WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Macaca mulatta JSUE00000000.3 (JSUE03) 311 65 57 70 49 60 6 4
Macaca mulatta AEHK00000000.1 (AEHK01) 189 28 30 35 41 52 0 3
Macaca mulatta AANU00000000.1 (AANU01) 292 63 51 65 45 57 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Macaca mulatta V0 iglv JSUE03005103.1 30198 VDSETVVTQEPSLSVYPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCTLYMGSGI
Macaca mulatta V1 iglv JSUE03005103.1 82349 QSMLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCSSLVIVTDPQESLTDFSGSKSGNLASLTITGLWPENEADYHCQS
Macaca mulatta V2 iglv JSUE03005104.1 3686 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca mulatta V3 iglv JSUE03005104.1 13741 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGNAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADGSYN
Macaca mulatta V4 iglv JSUE03005104.1 54456 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRISGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca mulatta V5 iglv JSUE03005104.1 81674 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQQGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Macaca mulatta V6 iglv JSUE03005114.1 12396 SWAEVVFTQPHSVSGSPGQTVTISCTHSSGSIDNSYVYWYQQRPGSAPTTVIYNDDQRPSGVPDRSSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSG
Macaca mulatta V7 iglv JSUE03005114.1 50598 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca mulatta V8 iglv JSUE03005114.1 59924 SWAQSVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVNKRPSGVSDRFSGSQSGTSATLGISGLRPEDEADYYCSAWDSSL
Macaca mulatta V9 iglv JSUE03005114.1 65264 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSQSGTSASLTITGLQSEDEADYYCQSYDSSLS
Macaca mulatta V10 iglv JSUE03005114.1 81531 SLSQPVLTQPSSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Macaca mulatta V11 iglv JSUE03005114.1 88277 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRIFWYQQKPGSPPRYLLNYHTDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Macaca mulatta V12 iglv JSUE03005114.1 92916 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDNSLSS
Macaca mulatta V13 iglv JSUE03005114.1 101920 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPHWFQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCWLYYSGA
Macaca mulatta V14 iglv JSUE03005114.1 111445 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGMAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCEAWDDSLSG
Macaca mulatta V15 iglv JSUE03005114.1 120517 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDKAEYYCWLYYSGA
Macaca mulatta V16 iglv JSUE03005115.1 4406 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca mulatta V17 iglv JSUE03005115.1 9240 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDSSLSG
Macaca mulatta V18 iglv JSUE03005115.1 22448 SNSQAVATQEPSLTVSRGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCL
Macaca mulatta V19 iglv JSUE03005115.1 29583 SLSQPVLTQPTSLSASPGASARLSCTLSSGINVGSYSIFWYQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Macaca mulatta V20 iglv JSUE03005115.1 40295 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRSYVSWYQQVPGTAPKLLIYQDNKRPSGVSDRFSGSKSGTSASLAITGLQTGDEADYYCSAWDSSLS
Macaca mulatta V21 iglv JSUE03005115.1 44467 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVYWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLTITGLQSEDEAEYYCETWDNSLNG
Macaca mulatta V22 iglv JSUE03005115.1 49476 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYYVYWYQQFPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDSSLS
Macaca mulatta V23 iglv JSUE03005115.1 55300 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTTPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCLSYDSSLS
Macaca mulatta V24 iglv JSUE03005115.1 78072 SLSKPMLTQPASLSASPGASASLTCTFSGGINVAGYHIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Macaca mulatta V25 iglv JSUE03005115.1 82620 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca mulatta V26 iglv JSUE03005115.1 147964 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRAGKAVLAITGAQPEDEAFYYCALW
Macaca mulatta V27 iglv JSUE03005116.1 18668 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQVPVLVIYKDSERPSGIPERFSGSSSGTTVTLTVSGAQAEDEADYYCYSGDGNS
Macaca mulatta V28 iglv JSUE03005116.1 28250 SWAQSAPTQPPSVSGSPGQSVTISCTGTSSDIGYYNAVSWYQQHPGTAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Macaca mulatta V29 iglv JSUE03005116.1 41045 SAASYDLTQPPSVSVSPGQTARITCGGDNIGSEVVNWYQQKPPQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDISSDH
Macaca mulatta V30 iglv JSUE03005117.1 2369 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVVYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca mulatta V31 iglv JSUE03005120.1 134 SWAQAALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYAVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Macaca mulatta V32 iglv JSUE03005120.1 18022 SAASYDVTQPRSVSVSPGQTARITCGGDNIGSKVVHWYQQKPAQAPVLVIYRDSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V33 iglv JSUE03005121.1 11597 SWAQAALTQPPSVSKSLGQSVTISCAGTSSGIASYSDVSWYQQHPGTAPRLLIYRVSNRPSGVSDRFSGFKSGSTASLTISGLQAEDEAIYYCCSYRSG
Macaca mulatta V34 iglv JSUE03005121.1 20009 SATSYELTQPPSVSAASGQTARITCGGDNIGSKNVHWYQQKPAQAPVLVIYADSKRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSKY
Macaca mulatta V35 iglv JSUE03005121.1 32180 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca mulatta V36 iglv JSUE03005121.1 39072 SVASYELTQPPSVSVSLGQTAKITCSGDVLAKYYAHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCYSGDDNN
Macaca mulatta V37 iglv JSUE03005122.1 575 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Macaca mulatta V38 iglv JSUE03005122.1 17269 SWAQAAPTQSPSVSGSAGQSVTISCTGTSSDIGYYNAVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca mulatta V39 iglv JSUE03005122.1 40982 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca mulatta V40 iglv JSUE03005122.1 48414 SVASYELTQPLSVSVALGQMARITCGGNNIGRKYVYWYQQKPDQAPVLVIYEDSKRPSGIPERFSGSNSGNTATLTIDGAQARDEADYYCQVWDS
