WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Capreolus capreolus CCMK000000000.1 (CCMK01) 102 2 11 7 32 26 8 16
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Capreolus capreolus V0 trbv CCMK010000397.1 11078 HMGALVIQNPRYLVTGMGKPVNLSCSQNMKHDVMYWYQQKPSQAPKLLLYYYDRQITREKNTSENFQSSQPNTSFCSLDIRSAGLGDSAVYLCASSR
Capreolus capreolus V1 trbv CCMK010000397.1 15678 FLEAEVTQTPGHLVQGKGLDVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCPSNSPCTLKIQATEPQDSAMYFCASSD
Capreolus capreolus V22 igkv CCMK010009833.1 416 SSGDIVLTQTPLSLSVTPGETVSISCKSTQSLKDSDGKTYLRWFQHKPGQSPQSLIYEISNRDDGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQATYVP
Capreolus capreolus V29 trbv CCMK010014514.1 18 SGLGALVSQQPRRAVRKSGDSVTIQCRTVDFQATTVFWYRQLPKQGFVLMATSNEGANATYEQGYNKDKLPISQPNLTFSSLTVTSVDPADSSLYFCGAR
Capreolus capreolus V30 trbv CCMK010014514.1 6919 SMDTEVTQSPGHLVKGKDQKAKMDCVPKKGHSYVYWYRKRPEEAIEFLVNFQNQDIVKDTEVFKQRFSAECPKNSPCSLEINSTEAADSALYFCASSQ
Capreolus capreolus V47 ighv CCMK010026706.1 14358 VLSQVQQQELGPELVKPSLTLSLTCADSGYSTASGYAWNWIHQAPGKGLEWMGCINYDGSTYYSPSIKSCTSISRDTSKSQSSLQLSAVTPEDTAVYYCAR
Capreolus capreolus V58 trav CCMK010031775.1 1970 QTRGNSVTQMDGQVTFSEGTSVTVNCTYSTSGYRALFWYVQYPGEGPQLLLKATKANEKGSHKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Capreolus capreolus V78 trdv CCMK010044451.1 434 SGVAQKVTQDQPDITSQIGQSVILNCRYEVSWSGYTHYLFWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Capreolus capreolus V108 trbv CCMK010064246.1 13084 VSAQTIHQWPPTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQLLFYSVSAEDIDPREFQNFEASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Capreolus capreolus V130 trav CCMK010081027.1 5205 QVKQSPQSLTVQEGEISILNCSYEKSIFDYFPWYWQYPGKGPAFLIAIRSVVNEMEDGRLTIFLNKSAKQLSLHIATSQPEDSAIYFCAANAQCSP
Capreolus capreolus V138 iglv CCMK010083833.1 1094 SWAQDVLTQRSSESGSLGQRVTISCSGSSSNIGGDGVSWCQQLPGKAPRFLIYGDDTRALEVPDPISGSKSGDSASLTITLLQGEDEADYYCGLTMTAWV
Capreolus capreolus V160 iglv CCMK010107845.1 526 VDAQTVVQEPALSVSPGGTVTLTCGLSSGSVTSSNYPSWFQQTPGQAPRTVIYSTNSRPSGIPDRFSGSISGNKAALTITGAQPEDEAVYYCGLGSSSYN
Capreolus capreolus V170 trav CCMK010113256.1 860 SAGKGVEQPTELMAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLSRFDAHSYLLLKELHMKDFASYLCAVI
