGFKLMGYLSFNDENKELGFDNIKLKGDAKSNGTLTIENLTVTDSAVYFCAAYYTV
Danio rerio V194 trbv CZQB01118636.1 895 SVLGKSVVQTPPDLLNKPDEFAEIQCSHTIQSYYVVLWYKQNQSITNLQLMGYLNVDQDTIENDFNAKIKMKGDGRNNVTLTIRDLTVTDSAVYFCAAY
Danio rerio V193 trdv CZQB01118636.1 5437 SVANGSVKQSPSNLIKTKGDSVNLECGHSTTYTMIFWYKQSLGHGFTLLGYTWNKNSFPEDNLSKRISLDGDGTVKAFLRIKDLEASDSTLYYCAAS
Danio rerio V192 trbv CZQB01118634.1 2956 SVLGKSVVQTPPDLLNKPDEFAEIQCSHNIQSYYVVLWYKQNLSITNLQLMGYLNVDQDTIENDFNGKIKMKGDGRNNVTLTIRDLTVTDSAVYFCAAY
Danio rerio V191 trav CZQB01118633.1 6897 EKEDKTVHQNPLNLIIDHGDSPEIKCFHKITGYDRLLWYKQSQNKELTFMGYLIGDSGNPEKPFENKITIQGNANKLHGSLTLINATAESDSVYFCAAYYTV
Danio rerio V190 trav CZQB01118633.1 8134 SPLSDKVVQSPPDMIILSSLSESPVLQCSHRDSSYDRILWYKQLQNKQFIFLGYLLGSSHQLEPGFINKYTFAGNGNTNANLTIKTLEFNDTATYFCAASTQ
Danio rerio V189 trbv CZQB01118629.1 587 FSQSNKVNQSPPDLIYNQGDDAKIRCQHSVGGNYNQINWYRQNQDLSFTFMGYLLLQGPNPEKEFSKKIDMSGNGQSDGYLTIKSLLYNDSAVYFCAAY
Danio rerio V188 trgv CZQB01118628.1 2615 NSSIIQTPSDLLANNTESVSLHCSHSSSAFNVILWYKQLLNGEMQLMGHLYRTNNNTETLFTDKIELLGNGASSSSLKLKTLSSKDNAIYYCAAR
Danio rerio V187 trbv CZQB01118627.1 231 CSLVIQQSPKELLTVEVKDTNLSCHHGESSYPYMLWYQQKSNGGSLELIGLLTFGSFSPEDKFKSRFSTFGDSTKEAFLLISKVSAEDSAVYFCAAS
Danio rerio V186 trbv CZQB01118625.1 951 CVVCSPVIQQSPEHLLRSVEEKQANLSCYHGDNDYPYLYWYQQKSSGGSMELIGMLNYGSATVEDKFKTRFIISGHAKEDAFLVISSMSAEDGAVYFCAAS
Danio rerio V185 trbv CZQB01118624.1 4564 LSDCVQFDQPLSKFTEPGKKVVISCSHNDNNLDVMLWYQQLQSGGSLALIGYNYAKADPVYEPGFEKRFSLTRNSTETGSLTVSSPSLSDSAVYFCAAR
Danio rerio V184 trav CZQB01118622.1 491 KATCVIVEQKVTSLFANKSGNTVMNCSHDDSSMYVMLWYQQKNTEMVLISYRYDMSEPSNEDGFKERFDFQRTDTRNGALEISDLSQSDSAVYYCAVS
Danio rerio V183 trav CZQB01118622.1 2828 EVRCVIVKQKVSIFANKRDNIVMNCSHAEGGMQVMLWYQQKNTEIVLIGYSYGINQPTSEDGFKERFNLERVDTLNGALKISEVSQSDSAVYYCAVS
Danio rerio V182 trav CZQB01118622.1 5476 YARCADVQQNPSKLANKNDKAEISCKYSDSGKPNMLWYQQKDSAMALIVLSYGATGDPMYEDGFKGRFELERKVTFNGTLKINNLSLSDSAVYYCAVS
Danio rerio V181 trbv CZQB01118616.1 2149 SLGQIIITQNERLDRSELFVAPDKNVTLKCNHNDGTYFYMFWYRQRSKGEMSLVAFSPGKDTEEIVAPFEKTKYKMKRPDIKESSLEIYSVVQEDLGIYFCASSIA
Danio rerio V180 trgv CZQB01100338.1 4880 VRCAKVLTQKPSIMTEDKGRSVTLDCNIEKDYSYVSWYKQTLNAAPQFVLRYYHSLSSPDLYGDGFTSSRFTSKAQSKIDYSLIISNVAVSDSAVYYCKTWD
Danio rerio V179 igkv CZQB01076136.1 40608 SHQEVQSPECLSIQAGESASISCSGTSGVGNDMSWYLQKPGKAPKLLIYGISHLEPGVSDRFIGSGSEPDFTLNIRAVQPEDAGVYYCMGYYGDDT
Danio rerio V178 igkv CZQB01076136.1 52647 SVGQILTQSENQTVLPDQTVTIHCNHKPALNCWSLKNTSQYCMSWYHHFPGKTHKLLIYYTSNRASGVSSRYSGSENADHTVFTLTISGVQPKDSGVYYCQSQ
Danio rerio V177 igkv CZQB01060325.1 37337 GAQSNHSAEIVSLQTFKLGDDVIIKCFSTKISLGNTLVWYKQKTGQIPRAITISYIQLNKVIFEDEFKDGRFSILPSEDSFHLNITAATKQDTGIYYC