Macaca mulatta V41 iglv JSUE03005122.1 51772 SWAQAALTQSPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca mulatta V42 iglv JSUE03005123.1 21973 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V43 igkv JSUE03011470.1 11282 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGSDFTLTISGLQAEDVAVYYCQQYY
Macaca mulatta V44 igkv JSUE03011473.1 2946 ARAEMILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Macaca mulatta V45 igkv JSUE03011473.1 14186 AKCDIQMTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTDVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Macaca mulatta V46 igkv JSUE03011473.1 60992 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Macaca mulatta V47 igkv JSUE03011473.1 70277 ARAETILTQSAAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca mulatta V49 igkv JSUE03011778.1 110466 SSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Macaca mulatta V50 igkv JSUE03011780.1 23363 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYNTP
Macaca mulatta V51 igkv JSUE03011781.1 13682 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca mulatta V52 igkv JSUE03011781.1 44154 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQPLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQY
Macaca mulatta V53 igkv JSUE03011781.1 66848 SSGDIVMTQTPLSLPVTLEEPASISCRSSQSLVYSDGKTYLYWYLQKPGQSPQLLMYLVSKRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Macaca mulatta V54 igkv JSUE03011781.1 74948 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYNTP
Macaca mulatta V55 igkv JSUE03011781.1 83039 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTHLHWYLQKPGQSPQLLMYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Macaca mulatta V56 igkv JSUE03011781.1 108134 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLFWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQDIQLP
Macaca mulatta V57 igkv JSUE03011781.1 116357 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSNLAWYQQKPGKAPKLLIYAASSLQTGIPSRFSGSGSGTDFTLTISSLQPEDSAAYYCQQVYSNP
Macaca mulatta V59 trgv JSUE03028421.1 118410 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Macaca mulatta V60 trgv JSUE03028421.1 123140 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYGSTRNNLRLILRNVIENDSGVYYCANWD
Macaca mulatta V61 trgv JSUE03028421.1 127534 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Macaca mulatta V62 trgv JSUE03028421.1 137055 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQVGKAPQRLLYYDTSNSRVVLESGISPGKYDSYGSTRNNLRLRLRNLIENDSGVYYCANWD
Macaca mulatta V63 trgv JSUE03028421.1 151826 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Macaca mulatta V64 trbv JSUE03029789.1 97313 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVIFFDNNISEKSEIFEDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Macaca mulatta V65 trbv JSUE03029789.1 104280 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca mulatta V66 trbv JSUE03029789.1 108924 PIDSGVTQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKVKKPPEIMFIYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V67 trbv JSUE03029789.1 117146 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Macaca mulatta V68 trbv JSUE03029789.1 124740 SLDTAVSQTPKYLVTQTGKEEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKKLFINETVSNRFSPDSPDKARLILHIKPLELGDSAVYFCASSQ
Macaca mulatta V69 trbv JSUE03029789.1 133250 HTEPEVTQTPSHQVTRMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVYFYNGEISEKSEIFEDRFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Macaca mulatta V70 trbv JSUE03029789.1 139768 PLDTAVFQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPESPDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca mulatta V71 trbv JSUE03029790.1 1380 PTDTGVTQTPKHLVMGMTNKKSLKCEQHMGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V72 trbv JSUE03029790.1 12337 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVYWYQQTPGQGLQFLFEYFSETQRQKGNFSNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca mulatta V73 trbv JSUE03029790.1 20267 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSAAEGTTDPGEVPDGYSVSRLNKTEFLLRLESAAPSQTSVYFCASSE
Macaca mulatta V74 trbv JSUE03029790.1 34883 SLDTAVSQTPKYLVRQTGKNESLKCEQNLGHDAMYWYKQDSKKLLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca mulatta V75 trbv JSUE03029790.1 38316 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFSPECPDSSHLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V76 trbv JSUE03029790.1 50061 PVNAGVTQTPKFQVLKTGQNMTLKCAQDMNHNRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Macaca mulatta V77 trbv JSUE03029791.1 25757 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAADDSGLRSDRVSATRPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca mulatta V78 trbv JSUE03029791.1 31127 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQAPGQGPQFIFEYANESRTSEGNFPHRFSGRQFRDYHHSEMNVSALELGDSALYLCASSL
Macaca mulatta V79 trbv JSUE03029791.1 33813 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDRSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSGLYFCASSE
Macaca mulatta V80 trbv JSUE03029791.1 42142 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca mulatta V81 trbv JSUE03029791.1 53548 FTEAGVAQSPRYKITEKSQTVAFWCDPISGHATLYWYRQILGQGPELLVQFQNKGIVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V82 trbv JSUE03029791.1 66132 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca mulatta V83 trbv JSUE03029791.1 75289 LTEAGVAQSPRYKVIEKSQAVTFWCNPISGHATLYWYQQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V84 trbv JSUE03029791.1 92398 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Macaca mulatta V85 trbv JSUE03029791.1 96630 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHEYLYWYQQALGQGPAFLTYFQNDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTQQGDSAVYLCASSL
Macaca mulatta V86 trbv JSUE03029791.1 126454 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSL
Macaca mulatta V87 trbv JSUE03029791.1 129758 LVNVGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPLRLESADPSQTSVYFCASSY
Macaca mulatta V88 trbv JSUE03029791.1 134378 HTGARVSQSPRYKVTKRGQDVALRCDPISGHATLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca mulatta V89 trbv JSUE03029791.1 145012 SVDTGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V90 trbv JSUE03029791.1 156563 HTGAGVSQSPRYKVTERGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFNDKAQPDKSGLPNDRFSAERPEGSVSTLKIQRTEQRDSAVYLCASSL
Macaca mulatta V91 trbv JSUE03029791.1 161628 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQLIFEYYEKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca mulatta V92 trbv JSUE03029791.1 167657 LFSAGPGNAAVNQTPKFQVLKTGQSMTLQCAQDMNHECMSWYRQDPGMGLRLIHYSAAAGITDKGEVPNGYNVSRSNTEDFPLRLESAASSQTSVYFCGSSY
Macaca mulatta V93 trbv JSUE03029791.1 190671 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCTSSL
Macaca mulatta V94 trbv JSUE03029791.1 198106 PGNADVTQTPKFQVLKTGQSMTVQCAQDMNHDCMYWYRQDPGMGLKLIHYSVGAGITDKGEVPNGYNVSRLNTEDFPLRLESAALSQTSVYFCASS
Macaca mulatta V95 trbv JSUE03029791.1 210496 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSNVSWYQQALGQGPQFIFQYYEKEERERGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V96 trbv JSUE03029791.1 217784 PVNAGVTQTPKFQVLKTGQSLTVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESADPSQTSVYFCASSE
Macaca mulatta V97 trbv JSUE03029791.1 222089 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKAQPDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca mulatta V98 trbv JSUE03029791.1 230864 PVDAGVVQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQALGQGPQLIFQYYRGEDRGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Macaca mulatta V99 trbv JSUE03029792.1 7681 HADAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDLAMYLCASSL
Macaca mulatta V100 trbv JSUE03029792.1 14503 SVAAGVIQSPRHLIKEKRETATLQCYPLPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASNL
Macaca mulatta V101 trbv JSUE03029792.1 21737 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESTTRSQTSVYFCASSE
Macaca mulatta V102 trbv JSUE03029792.1 32779 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca mulatta V103 trbv JSUE03029792.1 38380 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V104 trbv JSUE03029792.1 41646 HTDAGVIQSPQHEVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPEVSFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V105 trbv JSUE03029792.1 56986 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca mulatta V106 trbv JSUE03029792.1 63993 HTEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFLRASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca mulatta V107 trbv JSUE03029792.1 69611 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca mulatta V108 trbv JSUE03029792.1 75489 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGYSYFFWYQRVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca mulatta V109 trbv JSUE03029792.1 90116 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Macaca mulatta V110 trbv JSUE03029792.1 93357 TMDGRITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca mulatta V111 trbv JSUE03029792.1 101297 GSGLAAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca mulatta V112 trbv JSUE03029792.1 111699 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINKRFSAQCPQNSSCTLEIQSTESGDAALYFCASK
Macaca mulatta V113 trbv JSUE03029792.1 120676 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca mulatta V114 trbv JSUE03029792.1 132817 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca mulatta V115 trbv JSUE03029792.1 140646 LTEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca mulatta V116 trbv JSUE03029792.1 181584 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSVNVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca mulatta V117 trbv JSUE03029792.1 186918 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca mulatta V118 trbv JSUE03029792.1 206667 SVFSAVISQKPSRDVCQRGTSVKIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca mulatta V119 igkv JSUE03035571.1 7522 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYHCMQG
Macaca mulatta V120 igkv JSUE03035572.1 9514 TSGDIVMTQTPLSLPVTPGELASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIHEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca mulatta V121 igkv JSUE03035572.1 19344 ARCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca mulatta V122 trav JSUE03039283.1 27097 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca mulatta V123 trav JSUE03039283.1 51314 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca mulatta V124 trav JSUE03039285.1 39282 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYVTGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca mulatta V125 trav JSUE03039285.1 51437 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca mulatta V126 trav JSUE03039285.1 70172 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca mulatta V127 trav JSUE03039285.1 80110 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca mulatta V128 trav JSUE03039285.1 116559 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYHKETTSFHLEKDSVQESDSAVYFCALS