Capreolus capreolus V172 trbv CCMK010113997.1 21999 IPADPAITQIPKYLVMGMMDRKSLKCEQQLGHNAMYWYKQNAQKPPELMFIYNYKELAENASVPSRFQPRCPESSQCLLDLNALKPQDSAVYLCASSR
Capreolus capreolus V188 trav CCMK010126841.1 2212 VLGDSKTTQPNSVEGAEEEPVHLPCNHFKISGNEYVYWYQQIPHQGPEYLIHGLNKNVTNRMTSLSIAKDRKSSILVLPQLTVRDTAVYYCILR
Capreolus capreolus V192 trav CCMK010130292.1 1411 MNGQQIKHFPEFLLLQEGENFTTYCNFSSNFYNLQWYKQRPGSSPVLLMILAKSGEVKTQQRLTVRFGESRQHSSLHLTTAQPSDVGTYFCAA
Capreolus capreolus V205 trdv CCMK010147296.1 2863 SGVAQKVTQDQPDVSRQVGQSVTLNCRYETSWTAYYLFWYKQLPSGQMTYIIRQGSLVSNARKDRYSVNFKKEDKSISLTISALQLEDSAKYFCALCE
Capreolus capreolus V219 trdv CCMK010166767.1 2351 SGVAQKVIQDQPDVSSQVGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSFNLTISALQLEDSAKYFCALSE
Capreolus capreolus V224 trav CCMK010172561.1 1865 VNGQQISQIPQFLRLQEGENFTTYCNSSSILTNLQWYKQSPGGSPVLLMILDKGGEVKTEQRRTGRFGETRKHSSLHLAAAQLSDVGTYFCA
Capreolus capreolus V228 trav CCMK010175095.1 2354 GVRAVKVEQSPLVLNLQEGANCTLRCNFSATVSSVQWFQQNPGGSLTRLFFIASGMKQNERLSSTVNSKELYSTLHITASQLEDTATYLCAVE
Capreolus capreolus V240 trgv CCMK010183059.1 21416 HLEQPQISSTRKLSKTAHMECMISGVTISTTSVYWYQERPSQAIQHLLHIFSNNTVKRESGILLSKFEAHMTPETSTSTLTVHNVQEQDSATYYCALWD
Capreolus capreolus V242 trav CCMK010183973.1 3323 GSNGDSVTQQKGQVTLLEGESLSVNCSYKTKQYPALSWYVQYSGEGPKLFLRAHRDNEKGSSKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Capreolus capreolus V283 trav CCMK010225757.1 1575 VQGMDVAQSPPALSLQEGASPTLRCNFSTTPDNVQWYLQNPGGRLIRLFYIPSGTKQDGRLNATTVPKERRSSLHISSSRTTDSGYYFCAVQHGAPQ
Capreolus capreolus V284 trdv CCMK010225757.1 14033 SGVAQKVTQDQPYITSQIGQSVILNCRYELGRSEYTHYLFWYKQLPSGEMTFLIRQESSGRDARNGRYSVNFQRAQNNISLTISALQLADSAKYFCAVLE
Capreolus capreolus V292 trav CCMK010241268.1 2576 VSLGNEVEQSPSTLSVQEGNTAVITCTYTDTASEYFPWNKQEPGKGPQLLVAICSNMGEKKDQRLTVLLNKTAKCLSLHIATIQPGDSAAYFCAAR
Capreolus capreolus V297 trbv CCMK010249149.1 509 GLVDSRVTQTPKYLIKSRKQQATLRCSPESGHRSVYWYQQALGQGPQFLIQYYDGEEYQKGNISDRFAVKQLSGSRSELSLTPLELTDSALYLCASSQ
Capreolus capreolus V305 trdv CCMK010259468.1 964 SVVAQSVTQDQPHIVTEVGKTVTLNCRYEPSWNMPSYFIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCVLLD
Capreolus capreolus V313 trav CCMK010268020.1 2182 QTHGDSVSQMDGQVTLSEGATLTVNCTYSAITYPTLFWYVQYPGEGPVLLLKATKINDERTNKGFEATYNAKTTSFHLEKASVQESDSAVYYCALG
Capreolus capreolus V314 trav CCMK010271171.1 1095 GTNGDSVNQTEGSVTVSEGALMTLNCTYQATYSTSYPFWYVQYLNKAPQLLLKGLTADKKVEHEDFQATLVKRDSSFHLQKQAVQTSDSAVYYCALS
