WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Orcinus orca ANOL00000000.2 (ANOL02) 64 24 13 2 11 11 2 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Orcinus orca V22 trgv ANOL02003608.1 135366 HLEQPQLSTTKKLSKTARLECMVSGVTISKTSVYWYQERPGEAIQHLLHILPNNTVRRESDATLGKFEADKKPETSTSTLTIHNVQEQDAATYYCALWE
Orcinus orca V23 trgv ANOL02003608.1 149254 GLGQLKWEQPEISVTGVRDKSVVISCKVSSQDFSNEYIHWYRHKPNQGIEHLAYVVTVPALKDLGGKKNKIEARKDVPTSTSTLNIRFLQKEDEATYYCAWWAY
Orcinus orca V189 trbv ANOL02032430.1 21617 VRAQTIHQWPLIRVQPAGSPLSLECTVKGTPNPRLYWYRQEAGGALQLLYYSISSDQIDAEKPQNFEASRPREDLFILSSKKLLPSNSGFYLCAWN
Orcinus orca V209 trav ANOL02034624.1 87090 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Orcinus orca V220 trav ANOL02036758.1 3369 VSLGEKMEQSPSTLTVQEGNSSVITCTYTDSALDYFLWYKKEPGKGPQLLIDIRSNKNKKEHQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCAAS
Orcinus orca V221 trav ANOL02036765.1 1702 GTNGDSVNQTEGPVTVSEGAPRTLHCTYQTSGSNIYLFWYVQYLNKAPQLLLKGSKANRRAEHQGFQATLVTSDSSFHLQKPSMQASDSAVYYCALS
Orcinus orca V301 ighv ANOL02051376.1 7493 WPRTGEALTDPVPHLCRLRGLCNQQLLLELDLPTPWGRVGVDGVLDREYKLQPAFQGRISITADTSKNQFSLQLSSVTTEDTAVYYCARDSERKSV
Orcinus orca V433 ighv ANOL02076924.1 10770 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSNSVAWVRQPPGKGLEWVGNMWYDGDTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V434 ighv ANOL02076924.1 18940 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFDDYAMSWVRQAPGKGLEWISGINWNGGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V435 ighv ANOL02076926.1 5450 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWISGISSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V436 ighv ANOL02076926.1 11143 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSSYVAWVRQAPGKGLEWVGAMSYSGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAG
Orcinus orca V437 ighv ANOL02076927.1 1556 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFDDYAMSWVRQAPGKGLEWISGISWNGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V438 ighv ANOL02076929.1 3408 ALSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSDGVAWVRQPPGKGLEWVGGINSYESTYYNPALKSRLSITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V439 ighv ANOL02076930.1 7025 VLSQVQLQESGPSLVKPSQTLCLTCTVSGFSLTSYAVAWVRQPPGKGLEWVGGINTGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTALYYCAR
Orcinus orca V440 ighv ANOL02076931.1 3269 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSSAVAWVRQPPGKGLEWVGVIYRGGSTDYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAG
Orcinus orca V441 ighv ANOL02076932.1 1271 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFDHYAMSWVRQAPGKGLEWISVISWDGDSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V442 ighv ANOL02076935.1 3547 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSDSVSWVRQPPGKGLERVGIMWNDGDTNYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTALYYCAR
Orcinus orca V443 ighv ANOL02076936.1 2603 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPAKGLEWISGISSGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V444 ighv ANOL02076936.1 5449 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSSAVAWVRQPPGKGLEWVGVMGSGGSTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V449 ighv ANOL02077497.1 3183 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSSAVAWVRQAPGKGLEWVGWIYGGGSTDYNPTLKSRLSITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V450 ighv ANOL02077499.1 11301 AAGGSGGGLVKPGRSLRLSCAASGFTFSSYGMSWVRQAPAKGLEWISGISSSGGNTNYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCANG
Orcinus orca V451 ighv ANOL02077499.1 17854 ALSQEQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVAWVRQTPGEGLELVGVMWGGGSTDYNPTLKSRLSITTDTSKSQVYLSLSSLTTEDTAVYYCGT
Orcinus orca V452 ighv ANOL02077499.1 28172 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWISGISSSGGSTYYADSVKGRFTISRDNCKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V453 ighv ANOL02077499.1 31746 VLSQVHLQESGPGLVKPQQTLSLTCAVSGFSITTSGYCWSWVRQPPRKDLEWMGIICYNGATAYNPSLKSHTSISSDTSKNQYSLQLSSVITEDTATYYCAR
Orcinus orca V454 ighv ANOL02077499.1 37711 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVAWVRQPPGKGLEWVGGIYGGGSAYYNPTLKSRLSITTDTSKSQVYLSLSSLTTEDTAVYYCAT
Orcinus orca V455 ighv ANOL02077502.1 4358 ALSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVAWVRQPPGKGLEWVGNMWNDGDTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V456 ighv ANOL02077505.1 3370 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFDDYAMSWVRQAPGKGLEWISVISWDGGSTYYADAVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V457 iglv ANOL02077678.1 348 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSYVGWYQQLPGMAPKTLIYDDNERPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSDSSSSP
Orcinus orca V458 iglv ANOL02077679.1 497 SWAQSVPTQPPSVSGNLRQTVTISCTGTSSYVSWYQQLPGMAPKTLIYNNNNRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Orcinus orca V459 iglv ANOL02077682.1 2689 SWAQSGPTQPPSVSGNLRQTVTISCAGTSSYVGWYQQLPGMAPKTLIYNNNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEAVYYCSSYESS
Orcinus orca V460 iglv ANOL02077685.1 865 SWAQSGPTQPPSVSGNLRQTVTISCAGTSSYVGWYQQLPGMAPKTLIYNNNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEAVYYCSSYESS
Orcinus orca V461 trav ANOL02077774.1 1741 GTNGDSVNQTEGPVTVSEGAPRTLHCTYQTSGLDPYFFWYVQYLNKAPQLLLMGSKAKQRAEHQGFQATLVTSDSSFHLQKTSMQASDSAVYYCALS
Orcinus orca V462 trav ANOL02077797.1 1276 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESNYYLLWYKQPPSGEMIFIIGQEAYKQQNATNSRYSVNFQKEAKSFRLRISDSQLEDAAKYFCAYSG
Orcinus orca V463 trav ANOL02077933.1 2191 GAGAQSVTQPDGHITVSEGDHLELRCNYSSSVSPSLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRRSEKSFHLRKTSAHWKDSAKYFCALS
Orcinus orca V480 ighv ANOL02001144.1 20515 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLSSSSVAWVRQPPGKGLEWVGGINTGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Orcinus orca V481 ighv ANOL02001146.1 3050 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWISAISSSGGYTNYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V482 ighv ANOL02001148.1 5821 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSSYGMSWVRQAPAKGLEWISGISSSGGSTNYADSVKGRITISRDNSRNTLYLQMNSLRSEDTAVYYCAKD
Orcinus orca V665 trbv ANOL02032432.1 40248 GSGLSALVSQHPSRAICKSGASVTIQCRSETLQATTVYWYHQFPKQGLVLMATSNRGSDATYEQGYTEDKYPVSHPNATFSSLMVTNVHPADSSLYFCGFR
Orcinus orca V666 trbv ANOL02032432.1 27734 PMDAEIYQVRFLLAEAGWNVTLECKQNLTYNSMYWYRQDPGQGLRLIYYSAVVKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCSGS
Orcinus orca V667 trbv ANOL02032432.1 22195 SMDVGITQTPRNRIANTGKSTVLECSQTKGHESMYWYRQDPGLGLRQIYYSHGVDDINKGDVSDGYRVSRKEQAKFSLFLEPATPNQTALYFCASSI
Orcinus orca V668 trbv ANOL02032432.1 13522 LKDAVVTQFPRHKISKTGKELTLQCSQKQNHYSMYWYRQDPGFGLRLIYYSTGTNTTEKGDVPEGYRVSRNELEYFPLTLKSASTSQTSVYFCASSE