Danio rerio V176 trgv CZQB01060325.1 60623 QSNHSAEIVSLKTFQLGDDVIIKCFLTKMSLGNTLVWYKQSTGQIPRAITISYNQLNKVRFVDEFKDGRFSVLPSEDSFHLKITAATKQDTGIYYC
Danio rerio V175 trav CZQB01060317.1 64594 TDRISSTSVIQQPVSDRLHSGDSVTLQCSVSSHICAGHYRVYWFKHSSGYSQPGFIYTHDNRSDQCLESSEKSSFVQSCVYSLSQTELTTSDAGVYYCAVDTCGK
Danio rerio V174 trav CZQB01060317.1 74553 TDRISSTSVIQQPVSDRLHSGDSVTLQCSVSSHICAGHYRIYWFKHSSGYSQPGIIYTHDNRSDQCLESSEKSSFVQSCVYSFSQTELTTSDAGVYYCAV
Danio rerio V173 ighv CZQB01055060.1 759 IKCQSMESIESSVQRKLGETLTLSCRGSGFSFSYYNMHWIRQQAGKPLVWIGRVYDSTDYSYAESFKSRAEITRDNSKSMTYLKLSGLTAEDSAVYYCARQ
Danio rerio V172 ighv CZQB01055060.1 2846 IKCQNMESIESSVQKKPGETLTLSCRGSGFSFDCCSMHWIRQQAGKPLVWIGYVSNGGVSQNYAESFKGRTEITRDNSKSMVYLKLSGLTAEDSAMYYCARQ
Danio rerio V171 ighv CZQB01055060.1 4750 SIVLRPGQVLTLSCKISGYSVTDSSYCTNFIRQAAGKALEWVGAICGSGNTYYSDKLKSRFTVSRDSSSSSVTLSGQNMQTEDTAVYYCARE
Danio rerio V170 ighv CZQB01055060.1 5883 VNGQSLESIPSSSVTKKPGETLNLSCKGSGFDFGQYGMQWIRQPAGKALDWIGVIWSDGSKTVYAKSVEGRIEITRDNSNNMVYLKLSGLKTEDSAVYYCAR
Danio rerio V169 ighv CZQB01055060.1 8356 IKCESMESIESSVQKKPGETLTLSCRGSGFSFSSYYMHWIRQQAGKPLVWIGGTGYGYAESFKGRAEITKDNSKSMTYLKLSGLTAEDSAVYYCARQ
Danio rerio V168 ighv CZQB01055060.1 10658 SIVLRPGQVLTLSCKISGYSVTDSSYCTDFIRQAAGKALEWVGEICGSGNTYYSDKLKSRFTVSRDSSSSSVTLSGQNMQTEDTAVYYCARQ
Danio rerio V167 ighv CZQB01055060.1 12413 VNGQSLESIPSSSVTKKPGETLNLSCKGSGFDFGQYGMHWIRQPAGKALDWIGVIWYDASKTVYAKSVEGRIEITRDNSNNMVYLKLSGLKTEDSAVYYCAR
Danio rerio V219 trav CZQB01208027.1 360 SVANDSVQQSPPNLVKNKGDSADLVCSHKITSYTMIFWYKQSLGQGFTLLGYTWNKNHFPEDHLSTKISLDGDGTAEAFLTIKDLEASDSTLYFCAAS
Danio rerio V218 igkv CZQB01186361.1 716 SSGVTLTQPEVKTVQQDETATIECHIDVGIYSNYLAWYQQKPGETPKLLIYYINNRYSNTPSRFSGGGSGSDFTLSISEVQTEDAGDYYCQS
Danio rerio V217 igkv CZQB01172581.1 944 LSGQVTVTQSPAGKMVQVGESVTITCKSNPEVGDYCVGTHTCMAWYQQKPGEAPKLLIHSANRRDSNTPSRFSGSGSYSDFTLSISGVQTEDAGDYYCQS
Danio rerio V216 trav CZQB01171717.1 1720 VRCAKVLTQKPSIMTEDKGRSVTLDCNVEKDESYIYWYKQTPNAAPQFVLRYYHSHSSPDLYGNGFTSSRFTSKAQSKIDYSLIISNVDVSDSAVYYCQTWD
Danio rerio V214 igkv CZQB01168304.1 4621 SSGQITVTQTPAVQTAGAGQTVEFRCSASSPLTGCSPPCLSWYFQRPGEAPKLLISLINRLQSGTQSRFSGGGSDSDFTLSISGVQTEDAGDYYCQS
Danio rerio V213 igkv CZQB01168304.1 4621 SSGQITVTQTPAVQTAGAGQTVEFRCSASSPLTGCSPPCLSWYFQRPGEAPKLLISLINRLQSGTQSRFSGGGSDSDFTLSISGVQTEDAGDYYCQS
Danio rerio V212 igkv CZQB01168304.1 6604 QVTVIQTPAEHHVQHTHTVTLSCKTSSSIGRRSDGDCKSCVAWYLQKPGETPKPLVYNIRTLRAGTPSRFSGNGADHGTDFTLSISGVQTEDAGDYYCQS
Danio rerio V211 igkv CZQB01168304.1 6604 QVTVIQTPAEHHVQHTHTVTLSCKTSSSIGRRSDGDCKSCVAWYLQKPGETPKPLVYNIRTLRAGTPSRFSGNGADHGTDFTLSISGVQTEDAGDYYCQS