Capreolus capreolus V334 trav CCMK010300318.1 507 VSSPQNTVEQSPASLPVPEGAVTSLSCTYSDSAPQYFVWYRQYPGKGPEFLLAVYPDKDKEEGKFTAQATKANKHVSLLIRNSEPSDSATYLCAE
Capreolus capreolus V335 trgv CCMK010300669.1 11276 GLGLSKVEQAQISLSTEVKKSINIHCKIESTNFESEIVYWYRQKRNQALENLVNVISTTTAARSQVDGKNKIEARKDARMFTSTLTVNFIEKEDVGIYYCAGWS
Capreolus capreolus V336 trgv CCMK010300669.1 16819 GLGLSKVEQAQISLSTEVKKSINIRCKIESTDFGLEAIHWYRVKLNQFLEHLVYVISTTTAARSQVDGKNKIEARKDAQTFTSTLTVNFVEKEDVGIYYCAGWD
Capreolus capreolus V342 trav CCMK010307124.1 794 VRGVDVEQSPPALSLQEGASYTLRCNFSTFTQSVNWYLQKPGGRLIHLFSVPSGTKQEGRLKATTVPAERRSSLHISSPWTTDSGTYFCAAQHDAPQ
Capreolus capreolus V347 trdv CCMK010314892.1 11311 KGVLCNQVTQSSPEQRVASGSEVTLLCTFQTIYSNPDLYWYQIRPDGVFQFVLYRDNAKSHDADFAQGRFSVQHSVSHKTFHLVISSVRLEDTATYYCALEL
Capreolus capreolus V356 trav CCMK010321693.1 44 VNSQQEQNLQTLSIQEGENVTINCSYKSITLTALQWYRQDSRRGFVHLILMRSSERQKYSGRLHFTLYNSIKSSSLSITASQAEDAATYLCAAD
Capreolus capreolus V363 trav CCMK010325377.1 1874 GTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPLLFWYVQYPKQHLQLLLKHSSRESIQGFTADLNQAEASFRLKKPSAQEEDSAVYYCALG
Capreolus capreolus V373 iglv CCMK010333198.1 409 VDAQTVVQEPALSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYYTNSRLSGVPDRFSGSISGNKAALTITGVQPEDEAVYYCAL
Capreolus capreolus V381 trbv CCMK010342195.1 408 AVHAGVTQDPRFQVVRTGQRAILKCTQDLGHNYMCWYRQDLGHGLRLIHYSDVPPATEKGDVPDGYSVSRPSTENFPLTLESANRSQTSVYFCASSY
Capreolus capreolus V393 trav CCMK010356219.1 212 GTGAQLVTQPDGHINVSEGNHLELRCNYSYGGSINLFWYVQYPSQGLQVLLKYLSGPTLVKGIKGFEAEFKKDEKSFHLMKASAHWSDSGRYFCVLC
Capreolus capreolus V413 trdv CCMK010381291.1 376 SGVAQNVIQDQSDISGQLGQSVTLNCQYATTWSYYYMFWYKLLPNGEMIYLIRQVSTGQNARDGRYSVNFQKARKSISLTISDLQLEDSAEYFCALCE
Capreolus capreolus V424 trgv CCMK010387170.1 3259 IQQDFRVSQSSVMVGHVGRAITMSCQVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGADGKSCTMSLMKLAKSDEGMYYCAAWR
Capreolus capreolus V429 trbv CCMK012981882.1 25 AVHAGVTQEPRFQVVRTGQSTTLKCTQDLNHDYMYWYRQDLGHGLRLIYYSADAPSSQPGDVPEGYSVSRSNKENFHLTLKCANPSQTSVYFCASSYSKA
Capreolus capreolus V459 trdv CCMK010006660.1 1212 SGVAQSVTQDQPDILSEVGKTVTLNCQYETSWDVYKYYIFWYKQVPSEGMTYLIRLYSDHGNARHGHYSVNFQKAHNSISLTISAIELEDSAKYFCALLD
Capreolus capreolus V469 trav CCMK010011944.1 4880 VSSPENTVEQSPASLPVPEGAVASLSCTYSDSASEYFIWYKQYPGKGPEFLLYVYADKDKEEGKFTAQANRANKHVSLLIRDSEPSDSATYLCAT