Macaca mulatta V129 trav JSUE03039285.1 129790 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca mulatta V130 trav JSUE03039288.1 3146 VWSQQKEVEQDSGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Macaca mulatta V131 trav JSUE03039288.1 8586 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca mulatta V132 trav JSUE03039289.1 10723 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNAHEKKNQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca mulatta V133 trav JSUE03039289.1 33296 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCAV
Macaca mulatta V134 trav JSUE03039289.1 39792 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPNLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Macaca mulatta V135 trav JSUE03039289.1 45361 TARSQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDSVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca mulatta V136 trav JSUE03039289.1 59206 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFFWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca mulatta V137 trav JSUE03039289.1 65092 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca mulatta V138 trav JSUE03039289.1 83410 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca mulatta V139 trav JSUE03039289.1 108047 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTALVDKSSKYISLFIRDSQPSDSATYFCAMS
Macaca mulatta V140 trav JSUE03039289.1 121033 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLRLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca mulatta V141 trav JSUE03039290.1 7919 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca mulatta V142 trav JSUE03039290.1 17387 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTLKKSSSLLITASRAADTASYFCATD
Macaca mulatta V143 trav JSUE03039290.1 29611 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca mulatta V144 trav JSUE03039290.1 32830 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYYSNFQKSTSSFNLTITASQIVDSAVYFCALNE
Macaca mulatta V145 trav JSUE03039290.1 68765 LSGEDQVTQSPEALSLQEGDSSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca mulatta V146 trav JSUE03039290.1 79117 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca mulatta V147 trav JSUE03039291.1 10024 VIGIQVEQSPPDLILQEGANSTLRCNYSATVNNLQWFHQNPWGQLINLFYIASGTKQNGRLSATTVTTERYSLLHISSSQTTDSGIYFCAVKSQCSP
Macaca mulatta V148 trav JSUE03039292.1 334 VIGIQVEQSPPDLILQEGANSTLRCNYSATANNLQWFHQNPWGQLINLFYIASGTKQNGRLSATTVTTERYSFLHISSSQTTDSGIYFCAVESQCSP
Macaca mulatta V149 trdv JSUE03039294.1 2091 FSVAQKVTQAQSSVSMPVEKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIRQGSSEQNARDGRYSVNFKKEASFIALTISALQLEDSATYFCALRE
Macaca mulatta V150 trav JSUE03039295.1 5141 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRLETAKIPKALFVMTLNGDEKKKGRVRVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V151 trav JSUE03039295.1 12517 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V152 trav JSUE03039295.1 23467 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSEGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V153 trav JSUE03039295.1 32584 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca mulatta V154 trav JSUE03039295.1 50082 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca mulatta V155 trav JSUE03039295.1 69404 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Macaca mulatta V156 trav JSUE03039295.1 92713 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Macaca mulatta V157 trav JSUE03039295.1 97428 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Macaca mulatta V158 trav JSUE03039295.1 110367 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca mulatta V159 trav JSUE03039295.1 115125 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca mulatta V160 trav JSUE03039295.1 125480 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca mulatta V161 trav JSUE03039295.1 152283 SGMAQTVTQSQQEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca mulatta V162 trav JSUE03039295.1 161790 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYR
Macaca mulatta V163 trav JSUE03039295.1 185384 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca mulatta V164 trav JSUE03039295.1 202746 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca mulatta V165 trdv JSUE03039296.1 63696 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca mulatta V166 trdv JSUE03039296.1 84114 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTLGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca mulatta V167 ighv JSUE03040596.1 5232 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGGIYSNSESTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V168 ighv JSUE03040596.1 32496 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISDSYWWSWIRQPPGKGLEWIGYIYGSSTSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V169 ighv JSUE03040596.1 77487 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGNIGGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCA
Macaca mulatta V170 ighv JSUE03040596.1 105253 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMHWVRQASGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYFQMDSLRAEDTAVYYCAR
Macaca mulatta V171 ighv JSUE03040596.1 113021 VKCEAQLMETGGGLVQPGGSLRLSCADSGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRFTISRDDSKSITYLQMNNLKTEDTAVYYCAR
Macaca mulatta V172 ighv JSUE03040596.1 116530 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGRISGSGGSTSDNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V173 ighv JSUE03040596.1 124883 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLKLEDTAVYYCAR
Macaca mulatta V174 ighv JSUE03040596.1 166404 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSSTRINWIRQSPGKRLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca mulatta V175 ighv JSUE03040596.1 173660 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSSWISWVRQMPGKGLEWMGSIYPGDSDTKYNPSFQGHVTISADKSISTTYLQWSSLKASDTATYYCAK