Danio rerio V210 igkv CZQB01168304.1 8653 STGQVTVIQTPAEHHVQHTHTVTLSCKTSSSIGRWSDGDCKSCVAWYLQKPGETPKPLVYNIRTLRAGTPSRFSGNGADHGTDFTLSISGVQTEDAGDYYCQS
Danio rerio V208 trav CZQB01149659.1 587 CLICKKVHQAPPDVLCKPNDSVELTCSHNIDNYDTILWYQKSKGDSSLKLIGYAQYSSVKKFEDAYDGHFSLNGSGEKEVTLKFLKARLDQDSAEYFCAAFYAQ
Danio rerio V207 trbv CZQB01149659.1 4075 CSLFSSVEQNPALLIVRSGESCNISCSHGITSYNTILWYYQHEDGQGMHSIGYSFHSSHTLENVEDKRYELNGDGKSSVTLIISKLLLNDSAVYFCAAS
Danio rerio V220 trbv CZQB01212353.1 212 SSGEIIITQNEHLDRTELLIQLNKNISLRCNHNDANYYNMYWYIQRSQGEMSLVAFSLGKDTEEIVAPFEKTKYKMKRPDIKESSLEINSVVQEDSGIYFCASSIA
Danio rerio V209 trbv CZQB01155273.1 6144 AKDVTQTPVLWAPMGVNATMNCNHSYPSTYFYMYWFRQRQGETMKLIAFTMLNNKPDFGEFSEDKYSATKTEAQRGSFTVKKLQADDSGVYLCAVSEHS
Danio rerio V206 trbv CZQB01149659.1 9710 FAQSNEINQFPPDLMGHLTESVLLSCSHSIQNFELTLWYKQSEDRRLIFLGYLNLKFQYPEDEFKNKIALKGDGSSNSTLTINNLTSDDSAVYFCAARRHGV
Danio rerio V199 trav CZQB01118639.1 1460 SVANDSVQQSPPNLVKNKGDSADLVCSHKITSYTMIFWYKQSLGQGFTLLGYTWNKNHFPEDHLSTKISLDGDGTAEAFLTIKDLEASDSTLYFCAAS
Danio rerio V166 ighv CZQB01055060.1 14157 VHCVELTQTDSIVLKPGEVLTLSCKISGYSVTDGSYWTHWIRQAAGKALEWIGQIGANGYTNYNDKLNSRFILTKHTSSNTETLSGQNMQTEDTAVYYCARER
Danio rerio V163 ighv CZQB01055060.1 29319 LYCQGMDSIESSVQKKPGETLTLSCRGSGFSFDCCSMHWIRQQAGKPLVWMGLGYSSGNGHKAESFKERLEISRDDSKSMMYMKLSGLTEEDSAVYYCAKQ
Danio rerio V126 trav CZQB01007439.1 6874 NLFGDTIEPLFPDRHGSEGENVTFSCNYSLTSGTSVNLLWYRQYSGAKPEYLLSVTEYSNSSESDLRLFSNAVKALKRVDLLLSSAAVSDSAVYYCALR
Danio rerio V121 trav CZQB01007439.1 21386 CDSQDKVDQHTKTQSAFEGDTVTTDCTYQTSSTGPTLFWYQQKVSGVPKHMLNKFSTTGNSEEELKKKRFHATLSKTSVPLTIQNLRVQDSAVYYCALK
Danio rerio V86 trav CZQB01007420.1 1487 CRGQNRVEQPSREMTADKGDTVTLPCNYSVTTTNAYLFWYKQLPNRSPTFMLSAFTVGKGTTEDEFKERFNATLDKTLRTVPLLIQDLQVSDSAVYYCALQPTVTQ
Danio rerio V79 trav CZQB01007410.1 10913 CDCAESVDQNTRVETAVEGGSVTINCTYQTSDPSPYLFWYQQKPNTIPKYMMMIFATTVQNDKDFEEERFSAKHDKTLKSVPLLIQDLRVSDSAVYYCALR
Danio rerio V46 trav CZQB01007396.1 27969 TSRQDSITPTSPAVHVKEKEAARISCEYKYTVSMNNLQWYRQYPNAKPEFLVLIMESGQNQTATPPHPRLTTSVNKDKKLVNLEIFPADVKDSAVYYCALQPTVTG
Danio rerio V25 trbv LKPD01026700.1 1157 LSMAVNVIQTPTELFLDTGATLNITCSHNDRSLDKIFWYQQFNGRNLELIGFLSFKQRLVDKKEFTITGDAEKEATLVLSSVKAEHSAVYFCAVSA
Danio rerio V24 trbv LKPD01024207.1 4536 FSHCNKVDQGPSDLIHEQGETAKIRCQHSVSSYNQINWYRQNQDGGFTLMGYLLGTEPYRENDFKDKIDMPGDGNRDGNLTIKVISSNDNAVYFCAAY
Danio rerio V23 trav LKPD01024207.1 1225 FSHSNKVNQSPPGLIQKQGDDAKIRCQHSAGSSYNQINWYRQKQDGGLIFMGYLLGPDKTPEPDFSEKIDMSGNGRSDGTLTIKSLLSADSAMYFCAAYDTVFY
Danio rerio V22 trbv LKPD01019734.1 1923 HTSADTVLQSRRFIAVLPGDNVTLDCSMAAGVSMSSYTMYWYKQVHSGQPIELVIKEYDQAVKNYEATLNNNMFRLIISSLTAQDSGTYFCAA