Capreolus capreolus V480 trdv CCMK010021568.1 870 SGMAQKVTQDQPDTSSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIHQYSEDSNARNGRYSVNFRKADKSIRLIISSLDLEDSAKYFCALRE
Capreolus capreolus V500 trbv CCMK010033535.1 8985 LVDSGVTQTPKYLIKSRKRQATLRCSPESGHRSVYWYQQALGQGPQFLVQYYNQKVWGEAQLPDRFSGEQFSDARSELSLTPLELTDSAVYLCASSQ
Capreolus capreolus V501 trbv CCMK010033535.1 5097 AVHAGVTQDPRFQVVRTGQSATLNCIQDLGHNSMYWYRQDLGHGLRLIHYSAGVPTSEPGDVPDGLSVSRSNTENFPLTLESANHSQASVYLCASNY
Capreolus capreolus V502 trbv CCMK010033535.1 2513 LVDSGVTQTPKYLIKSRKQQATLRCSPESGHLYVSWYQQTLGQGPQFLIQYYNRGVNEKGNMPDRFLGEQFSDSHSQMNLSSLELTDSALYLCASSK
Capreolus capreolus V523 igkv CCMK010049725.1 2406 ARCDLQVIQSPSFLSASLGCRVSITCWANQNIGSELNWYPQEPGKDSKLLIYYATRLHTGVPSWFSGSGSGTDFTLTISSLKAEDAATYYCQQDYSTS
Capreolus capreolus V525 igkv CCMK010050899.1 3265 TIAEITLTQSPATVSVTPGDRVTITCKASQKVDDDLYWYQQKPGQAPKLIIKQASTLISGVPSRFSGSGYDIDFTLTIDDIKSEDSAYYFCQHDENIP
Capreolus capreolus V540 trgv CCMK010056457.1 20541 TQVSSNMEEDKLSVMRATGSSVVIDCDLIHNYIHWYKFQEGAVPQRLLYYDVSYTKVVLEPGISQGKYHVYKGTGKGYTILISSLQESDSGTYYCAFWE
Capreolus capreolus V541 trgv CCMK010056457.1 8187 TQVSSNTEGEKMSITKATGSGSFVEIACDLTTQTLRYIHWYKYQEGTAPQRLLYYDISYSKVTLESGVSEGKYKVNKGKSYTFAISNLQESDSGIYYCAAWE
Capreolus capreolus V550 trav CCMK010070848.1 1756 VSLGNKVEQRPSTLSVQEGNSCLITCTYTDVASSYFPWYKQEPGKGPQLIIDIRSNMGKNEGQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Capreolus capreolus V553 trbv CCMK010072909.1 1881 AVHVGVTQDPRFQVVRTGQSATLNCTQDLGHNYMCWYRQDPGHGLRLIHYSAAAPSAVQGDVPDGYSVSRPSTEKFPVTLNSANRSQTSVYFCGSSD
Capreolus capreolus V554 trdv CCMK010073480.1 3685 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGDSISKHYIFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDGLTNQAMLEVLRASKRDEGLYYCASI
Capreolus capreolus V566 igkv CCMK010083619.1 809 SSGDVVLTQTPLTLSFTPGETVSISCKSTQSLKYSDGKTYLHWFQHKPGQSPKGLIYQVSNRYSGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCCQSRYDP
Capreolus capreolus V571 trav CCMK010085884.1 934 SSIAQKVTQDQPPISVQEKETVTLDCTYDTRDTTYSLFWYKQPSSGVMTFLIRQDSHNKQNATEGRYSLNFQKASKFIKLTISASQLGDSAVYFCALRE
Capreolus capreolus V576 trbv CCMK010088003.1 7385 LVDSGVTQTLKYLTKSRKQQATLRCSPESGHCSVYWYQQTLGQGRQFLVQYFDGKVYQKGNRSDRFSRNQLSGARSELSLTPLELLDSIVYFCASSQ