Orcinus orca V669 trbv ANOL02032432.1 4836 PLKADVTQSPRHQITETRKRVTLTCSQNMQHDAMYWYRQDPGLGLRLIYFSRNIDLVEKGDVPNGYIVSREKKPDFPLTLASASTNQTSLYLCASSL
Orcinus orca V670 trbv ANOL02032433.1 25024 LSITGPVEAGITQKPRHKITVTGETVTLECHQTDKHDYMYWYRQDLGHGLRLIHYSLGVGNIEKGEIPDGYNVSRSNTEDFPLTLESVIPSRTSVYFCASSD
Orcinus orca V671 trbv ANOL02032433.1 11003 PTDAGVIQTPRHEVTEMGHAVTLSCEPISGHTVLYWYRQTLVQGLEFLIYFINQSPTDKSGMPKDRFSAEMPNKSFSTLKIQPTEPGDSATYLCASRK
Orcinus orca V672 trbv ANOL02032434.1 27625 ASADTEITQIPKYLIMETRNKKSLRCEQRLGHNAMYWYKQRAQKPPELMFIYNYKELAGNETVPSRFRPECPDGSRIYLHVDTLKLEDSALYLCASSK
Orcinus orca V673 trbv ANOL02032434.1 12126 PGNAGVTQDPKFRVLRTGQSTTLKCAQDLDHYYMYWYRQDLGHGLRLIHYSTDTGNINKGDVPNGYSVSRSNLENFPLTLEAATHSQTSVYLCASSY
Orcinus orca V674 trbv ANOL02032434.1 7608 GPMDAAVTQKPRYHIIRAGSKMVLDCSQDMNHVGMFWYRQDLGQGLRLIHYSNGVGSTGEGDVTEGYSVSRKKNEHFPLTLEPASTKQTSLYLCASSE
Orcinus orca V742 iglv ANOL02042298.1 11839 SVASYELTQPPLVSVALGQTSKITCSGDLLDKKYTYWYQQKPGQAPVLVIYEDSKRPSGIPDRFSGSSSGKIATLMISRAQAEDEADYYCESADSSDY
Orcinus orca V743 iglv ANOL02042298.1 9349 LCAVPVLTQTPSASSSLGGSAKLTCTLSSEHSTYYIEWYQQRVGQAPRYLMKLTSDGSVTKGDGILDRFSGSSSGADRYLTIANIQSEDETEYICGVSY
Orcinus orca V744 iglv ANOL02042298.1 5870 SVASSALTQPPAVSVSLGQTARITCQGDSLGSYDAQWYQQKPGQAAMLVIYGDSNLESGVPDRFSGSKSGKIATLTISRAQAEDEADYYCGSADSSGY
Orcinus orca V874 trdv ANOL02066598.1 30504 VMSAVTLVPQNQARSVSVGESVTLRCSMKGESISNYYTFWYRKTPGNTMTLIYREGGTYGPGFEDNFQGEIDFLNNQAVLNILEASERDEGSYYCAS
Orcinus orca V875 trav ANOL02066600.1 71356 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSDYYLLWYKQPPRGEMIFIIGQEAYKQQNATNSHYSVNFQKEAKSFRLSISDSQLEDAAMYFCTYSG
Orcinus orca V876 trav ANOL02066600.1 25792 VSGKNDVEQSPRYLSALEGDFVTINCSYSEEMTTLQWFQQNPGRGVVSLFILSLEMKKKGRVSATINRKERHSSLHISASQPRDSATYFCAVE
Orcinus orca V892 iglv ANOL02069477.1 6306 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNYVSWYQQLPGTAPKTLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSDSSSSP
Orcinus orca V893 iglv ANOL02069477.1 458 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNQVGWYQQLPGMAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSGTSS
Orcinus orca V894 iglv ANOL02069481.1 93951 ALAQPVLTQPPSLSSNLGASARLTCTLSSGFNVGNFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFTGSNDASTNAGILLISGLQPEDEADYYCAT
Orcinus orca V895 iglv ANOL02069481.1 87265 SWAQSRLTQEGSMSGSVGQTVTHSCTGNGNNVGANIVNWYQQIFHGAPKTAMLAGSLPSGIPDLCSGSTSVNTASLTISRLQPEDKADYYCSTWDDSISG
Orcinus orca V896 iglv ANOL02069481.1 72112 CLSQPVLTQPPSLSASPGASARLTCTLSSGYIVGGYHIVWYQQKPGSSPRYLLRFKSDSDKHQGSGVPSRFSGSKDASANSGLLLISALQPEDEADYYCAT
Orcinus orca V897 iglv ANOL02069481.1 69363 SWAQAVLTQPCSVSGALGQRVTISCTGSSSNIGSNYVSWYQQDPGMAPRLLIYDNSKRPSGVLDRFSGSKSGNSGSLTITGLQAEDEADYYCQSYDDSLD
Orcinus orca V932 igkv ANOL02074755.1 103111 CWGQITLTQTPETLAASQGSFVSITCKSSVEVGTSMAWYQQKPKEPPRLLIFGASARASGTPSRFQGSGSGFDFSLAIHGVEAEDVGVYYCQ
Orcinus orca V933 igkv ANOL02074758.1 10952 SNGDIVLTQTPLSLSVIPGDPASISCRSSQSLQDSDGDTYLNWYLQKPGQSPQLLIYGASNRASGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQDMEDL
Orcinus orca V942 trav ANOL02077271.1 468 QTREDSVTQMDGQMTLPEGAALTINCTYSAPGYPITFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATHQKESKSFHLEKASVQDSDSAAYYCALS
Orcinus orca V943 trav ANOL02077672.1 347 GTNGDSVNQTEGPVTVSEGAPRTLHCTYQTSDPGPYLFWYVQYLNKAPQLLLKGSKANRRAEHQGFQATLVTSDSSFHLQKPSLQASDSAVYYCALS
Orcinus orca V944 trav ANOL02077675.1 2062 VNSQQGEENLQALSIQEGENATMNCSYKTAIDTLHWYRQDSRRGFAHLILIRSNEREKLSGRLRVTLDNSIKGSSLSITASQAADTATYLCATD