Macaca mulatta V176 ighv JSUE03040596.1 212197 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca mulatta V177 ighv JSUE03040596.1 228018 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSPRAEDTAVYYCAR
Macaca mulatta V178 ighv JSUE03040596.1 237366 VQCEVQLVAYGGGLEQPGGSLRLSCGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLKTEDTAVYYCAR
Macaca mulatta V179 ighv JSUE03040596.1 253999 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V180 ighv JSUE03040596.1 266092 VQCEVQLVESGGGLVQPGGSLRLSCAAPGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca mulatta V181 ighv JSUE03040596.1 276009 VQCEVQLVESGAGLVQPGGSLRLSCAASGFTFSNSWMSWVRQAPGKGLEWVARIKRKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Macaca mulatta V182 ighv JSUE03040596.1 295803 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSNYWMYWVRQAPGKGLEWISAINSAGSSTYYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAG
Macaca mulatta V183 ighv JSUE03040596.1 334703 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Macaca mulatta V184 ighv JSUE03040599.1 3283 VQGEVQLVESEGNFVQPGGSLRLSCAVSGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVNSLFAISRGNAKNTLYLQMNSLIAEDTAIYYCVSE
Macaca mulatta V185 ighv JSUE03040599.1 14709 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Macaca mulatta V186 ighv JSUE03040599.1 49409 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Macaca mulatta V187 ighv JSUE03040599.1 59493 VQCEVQLVESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPEEGLVWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca mulatta V188 ighv JSUE03040599.1 98093 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWVRQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMDSLRAEDTAVYYCAK
Macaca mulatta V189 ighv JSUE03040601.1 48286 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca mulatta V190 ighv JSUE03040626.1 739 AHSEVQLVQSGAEVKKPGASVKVSCKVSGYTFTELSMHWVRQAPGKGLEWMGGVDPVYGEIIHAEKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V191 ighv JSUE03040626.1 14427 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMDWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKNTAYLQMSSLKTEDTAVYYCTR
Macaca mulatta V192 ighv JSUE03040626.1 19294 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPSRKTLEWLAHIYWDDDKRYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca mulatta V193 ighv JSUE03040629.1 1481 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWNWIRQPPGKGLEWIGNIGGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V195 ighv JSUE03040629.1 38652 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPRQGLEWMGWINPYNGNTKYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V196 ighv JSUE03040630.1 4436 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQALGKGLEWVSSISNTGKTIYYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCTR
Macaca mulatta V197 ighv JSUE03040631.1 32313 VQCVEQLVESGGALVQPGASLRLSCAASEFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V198 ighv JSUE03040632.1 16530 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGYITYSGSTSYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V199 ighv JSUE03040636.1 12646 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYETGYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTT
Macaca mulatta V200 ighv JSUE03040636.1 16240 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSSVSGSSSNTYYPDSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Macaca mulatta V201 ighv JSUE03040636.1 23728 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGPEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Macaca mulatta V202 ighv JSUE03040637.1 1525 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSGYEMHWVRQAPGKGLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCA
Macaca mulatta V203 ighv JSUE03040639.1 641 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Macaca mulatta V204 ighv JSUE03040640.1 1228 AHSEVQLVQSGAEVKKPGASVKISCKASGYTFTDYYLHWVRQAPGKGLEWMGRVDPEDGEAIHAQKFQDRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Macaca mulatta V205 ighv JSUE03040641.1 1950 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSSISSGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Macaca mulatta V206 ighv JSUE03040645.1 6116 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISDDYYWSWIRQPPGKGLEWIGYIYGSGGGTNYNPSLKNRVTISIDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V207 ighv JSUE03040647.1 2232 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMNWVRQTPGKGLEWISAINSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca mulatta V208 ighv JSUE03040648.1 1540 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYEMHWVRQAPGKGLEWVSVISESGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Macaca mulatta V209 ighv JSUE03040648.1 5504 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEYIGYISGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V210 ighv JSUE03040650.1 9821 VLSQVQLQESGPAVVKPSETLSLTCAVSGGSISSSNWWSWIRQSPGKGLEWIGGIYGSGGSTEYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCA
Macaca mulatta V211 ighv JSUE03083532.1 115 VLSQVQLKESGPGLVKPSETLSLTCAVSGGSISSGYGWGWIRQPPGKGLEWIVTIYSSTGNTYYDPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V212 trbv JSUE03084041.1 372 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYQAQPDKSGLPNDRFSAERPEGSVSTLTIQRTEQGDSAVYLCASSL
Macaca mulatta V213 trav JSUE03111938.1 2947 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V214 igkv JSUE03113795.1 174 TTGEIVMTQSPDTLSLSPGERATLSCRASQSVSSYVAWYQQKPEQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQQYNNWN
Macaca mulatta V215 ighv JSUE03124817.1 354 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISDYYYWNWIRQPPGKGLEWIGNIYGNSASTYYNPSLKSRVTISKDTSKNQFFLKLSSVTAADTAVYYCAR