Danio rerio V21 trgv LKPD01017842.1 79037 QVTLRQKISSTKSQDKTVVIDCDYSSDCRNYIHWYQLKGQTLKRILYAQLSGGEPAKDAGFELFKIDRKQSNIALKIPELKTEHSAVYYCACWVSG
Danio rerio V20 trgv LKPD01017842.1 75262 VEGLSLIQSQKVFVKLTGKTVSFKCEVFGLGSTNFVHWYHKKDGETLKRLLYISYTGTATGEAADYVSEKNGNSYGIKLKEIKEEHAGMYYCAAWDG
Danio rerio V19 trbv LKPD01017842.1 68176 AVLGVTLNQGQKALSKAAGKTLYLPCKVAGLQSWNYIHWYQMRDGEAPSRLLYINEGGAVTYDTNNPQANDFTVDRRKLYDLKLGDAQQKHTAVYFCAYWDSS
Danio rerio V18 trbv LKPD01017842.1 62826 AVGAKLDQGSKALVKAAGKTVYLPCKVTGLESSNYVHWYQVKDGEAPSRLLYISIDGAVVRDDKNPQTNGFTVDKTRLYDLKLSDTQNKHAAVYFCASWEYDSRT
Danio rerio V17 trbv LKPD01017842.1 59945 AVLGVDVDQGPKTLVKAAGKTVYLPCKATGLEYIHWYQVKDGEAPSRLLYISRDGVVTRDNNAQTHDFTVDKTRLYNLKLGDAQQKHAAVYFCAYWDSS
Danio rerio V16 trbv LKPD01014297.1 3471 SVLGKSVIQTPPDLLNKPDEFAEIQCSHSIQNYYVIQWYKQNKSITNLQLMGYLNVDQDTIENDFNGKIKMKGDGRNNVTLTIRDLTVTDSAVYFCAAY
Danio rerio V15 trav LKPD01004610.1 29433 HTEADVIKPLSLDENSHVGDAVTLSCSYKDYTGNMQNLQWYRQFPRSKPEFILYIFESGTMSKDKPDRFSAQVNKGTKQVDLNISPAVETDSAMYYCALV
Danio rerio V14 trav LKPD01004610.1 26028 ADVIKPLSLDENKHVDDTFTLSCSYKDYTDTVRNLQWYRQLPRSKPEFILYIFESGTMSKDKPDRFSAQVNKDSKQVDLNISSALETDSAMYYCALV
Danio rerio V13 trav LKPD01004610.1 4397 TLAQSIRPLQGDVHITERTPVRLSCKYDGSAYSLHWYRQYPGAKPEFLLLVRESAKKSVTYADPKIPGMDGEMSMSEKQVDLEIFSAAVSDSAVYYCALEPTVTG
Danio rerio V12 trav LKPD01003836.1 26401 TSRQDSITPTSPAVHVKEKEAARISCEYKYTVSMNNLQWYRQYPNAKPEFLVLIMESGQNQTATPPHPRLTTSVNKDKKLVNLEIFPADVKDSAVYYCALQPTVTG
Danio rerio V11 trbv LKPD01003836.1 24260 AVRQPTASVSAFTEETITLSCEYYTTDSMPALLWYRQTKNFPPQYILVRHNLGNGSNSKDFPNNRYQSRLDSAMGQVTLTVRNLLLSDSSVYFCALRPTV
Danio rerio V10 trav LKPD01003836.1 21633 GKSDSPITSDQTEVFPRENANVTLSCSYSSAISLHWYRHLPRSAPEFLLLVLQTTGRVQTAQNLDSRFEAMLNEKKNKVHLIISSVKVTDSALYYCAME
Danio rerio V9 trav LKPD01003836.1 10696 NLAKDVITPYSDEIFASETESVKFSCNYTGSVDGLHWYRQYPDSPPHFLILDYYGSITHANPPIAGISIKHRKDNSSVDLEISSVAVSDSAVYYCALQ
Danio rerio V8 trav LKPD01001641.1 40647 TANCVKFEQRLVLFANQTGKAQIDCEHDDSNLVVMLWYRQKTTGMPLDLIGYGYSGSPPNYETGFDEKRFNQARKNPTAGSLTISDLLPSDSAVYYCAAS
Danio rerio V7 trav LKPD01001641.1 35948 KVKCVLVQQNVALFANKSDSAEIKCSHNDSSMLNMLWYQQKDTAAMALIGYKYASGDPSYETAFEGRFELEKTDKLNGTLKISELSQSDSAVYYCAVS
Danio rerio V6 trbv LKPD01001641.1 34854 GFSDAVLITQWPKYISNRLGSSVKMHCYQNDTDYDYKYWYRHIKGEGPVLIGSYVVNSDSNEKGFESGYKLSGTGKKEWTLEVDVKEGTDAVYLCAAS
Danio rerio V5 trbv LKPD01001641.1 25980 FSDGVLITQWPKYISNRLGSSVKMHCYQNDTDYEYKYWYRQIKGDGPVLIGSYNFNSDSNEKGFESGYKLSGTGKKEWTLEVDVKEGTDAVYLCAAS
Danio rerio V4 trbv LKPD01001641.1 22459 GFSDGVLITQWPKYISSLPGFSVDMHCYQNDTDYDYKYWYRQIKGEGPVLIATIIGTSESFEKGFETGFQLPDKETKKWTLKVDVKERADAVYLCAAS