Capreolus capreolus V577 trbv CCMK010088003.1 2009 VVQAGVTQDPRFQVVRTEQSTTLNCTQDLGHNYMCWYRQDPGHGLRLIHYSDGPPGTEEGDVPDGYSVSRPSTENFPLTLKSANRSQTAVYFCASSYSMELH
Capreolus capreolus V590 iglv CCMK010099465.1 9025 SWAQAVLTQPPSVSGSPGQRVTITCSGSSSNIGILGVSWYQQLPGSAPKTLIYDSNKRPSGVPERFSGTKSGNTGTLTITSLQAEDEADYYCASADLILV
Capreolus capreolus V591 iglv CCMK010099465.1 2900 SWAQAVLTQPPSVSTTLGQRVTISCTGISNNFGDYYVSWNQQLPGKAPRLLTYEISKRPSGVPDRFSGSKSGNSASLTTSVQAEDDTDYYCFSRADGLKV
Capreolus capreolus V611 iglv CCMK010121193.1 1393 SCAQAVLTQPSSASGSPGQRVTITCTGSSSNIGGNYVGWLQQIPGSAPRTLIYGSTSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYFCATYDDSISG
Capreolus capreolus V618 trav CCMK010125725.1 1414 GTNGDSVNQTEGPVTVSQGALMTLNCTYQTSGSAPYLFWYVQHLNKAPQLLLTNQRPEHEGFQATLIKRDSSFHLQKQAVQTSDSAVYYCALS
Capreolus capreolus V625 trav CCMK010130560.1 635 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSMTSVQWFQQNPDRRLISLFYIASGMQQKGRLKSTINSKERYSQLHIRDSQPEDSATYFCAVE
Capreolus capreolus V633 trav CCMK010137829.1 10000 GVRGVKVEQSPSVLSLQEGANSTLRCNFSTSINYVQWFQQNPGGSLISLFFIASGTKQNERLSSTVNSKELYSTLHITASQLEDAATYLCAVE
Capreolus capreolus V634 trav CCMK010137829.1 2022 KSRAEKVEQYPSFQSVQEGDYCVINCTYTDSASTYFFWYKQEPGKGLQLLVHILSNEDKKQGQRLIVLLNKKNKHLSLNITATHPDDSATYFCATR
Capreolus capreolus V649 trbv CCMK010156410.1 36147 SMDTGVTQTPRNRIANTGESIVLECSQTKGHESMYWYRQDPGQGLRLIYSSYDIGGINKGDVSDGYNVSRKEKAKFSLYLEPAAPSQTAIYFCASSI
Capreolus capreolus V650 trbv CCMK010156410.1 30362 FMDADVHQTPRHCVIGTGKKITLECSQTMGHNNMYWYQQDPGMELQLIHYSYGVNTTEKGEHSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Capreolus capreolus V651 trbv CCMK010156410.1 28655 LKDAAVTQFPRRKILETKKEVILQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGLDTINRGDVPEGYDVSRDELEHFPLTLKSASPNQTSVYFCASSE
Capreolus capreolus V652 trbv CCMK010156410.1 10284 LMDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIGVGMVEEGNVPHGYSVSRKKKESFPLTLESATTNQTSVYLCASSE
Capreolus capreolus V653 trbv CCMK010156410.1 4043 SVFGALLSQKPSRAIRQRGTSVKIECQVDSQLTYMYWYRQLPGQSLVLMATANQGSKATYESGFAEDKFPISRPTLVFSTLTVSNVSSKDSSSYFCSTG
Capreolus capreolus V666 trbv CCMK010170681.1 6166 LVDSGVTQTPKYLIKSRKQQATLRCSPDSGHRSVNWYKQALGQGPRFLVQYYRGQVSGEGNMPDRFSGKQFSDFRSELNLSSLDLTDSAVYLCASSQ
Capreolus capreolus V667 trbv CCMK010170681.1 3384 AVHVGVTQDPRFQVVRTGQSVILNCTQDLGHNNMYWYRQDPGLGLRLIHYSTGPFTKEQGDVPDGYSVSRPNTENFPLTLSSANHSQTSVYFCASSY