Danio rerio V3 trbv LKPD01001641.1 13045 CVVCSPVIQQSPEHLLRSVEEKQANLSCYHGDNDYPYLYWYQQKSSGGSVELIGMLNYGSATVEDKFKTRFIISGHAKEDAFLVISSMSAEDSAVYFCAAS
Danio rerio V2 trbv LKPD01001641.1 9306 SVVCSPVIQQSPEHLLRTLEEKQTTLSCFGGSTYQYLYWYQQKSSGGSVELIGMLNYGSATVENKFKTRFNISGHAKEDAFLVITSISAEDSAVYFCAAS
Danio rerio V1 trbv LKPD01001641.1 3726 CSLVIQQSPEHLLRSVKEKEANLSCYHGDGSYTFLYWYQQKSSGGSVELIGMLNFGLATVEDKFKTRFIILGHATKDAFLLISSISAEDSAVYFCAAS
Danio rerio V0 trbv LKPD01001641.1 1067 CVVCSPVIQQSPEHLLRSVEEKQANFSCYHGDNNYQLLYWYQQKSSGGSVELIGMLNYGSATVEDKFKTRFIISGYATKDAFLLISSISAEDSAVYFCAAS
Danio rerio V64 ighv LKPD01031523.1 11945 MKCQSMESIESLVQKKPGETLTLSCRGSGFTFSSYSMHWIRQQAGKPLVWIGYTGQNYAESFKGRAEITRDNSKSMTYLKLSGLTAEDSAVYYCARE
Danio rerio V63 ighv LKPD01031523.1 15048 VDLYELTQPESLTVRPDDSLTINCRVSYSVTSEHTAWIRQPAGKALEWIGVIYSFGGLDYKDSLKTKFSITRDTSSNTITLHGKNVKAEDTAVYYCARR
Danio rerio V62 ighv LKPD01031523.1 22424 LYCQGMESIESSVQKKPGETLTLSCRGSGFSFGCCSMHWIRQQAGKPLVWMGLGYSSGNGHKAESFKEWLEISRDDSKSMMYMKLSGLTEEDSAVYYCAKQ
Danio rerio V61 ighv LKPD01031523.1 24794 VRGQNMESISSESVLKPGETLSLSCRGSGFTFGSNNMHWIRQQPGKALMWMGRVWYNAQGHDYANSFKGRIEITRDNSKSMVYLKLSALTEEDSAVYYCARE
Danio rerio V60 igkv LKPD01030582.1 26326 QISVTQSPSMTAEPDQTVTITCRTSTDVFNDGADDFLAWYLQKPGEAPKLLIYWVNRRESGTASRFSGSGSNRDFTMSISGVQTEDAGHYYCLS
Danio rerio V59 trbv LKPD01030577.1 1352 FSQSNKVNQSPPDLIYKQGDDAKIRCQHSVGGNYNQINWYRQNQDLGFTFMGYLLLNGPNPEKEFSKKIDMSGNGQSDGYLTIRRLLYNESAVYFCAAY
Danio rerio V58 ighv LKPD01024818.1 2234 ISGDEIRLDQSPSVTKRPGETVMISCKISGFTMTRYYMHWIRQKPGKALEWIGRVNSGSGSADYADSMKNQFTLSEDVSQNMQYLEAKSLREEDTAVYYCARE
Danio rerio V57 ighv LKPD01024818.1 13167 IDCQVVLTQSERSVNVAPGGFHKLSCACSGFTLRSTNMYWIRQAPGKGLEWIIYYYSDSDKSTAQSVQGRFTASKDSSNLYLHMNQLKTEDTAVYYCA
Danio rerio V56 ighv LKPD01024818.1 14008 CWCQTLTESEAVTIKPGESHKLTCTASSFDISGSWMAWIRQKSGKELEWLAIIRYDSQDMYYFQSVQGRFTISRDNSKQQVYLQMNSLKDEDTAVYYCARE
Danio rerio V55 ighv LKPD01024818.1 16223 VYSQIVLTQSEQSVSVSPSGSVKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHFYTDSDNGAAQSVQGRFTASKDSSNFYLHMNQLKSEDTAVYYCARE
Danio rerio V53 trav LKPD01020749.1 9201 VFADSIAPKKEGRNKTRKEGESVTLSCTFNRSDTAISLYWYMQYPNRELQYLLYKGHRSSEEGIVTDSRYKSTVSPTSTSLTINSVNLSDSALYYCALKKG
Danio rerio V52 trav LKPD01006528.1 5048 SSATEAITPYRAYEFAFKDDRVILSCNYTGSARGLHWYRQYPGLPPHFLILDYYGAVTHAKPPIAGISIKHRKDDSSVDLEISSAAVSDSALYYCALE
Danio rerio V51 trav LKPD01006528.1 14312 VTFGNDITPVQTEVFGAEMDNITVSCKYSSAVSLQWYRQYPGSAPDFLLTIHRTGSVSRSSTIVNEDPWYYGKLNKEKTHVFLEISTAKVSDSAVYYCALQ
Danio rerio V50 trav LKPD01006528.1 18207 SVYQPKTLQSANEEDAAVTLDCKYSTSSSNPTLLWYRQDDYGSPKYILLRYKFGDGDEATEFKGRFGSRLDSASKSVPLTIQHPHASDSAVYFCALL
Danio rerio V49 trav LKPD01006528.1 19766 EEIIFPNNKTVIAKADEKVLLSCSYTGTVYDLYWYRQSPGSAPQFLIMESSGVIIHATPQVPGIKIINKKNTKHVELEIFSASVEHSAVYYCAARPTVKG
Danio rerio V48 trav LKPD01006528.1 22443 QDSVTQTATVQTATEGQAVTIECTYKTNAFPTLYWYQYKANQFPKYMLKRYAGSSDEDDNFKDRFNANLNSSSTSVPLTITDVRVSDSAVYYCALQ
Danio rerio V47 trdv LKPD01071629.1 777 SVANGSVKQSPSNLIKTKGDSVNLECGHSTTYTMIFWYKQSLGHGFTLLGYTWNKNSFPEDNLSKRISLDGDGTVKAFLRIKDLEASDSTLYYCAAS
Danio rerio V46 trav LKPD01067176.1 5494 EKEDKTVHQNPLNLIIDHGDSPEIKCFHKITGYDRLLWYKQSQNKELTFMGYLIGDSGNPEKPFENKITIQGNANKLHGSLTLINATAESDSVYFCAAYYTV
Danio rerio V45 trav LKPD01063455.1 11796 SVNQPDTHVTKSEDGAVTLQCKYTATSTATPELYWYIQREHEIPKYILRKNKYEGENGTEFHKRFHVELTTDSVPLLIKDLRVSDSAVYYCALK
Danio rerio V44 trav LKPD01063455.1 7807 SVDQPDRELTSAEGNEVILLCNYKLMSAANAYLYWYKQLPDTSPAFILSEFSIGKGKAEPEFKDRFSAKLDSKLETVPLTIKDVRVSDSAVYYCALQPTVTQ
Danio rerio V43 trav LKPD01063455.1 3217 CRAQDRVEQPTRKKTENEGDQITLMCNYTTTSTNADVYLFWYKQLPDRSPTFILNKFPFSEGTIEPEFNKRFSAKLNSTLRTVPLLIQDLRVSDSAVYYCALR
Danio rerio V42 ighv LKPD01060737.1 4189 AHGQSLTSSGSEVKKPRESVTLSCVVSGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFTITKDTSKNMVYLEIKSLKAEDTAVYYCARETQ
Danio rerio V41 ighv LKPD01058648.1 475 QTLTESESVVIKPGNEHRLTCTFSGIDVGDADISWIRQTEGKALEWISHISAPSGSGKYYSKAVEGRFSITRDNSKMQVYLHMTKLQTEDTGVYYCARR
Danio rerio V40 trgv LKPD01057627.1 6960 NSSIIQTPSDLLANNTESVSLYCSHSSSAFNVILWYKQLLNGEMQLMGHLYRTNNNTETLFTDKIELLGNGASSSSLKLKTLSSKDNAIYYCAAR
Danio rerio V39 trav LKPD01057627.1 3460 VVFSDKVHQSPNAILWSPERRAEINCRHDISTYDTLQWYQQTDNTLKLIGYVYYEQRTIENAFEKRFNVSGHGKTHSTLHLLQLRSPEDSAVYYCAAY
Danio rerio V38 ighv LKPD01055364.1 7749 GVYCVELTQPSSMVVKPQESFSISCRISVSSYCIHWIRQSAGRPLEWLGYLCSSGGTIIKDSVKNKISFTQDTSKNTVFLQGRNFQTEDTAVYYCARE
Danio rerio V37 ighv LKPD01055364.1 2305 VNSFELTQPESLTVRPDDSLTINCKVSYSVTSEHTAWIRQPAGKALEWIGVIYYDGSLAYKDSLKSKFSISRDTSSNTITLQGKNVKAEDTAVYYCPRR
Danio rerio V36 ighv LKPD01055364.1 1077 QRKPGETLTLSCRGSGFTFSCCSMHWIRQQAGKPLVWIGRVYDSTDYSYAESFQRRAEITRDNSKSMTYLKLSGLTAEDSAVYYCAKHSQ
Danio rerio V35 trav LKPD01046758.1 14148 VVNGNVITPARTSVVLTEGSNITLSCTFNTSPYRLLWYRQTPGSRPEFLLLIVRSTKTTIEASPPQPHMSINLSEKLVDLEISSVAVSDSAVYYCALE
Danio rerio V34 trav LKPD01046758.1 5068 DSNGDIIRPEQTSVVVTDGSSITLSCTYDESAYSLHWYRQTPGSRPEFLLLIDESSKYVTKAEQPHPHMSIQLQNNKRVNLILSFAAVSDSAVYYCALQ
Danio rerio V33 trav LKPD01041982.1 2239 CRGQNRVEQPSREMTADKGDTVTLPCNYSVTTTNAYLFWYKQLPNRSPTFMLSAFTVGKGTTEDEFKERFNATLDKTLRTVPLLIQDLQVSDSAVYYCALQPTVTQ
Danio rerio V32 trav LKPD01037759.1 29865 RVDQPDKQLTEAEGGSVTLQCKYKTDSVQENLFWYIQRTNDLPKYILRRSKYGGENGTEFQERFHSELSTNSVPLTIRDLHVSDSAVYYCALK
Danio rerio V31 trav LKPD01037759.1 24804 CDSQDKVDQHTKTQSAFEGDTVTIDCTYQTSYTGPTLFWYQQKVNGVPKYMLNKITTTGHTEEEFKERFHATLSKTSVPLTIQDVRVSDSAVYYCALR