Capreolus capreolus V668 trbv CCMK010172678.1 9452 HTGAGVVSQSPGHRVTGRGQSVNFRCDPIPGHQGIYWYRQMLGQGPEYLTYFQGKEEPDKSGMPNNRFSAERPEGTYSYLKIQSAEPGDSAVYLCASSL
Capreolus capreolus V677 trdv CCMK010183448.1 1116 SALAQKVTQDQPDVSRQVGQSVTLNCRYETSWRNYYLFWYKQPPSGQMTYVIHQGSEATNARNSRYSVNFKKVDKSINLTISALQLEDSSKYFCALRE
Capreolus capreolus V679 iglv CCMK010184264.1 1877 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNIGYSNNVGWLQQIPGSPPRQLIYRITSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCAAY
Capreolus capreolus V682 trdv CCMK010188894.1 1584 SGVAQKVTQYQPDIISQVRNVVTLNCRYEKSWNMYTYWIFWYKQLPSGEMTCLIGQYSEYGNERDGHYSVNFQKARQFISLTISSLRLEHSGKYFCALWE
Capreolus capreolus V693 trav CCMK010197026.1 429 QTHGDSVSQMDGQVTLLEGVTLTVNCTYSDTTYPTLFWYVQYPGEGPELLLKATKANDKRTNKGFEATYNAKTTSFHLEKASVQESDSAVYYCALS
Capreolus capreolus V698 trav CCMK010204392.1 2129 LRRADWIRSQETEVSGEEGKTVSLFCNYYTSSRSFVSLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Capreolus capreolus V708 iglv CCMK010214622.1 687 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNVGYGNYVSWYQQLPGSAPRLLIYGTTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCLSADSSSYN
Capreolus capreolus V745 trdv CCMK010259433.1 1423 SGVAQKVTQDQPDVSSQVGQSVTLNCRYETSLSYYELVWYKQLPSGQMTYLIRLYSESSNARNGRYFVNFQKTDKSISLIISSLELEDSAKYFCAFCY
Capreolus capreolus V751 trbv CCMK010268728.1 2691 VVLAGITQDPRFQVVRTGQRTTLKCTQDMYHDSMYWYRQDPGHGLRLIHYSSATDTTYQGDVPEGYSVSRSRAENFPLTLESANPSQTSVYFCASGY
Capreolus capreolus V766 iglv CCMK010289857.1 368 HLASSQLTQPPAVSVSLGQTASITCQGDDLLLFNAHWYQQKPGQAPVLVIYGNRERASGIPDRFSGSSSDTTATLTISGAQAEDEADYYCQSADISIGG
Capreolus capreolus V769 igkv CCMK010292317.1 1580 ASGKAVLHQTPAYIAVPLGESISITCRANQSISDYLSWYKQKPGQAPSILIYDADNQYSGVPGRFTATQSETEFVFTISKVEADDAAMYYCQQDHVL
Capreolus capreolus V773 trav CCMK010298214.1 2804 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGVNDYIHWYRQNRKQSPQYVIHGLQGTVNSSMASLIVASDRKSSTLVLPQVTLRDTAVYYCVLRE
Capreolus capreolus V787 trdv CCMK010310501.1 4571 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYQQPSSGEMIYIVNIYSQSKHAREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Capreolus capreolus V793 trav CCMK010318114.1 1370 AHTQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELKDEGVYICEF
Capreolus capreolus V802 iglv CCMK010331413.1 996 HLASSQLTQPPAVSGTLGQTASITCQGDDIGSSDAHWYQQKPGQAPVTVIYKHNEQPSGIPDRFSGSNSGDTATLTISGAQAEDEADYYCQSADISIGD
Capreolus capreolus V806 trdv CCMK010333061.1 622 SSVAQRVTQDQPDISSQAGEVVTLSCRYETRLSSYNMFWYKQLPSGEMIYLIGQGSSSQNTRDGRYSVNVQRSHKTISLTISDLQLEDSAKYFCALWE
Capreolus capreolus V811 trgv CCMK010335497.1 698 ISITQHITSITKRKGNTAFLECQIKTDELKKNVYMHWYRQKPEQPLKRILYISSNENVVHGQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACSVE
Capreolus capreolus V816 trav CCMK010339882.1 4244 QTHGDSVTQIDGQLTLSEGTSVTINCTYSTSGYPFLFWYVQYPGEGPQLLLKATKANEKGSHKGFEATYNTEATSFHLEKASAQESDSAVYYCALR
Capreolus capreolus V835 trav CCMK010364861.1 1837 ILGDSKTTQPNSAEGSEEEPVHLSCNHSTISGREYVYWYRQISHQGPEYLIHGLNNNVTNKMASLSIAKDRKSSFLVLPQVTVRDTAVYYCILR
Capreolus capreolus V841 trav CCMK010366894.1 1836 SIIAQKVTQDQPQVLVQEKEAVTLDCKCDTSESRYSLSWYKQPSSGGMILLIRQDSHNQQNATEGRYSLNFQKARKSITLVISASRLEDSAVYFCALSE
Capreolus capreolus V842 trbv CCMK010367152.1 12140 HTGAGVVSQSPGHRVTRRGQTVNLRCDPISGHISLYWYRQTLGQGPEFLAYFQNDQALDKSGLPKNRFSAERPESTYSYLKIQPAEPEDSATYLCASSP
Capreolus capreolus V843 trbv CCMK010367152.1 2670 PLEAEVTQTPRHLIKRTGQTATLRCSPVSGHSSVSWYQQAWSQGPQFVFEFYETQPRAKGNFSNRFSAKQFHDFSSELNVTSLELTDSALYLCASSL
Capreolus capreolus V847 trdv CCMK010372621.1 772 SGVVQNVIQDQPDISGQLGQPFTLNCQYGTTWSYYYMFWYKLLPNGEMIYLIGQVSTGQNARDVRYSVNFQKAHKSMSLTISDLELEDSAEYFCALWE
Capreolus capreolus V850 trgv CCMK010375693.1 328 GLGQLTLEQPEVSVTGTREKSVIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSAAPTLSHLGGTKNKLEAKKYASSSTSTLKISFLEKEDEAMYYCAGWVS
Capreolus capreolus V870 trav CCMK013004826.1 644 PSVAQTVTQPQPEESVQEAGTVTLDCAYSTSDSDYYLFWYKQPPSGQMVFIIRQYSYERQNATNDRYSVNFQKEAKTFSLRISDSQLEDAAMYFCAYSV
Capreolus capreolus V871 iglv CCMK013014852.1 591 SWAQAVVTQPSSVSGSPGQTVTITCTGTSNNIGGGYYVGWFQQIPGSAPRLLIYGTTSRASGVPDRFSGSRSGNMATLTISSLQAEDEADYYCASADGRSFV
Capreolus capreolus V872 ighv CCMK013029281.1 423 VLSQMQLQELSPELVKPSLTLQLTCADSGYSITSGYGWNWICQVPGKVLERIECINYNANTHYSLSIKNHTSICRNTSKNKFSLQLTSVTTMDTAMYYCAR
Capreolus capreolus V875 igkv CCMK013036309.1 650 SSGDAVLTQTPLSLSVIPGETASISCKSSQSLLSSDGNTYFYWLQHKPGQSPQRLIYQVSKHDTGVSDRFTGSGSETDFTLRISSVQAEDAGVYYCFQA
Capreolus capreolus V882 igkv CCMK013073397.1 1219 SIGDIVLTQTPLFLSVIPGKTASISCRASQSLEDSYGDTYLSWHLQKPGQSPQLLIYLVSNQASGVPDMFPGSGSGTDFTLKISRVEAEDAGVYYCRQSIQEP