Danio rerio V30 trav LKPD01037759.1 1667 KVQQPSGEKTENEGDQVNLMCNYTTTASDTNIYLFWYKQLPNRSPTFILNKSPFSEGTIEPEFNKRLSATLNSTSKTVRLLIQDLRVSDSAVFYCALR
Danio rerio V29 igkv LKPD01036770.1 52526 SHQEVQSPESLSVKAGDSASISCTGTSGVDNDMSWYLQKPGKAPKLLIYGVSYLESGVSDRFSGSGSEPAFTLNIRGVQPEDAGVYYCMGYYSGGR
Danio rerio V28 trav LKPD01032885.1 46938 IESQDNVEQKARVQTAVEGEAVEIDCTYQTQLTPTLFWYQQKTNTIPKYMLNRVGKTGGEDKEFKERFTANLNTFSKSVPLMIRDLHVSDSAVYYCALQ
Danio rerio V27 trav LKPD01032885.1 40075 QDNVIQPKQVMTAYEDGTITLECTYKASSTQYPNLLWYQQMTNGSPKYMLMRLSGSSDTNEEFKQRFNAELNTSALSIPLTIKDLRASDSAVYYCALK
Danio rerio V26 igkv LKPD01031608.1 2092 KVTQSPSEKTIEGGQSVTLMCSSNLDVGKWCNDTYCLSWYLIKAGEAPKLLIYQGNLRHSSAPSRFSGNGSVRSFQLTISGARGEDSGLYFCFGDYGGFR
Danio rerio V93 trav LKPD01059790.1 4117 NVEQPSGQITANEADSVHLQCSYSTTFTNAYLFWYKQLPNRSPTFILSEFTIGEGTTEDEFKGRFSATLNSTLKSVPLLIQDLRASDSAVYYCALR
Danio rerio V92 trbv LKPD01052650.1 42088 AKDVTQTPVLWAPMGVNATMNCNHSYPSTYFYMYWFRQRQGETMKLIAFTMLNNKPDFGEFSEDKYSATKTEAQRGSFTVKKLQADDSGVYLCAVSEHS
Danio rerio V91 trgv LKPD01052454.1 247 CWCQTLTESEAAVIKHGESHRLTCTVSGFSDDPYLAWIRQTAGGGLEWLAYISSSGSTTYYSQSVQGRFTISRDNSKKQMYLQMNNMKSEDTAVYYCAR
Danio rerio V90 ighv LKPD01052454.1 4297 VYSQIVLTQSEQSVSVSPNGSVKLTCACSGFTLSSYWMFWIRQTPGKGLELILNYLSDSDKSSAQSVQGRFTASKDSSNFYLHMNQLKTEDTGVYYCAT
Danio rerio V89 trgv LKPD01047665.1 13026 YGNIIQPDTVVSFQEGETAVLRCFITNSQMSMTLWYKQVTGEEPRLIASSILRSSEIQFHNEFDSSHFEVLRDTGGFNLKIVNAVQSDSGTYYCATSFSNVIEFGN
Danio rerio V88 igkv LKPD01047665.1 32898 GVQSNHSAEIVSLQTFKLGDDVIIKCFSTKISLGDTLVWYKQSTGQIPRAITISYIKLNNVIFKDEFKDGRFSILSSEDSFHLYITAATKQDTGIYYC
Danio rerio V87 trav LKPD01047622.1 5096 ASSEDTITADKTEEFADDGSNVTLSCTFSSAWSLLWYRQYPGSAPEFLVNIAERSKKVERSNTDHRFTTKIRIEKEKHVDLLLSPAAVSDSAVYYCALTSM
Danio rerio V86 trav LKPD01041850.1 2465 QQPSGEMTENEGDQVSLMCNYTTTASDGNIFLFWYKQLSNRSPTFILNKIPFSEGTIEPEFNKRFTAKLNSTLRTVPLLIQDLRVSDSAVYYCALKPTVTQ
Danio rerio V85 trav LKPD01039396.1 1914 ACFAKTVLQSPDDLIKNQNESAVILCAHSISGYDRILWYKKDIMDFEFMGYLNLNFDNPESDFKTKITLDGDGRNNGSLTVKNLTLTDSAVYFCAAYNTV
Danio rerio V84 trav LKPD01039396.1 4112 ACLGKTVLQSPGDLIKNQAESAVIVCTHNIQSYDRVLWYKQTQNTKDFEYIGYRLYSSDQLESEFVKKVELNGDGSKNVTITFKNLTATDSAVYFCAA
Danio rerio V83 trbv LKPD01039396.1 7694 ACLGETVHQTPDYFIKKRSESAVITCTHNIQNYNRILWYKQSADRFGFKLMGYLSFNDENKELGFDNIKLKGDAKSNGTLTIENLTVTDSTVYFCAAYYTV
Danio rerio V82 trav LKPD01032744.1 3257 SVSGNLIKPIQTDVFADEGSNVTLSCSYSSADYLFWYRQYPRGAPEFLVSIFEGERNSKSSDVDPRLSAKLTKSEHNHADLMLSCAAVSDSAVYYCALR
Danio rerio V81 trav LKPD01032744.1 6111 VAYGNEIKPVKTEEFAKEDSSVTLSCSYSSARTLFWYRQYPGLAPQFLVFFIHGTSEAKESGVDPRFTAKPNGEKQSHVDLLLSSAAVSDSALYYCAME
Danio rerio V80 trav LKPD01032744.1 10950 FVSPDSVEQKTRVQTAVEGESVTINCTYSTTDTFPYLFWYQQQVNGIPQYMLKKFPGSGEIENQFKKRFDADLDSSTTSVLLRIKEVHVSDSAVYYCALK
Danio rerio V79 trav LKPD01032744.1 14079 CDSQDKVDQHTKTQSAFEGDTVTTDCTYQTSSTGPTLFWYQQKVSGVPKHMLNKFSTTGNSEEELKKKRFHATLSKTSVPLTIQNLRVQDSAVYYCALK
Danio rerio V78 trav LKPD01032744.1 25439 SVLGNDIKPNITDVVYEEGSDGTIFCSHSPGAGDYIYWYRQYGGSKPEFLVLIFGSTKDTETSKVDPRFSVTVEKKERNHADLLLSSAAVSDSAVYYCALQ
Danio rerio V77 igkv LKPD01032688.1 4936 QLSVTQTPSAAAPAGQTVTINCQTSRGIGDRTHGCGSCLSWYLQKPGEAPKLLIYSIRSLQSGTPARFSGSGEYYGTDFTLTISGVQTEDAGHYYCMG
Danio rerio V76 trav LKPD01032322.1 1570 SVANDSVQQSPPNLVKNKGDSADLVCSHKITSYTMIFWYKQSLGQGFTLLGYTWNKNHFPEDHLSTKISLDGDGTAEAFLTIKDLEASDSTLYFCAAS
Danio rerio V75 trbv LKPD01032322.1 4632 VCLGETVHQTPGNFIKTRSESAVITCSHKIQNYDRMLWYKQDTLGLKLMGYLFLDQTKEPEFENKIHLEGDAKKNGTLTIKNLTGNDSAVYFCAAYYTQ
Danio rerio V74 trdv LKPD01032322.1 7208 TAGDDGVLQYPKILWSTKENYAEMNCTHNKGSSYYQMYWYRQRPGETMRLIVFTMENSKPDFGDFDEKKYDASKEDPTSGSLTVKNLEPEDSAIYFCSVS
Danio rerio V73 trav LKPD01032306.1 6260 ATYADEIKPVKTEVFADEGSNVTLSCTYSSANNLQWYRQYPGSAPQYLVLIPDSSKEDWKSNVDDRFTARVTKNKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio V72 trav LKPD01032306.1 13363 CRGQDKVEQPIREITEGEGAHVFVQCNYTSSNPTLFWYKQLPNRSPTLILSQYSAEADKKRFSATLNSKEKSFPLLIQDLQVSDSAVYYCALE
Danio rerio V71 trav LKPD01032306.1 14388 AIYADEIKPVKSEEFADGGSNVTLSCTYSSAYYLYWYRQYPGSAPQHIVLIPESRKDDTKSDVDHRFIARVTKDKEKRVDLLLSSAAVSDSAVYYCALE
Danio rerio V70 trav LKPD01032133.1 2756 CLICEKVHQAPPDVLCKPDDSVELTCSHNIDNYDTILWYQKSKGDSSLKLIGYARYSSAKDIEKSYMGHFNVTGNGEEEATLRILKARLDQDSAEYFCAASY
Danio rerio V69 trav LKPD01032133.1 5635 CLICKKVHQSPPDVLCKPDDSVELTCSHNIDNYDTILWYQKSKGDSSLKLIGYAQYSSVKKFEDPYDGHFSLNGSGEKEVTLKFLKARLDQDSAEYFCAAFYAQ
Danio rerio V68 trbv LKPD01032133.1 9226 CSLFSSVEQTPALLIVRSGESCNISCSHGITSYNTILWYYQHEDGQGMHSIGYSFHSSHTLENVEDKRYELNGDGKSSVTLIISKLLLNDSAVYFCAAS
Danio rerio V67 ighv LKPD01031523.1 1438 IKCESMESIESSVQKKPGETLTLSCRGSGFSFSSYYMHWIRQQAGKPLVWIGGTGYGYAESFKGRAEITKDNSKSMTYLKLSGLTAEDSAVYYCARQ
Danio rerio V94 trav LKPD01059790.1 248 CKCKDSVHQKRVETAVEGTDLFISCSYTSTDPIPTLFWYQQKVNEFPKYMLSTFESKDDEFKKRFNARLNTSSTSAPLLIQDLRVSDSAVYYCALK
Danio rerio V66 ighv LKPD01031523.1 5354 VNGQSLESIPSSSVTKKPGETLNLSCKGSGFDFGQYGMQWIRQPAGKALDWIGVIWSDGSKTVYAKSVEGRIEITRDNSNNMVYLKLSGLKTEDSAVYYCAR
Danio rerio V65 ighv LKPD01031523.1 7096 VHCVELTQTDSIVLKPGEVLTLSCKISGYSVTDGSYWTHWIRQAAGKALEWIGQIGANGYTNYNDKLNSRFILTKHTSSNTETLSGQDMQTEDTAVYYCARER
Danio rerio V54 ighv LKPD01024818.1 17057 YFCIELDQQSVMEVKPKETFTIACKITGYSASGGGYTNWIRHAAGKPMEWIGYFHTSSNNGVKDSLNNKISFSSESSSNAVILTGKNFNTEDTAVYYCARD