Macaca mulatta V216 iglv JSUE03129027.1 125 SAVSYELTQPPSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVLVIYYDSDRPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQGWDSSSDH
Macaca mulatta V217 igkv JSUE03144151.1 901 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFDSDYANTYLDWYLQKPGQSPQLLIYMLSNQASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSVEYP
Macaca mulatta V218 iglv JSUE03147321.1 742 SWAQAALTQPPSMSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca mulatta V219 igkv JSUE03155133.1 48 CPDVTSQMTQSPSPLSASVGDKVTITCRASQGISNALAWYQQKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca mulatta V220 iglv JSUE03156810.1 128 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V221 igkv JSUE03159182.1 27 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYAATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQHNSYP
Macaca mulatta V222 trbv JSUE03171531.1 222 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPAFLTYFQDDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca mulatta V223 ighv JSUE03174796.1 706 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIYGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V224 igkv JSUE03180283.1 863 TTGEIVMTQSPATLSLSPRERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYYASNRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYHCQQESNW
Macaca mulatta V225 igkv JSUE03185770.1 840 TTGETVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQESNWK
Macaca mulatta V226 igkv JSUE03189615.1 391 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Macaca mulatta V227 iglv JSUE03203029.1 1845 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSYDSYN
Macaca mulatta V228 trbv JSUE03208396.1 79 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDAQLDKSGLPNDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca mulatta V229 trbv JSUE03221526.1 167 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAADDSGLRSDRVSATRPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca mulatta V230 igkv JSUE03234441.1 462 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQEPGKAPKLLIYSASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQFKNYL
Macaca mulatta V231 iglv JSUE03243110.1 1000 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNGVSWYQQHSGTAPRLLIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYRSG
Macaca mulatta V232 iglv JSUE03288299.1 1843 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca mulatta V233 iglv JSUE03307810.1 792 SWAQAALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V234 ighv JSUE03312868.1 444 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSSYWSWIRQAPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQLSLKLSSVTAADTAVYYCAR
Macaca mulatta V235 iglv JSUE03323533.1 347 SAASYELTQPPSVSVSPGQMARITCGGDNIGSKNVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V236 ighv JSUE03346235.1 1063 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca mulatta V237 igkv JSUE03004926.1 12651 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca mulatta V238 igkv JSUE03004926.1 1402 ARCDIQMTQSPSSLSASVGDTVTITCQASQGIGNNLNWYQQKPGKAPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca mulatta V239 igkv JSUE03011473.1 176482 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSYP
Macaca mulatta V240 igkv JSUE03011473.1 172030 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTVSSLEPEDFAVYFCQQESNW
Macaca mulatta V241 igkv JSUE03011473.1 159370 AKCDIQMTQSPSSLSASVGDKVTITCQASQSISSWLAWYQQKPGKAPKPLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSAP
Macaca mulatta V242 igkv JSUE03011473.1 95796 CNGDIVLTQSPASLAVSPGQRATITCRASETVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca mulatta V243 igkv JSUE03011473.1 77977 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQENSI
Macaca mulatta V244 igkv JSUE03011474.1 7864 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYDDLP
Macaca mulatta V245 igkv JSUE03011475.1 97931 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYKSYP
Macaca mulatta V246 igkv JSUE03011475.1 91501 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKAPGLQSGVPSMFSGSGSGTDFTLTISSLQPEYFATYYCQQFSSAL
Macaca mulatta V247 igkv JSUE03011475.1 75403 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPKLLIYGASSRATGIPDGFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Macaca mulatta V248 igkv JSUE03011475.1 32483 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Macaca mulatta V249 igkv JSUE03011475.1 13658 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRVTGIPDRFSGSGSGTDFTLTISSLEPEDVAVYYCQQRSNW
Macaca mulatta V250 igkv JSUE03011476.1 46015 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISNALAWYQQKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca mulatta V251 igkv JSUE03011476.1 43527 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYANSLASGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQGNSNP
Macaca mulatta V252 igkv JSUE03011476.1 25036 TTGEIVMTQSPATLSLSPGETATISCRTSQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Macaca mulatta V253 igkv JSUE03011477.1 35522 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYDASNRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQQESNW
Macaca mulatta V254 igkv JSUE03011478.1 29467 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca mulatta V255 igkv JSUE03011478.1 22843 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Macaca mulatta V256 igkv JSUE03011478.1 5869 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLSWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQGYSTP
Macaca mulatta V257 igkv JSUE03011479.1 30386 TAGEIVMTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca mulatta V258 igkv JSUE03011480.1 14982 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNW
Macaca mulatta V259 igkv JSUE03011480.1 2388 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNDLNWYQQKPGKAPKLLIYAASSLESEVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQPFKNYL
Macaca mulatta V260 igkv JSUE03011481.1 585 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSDP
Macaca mulatta V261 igkv JSUE03011483.1 7341 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYNSDP
Macaca mulatta V262 igkv JSUE03011484.1 261669 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNYLSWYQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Macaca mulatta V263 igkv JSUE03011484.1 239375 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSDGNTYLSWYQQKPGQPPRRLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQGTKVP
Macaca mulatta V264 igkv JSUE03011484.1 204933 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca mulatta V265 igkv JSUE03011484.1 196659 ARCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca mulatta V266 igkv JSUE03011484.1 160925 STGDVAMTQSPLSLPVTPGQPASISCRSSQSLLHSNGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMEG
Macaca mulatta V267 igkv JSUE03011484.1 144496 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca mulatta V268 igkv JSUE03011484.1 115259 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca mulatta V269 igkv JSUE03011484.1 109779 VRCDIQMTQAPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca mulatta V270 igkv JSUE03011484.1 45608 SRGDIVMTQSPAFVSVTPGEKVTITCQVSEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Macaca mulatta V271 igkv JSUE03011484.1 29353 VRGDIQMTQSPSSLSASVGDTVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSYP
Macaca mulatta V272 igkv JSUE03011484.1 13793 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHN
Macaca mulatta V273 igkv JSUE03011486.1 88372 SSGDIVMTQTPLSLPITPGEPASISCRSSQSFLDSDDGYTYLDWYLQKPGQPPQPLIYFVSSRASGVPDRFSGSGSGSDFTLKISGAEADDVGVYYCMQCIEFI
Macaca mulatta V274 igkv JSUE03011486.1 75188 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLHWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHSYGTP
Macaca mulatta V275 igkv JSUE03011486.1 59800 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVKAEDVGVYYCMQALQTP
Macaca mulatta V276 igkv JSUE03011486.1 54806 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca mulatta V277 igkv JSUE03011486.1 35887 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca mulatta V278 igkv JSUE03011486.1 13999 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQHDNSP
Macaca mulatta V279 igkv JSUE03011778.1 60434 SGDIILSQTPASLTAPPGETVSISCQASAHVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca mulatta V280 igkv JSUE03011778.1 1974 TSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQLLIYEVSKRASGVPERFSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Macaca mulatta V281 trbv JSUE03029794.1 94911 VRSQTVHQWPATLVQPAGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Macaca mulatta V282 trdv JSUE03039296.1 131559 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca mulatta V283 ighv JSUE03040654.1 26440 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLASIYWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca mulatta V284 ighv JSUE03040654.1 11765 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGRISGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V285 ighv JSUE03040655.1 3036 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTISSYWMSWVCQAPGKGLEWLSDIYGSTMYYGDSVKGLFTVSRDNAKNSLSLQMNSLRAEDTAVYYCTR
Macaca mulatta V286 ighv JSUE03040656.1 73267 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYGMHWVRQAPGKGLEWVSSISYTGKTIYYADSVKGRFTVSRDNAKNSLSLQMSSLRAEDTAVYYCTR
Macaca mulatta V287 ighv JSUE03040656.1 68167 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSYISNGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca mulatta V288 ighv JSUE03040656.1 20268 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Macaca mulatta V289 ighv JSUE03040656.1 13588 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMHWVRQASGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYFQMDSLRAEDTAVYYCAR
Macaca mulatta V290 ighv JSUE03040656.1 1934 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Macaca mulatta V291 ighv JSUE03040657.1 64065 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKAEDTAVYYCAR
Macaca mulatta V292 ighv JSUE03040657.1 9102 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIAYLQMSSLKTEDTAVYYCTR
Macaca mulatta V293 trav JSUE03065389.1 2655 VNGQQIMQIPQYQHVQEGEDFTTYCNFSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V294 ighv JSUE03072323.1 593 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca mulatta V295 ighv JSUE03088957.1 824 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTTGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V296 ighv JSUE03090265.1 2355 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGVIIPLVGITNYAEKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V297 ighv JSUE03090999.1 752 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWISAINSAGSSTYYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAG
Macaca mulatta V298 iglv JSUE03112380.1 773 SAVSYELTQPRSVSVSPGQTARITCGGDNIGSKSVQWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V299 trav JSUE03118436.1 576 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRLETAKIPKALFVMTLNGDEKKKGRVRVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V300 trav JSUE03151030.1 5867 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V301 ighv JSUE03152737.1 6276 AQCEVQLVESGGGLVQPGGSLRPSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATEYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCAR
Macaca mulatta V302 ighv JSUE03152965.1 855 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Macaca mulatta V303 iglv JSUE03155588.1 1307 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHSPHWCQQKPGQAPRTLIYNTSFKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCL
Macaca mulatta V304 trav JSUE03159078.1 2495 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSSFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V305 iglv JSUE03182211.1 3992 SWAQSALTQAPSVSKSLGQSVTISCTGTSNDVGGYNDVSWYQQHPGTAPRLLIYEVSKRPSGVSDRFFVSKSGNTASLTISGLQAEDEAIYYCSSYRSG
Macaca mulatta V306 iglv JSUE03183477.1 3992 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V307 iglv JSUE03234892.1 543 SWAQAALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYAVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Macaca mulatta V308 trav JSUE03237934.1 6700 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLITLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V309 ighv JSUE03293907.1 1556 VLSQVQLQESGPGLVKPLETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQLSLKLSSVTAADTAVYYCAR
Macaca mulatta V310 igkv JSUE03305349.1 6359 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Macaca mulatta V311 trgv JSUE03309029.1 318 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQVGKAPQRLLYYDTSNSRVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCANWD
Macaca mulatta V312 trav JSUE03323810.1 16195 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V313 iglv JSUE03329199.1 4234 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V84 trav AEHK01279736.1 2505 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASSYFPWYKQELGKGPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca mulatta V85 trav AEHK01279739.1 9101 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCAV
Macaca mulatta V0 ighv AEHK01006713.1 3110 VQCEVQLVEPGGGLVQPGGSMRLSCAASGFTFSSYGMSWVHQTPGKGLEWVSTISGNGVSTWYPDAVKGQFTISRNNTKNSLYLQMNSLSVEDIAVYYCAK
Macaca mulatta V1 iglv AEHK01007696.1 3716 VDSETVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQTDDESDYYCMLYMGSGI
Macaca mulatta V2 iglv AEHK01007707.1 1289 QSMLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCSSLVIVIDPQESLTDFSGSKSGNLASLTITGLWPENEADYHCQS
Macaca mulatta V3 iglv AEHK01007716.1 1380 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca mulatta V4 iglv AEHK01007718.1 6038 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADGSYN
Macaca mulatta V5 iglv AEHK01007723.1 8296 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSPHDLGSGVPRRVSGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca mulatta V6 iglv AEHK01007723.1 35668 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQQGKAPRYLMWLKSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Macaca mulatta V7 iglv AEHK01007757.1 5831 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSSYVYWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDETDYYCQSYDSSS
Macaca mulatta V8 iglv AEHK01007760.1 427 CSDSGALTDCVPRRDSHSHLCFQYCAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLAGGKAALTLLGAQPEDEAEYYCWLYYSGA
Macaca mulatta V9 iglv AEHK01007760.1 9241 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPNWYQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLLGAQPEDEAEYYCWLYYSGA
Macaca mulatta V10 iglv AEHK01007760.1 17326 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLPITGLRSEDEADYYCEAWDNSLSS
Macaca mulatta V11 iglv AEHK01007761.1 7049 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAPPEDEAEYYCWLYYSGA
Macaca mulatta V12 iglv AEHK01007762.1 5557 SLSQPVLTQPTSLSASPGASASLTCTFSGGINVAGYHIHWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca mulatta V13 iglv AEHK01007763.1 1898 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSAWDSSLSG
Macaca mulatta V14 iglv AEHK01007766.1 4997 SLSQPVLTQPTSLSASPGASASLTCTFSGGINVAGYYIHWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca mulatta V15 iglv AEHK01007766.1 15971 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRSYVSWYQQVPGTAPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGTGDEADYYCGAWDSSLS
Macaca mulatta V16 iglv AEHK01007772.1 8462 SLSKPMLTQPASLSASPGASASLTCTFSGGINVAGYHIHWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCAI
Macaca mulatta V17 iglv AEHK01007773.1 1280 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca mulatta V18 iglv AEHK01007778.1 5010 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGFLRGGKAVLTITGAQPEDEAFYYCALW
Macaca mulatta V19 iglv AEHK01007798.1 5619 SVASYELTQPPLVSVSPGQTAKITCSGDVLAKYYAHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCYSGDDNN
Macaca mulatta V20 iglv AEHK01007798.1 15990 SAASYELTQPRSVSVSPGQTARITCGGDNIGSKNVQWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V21 iglv AEHK01007799.1 1859 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQVVYGNNNRPSGISERFSGSSSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca mulatta V22 iglv AEHK01007802.1 12303 SWAQAALTQPPSVSGSPGQSVTISCTGTSIASYSDVSWYQQHPGKAPRLLIYSVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYRSG
Macaca mulatta V23 iglv AEHK01007803.1 252 SATSYELTQPPSASAASGQTARITCGGDNIGSKNVHWYQQKPAQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Macaca mulatta V24 iglv AEHK01007803.1 19157 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Macaca mulatta V25 igkv AEHK01060336.1 179 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFDSDYANTYLDWYLQKPGQSPQLLIYMLSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSVEYP
Macaca mulatta V26 igkv AEHK01060348.1 931 SSGDIVTTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLYWYLQKPGQSPQFPMYFASYRASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQG
Macaca mulatta V27 igkv AEHK01060350.1 10365 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPELLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca mulatta V28 igkv AEHK01060372.1 5322 SSGDIVMTQTPLSLPITPGEPASISCRSSQSFLDSDDGYTYLDWYLQKPGQPPQPLIYFVSSRASGVPDRFSGSGSGSDFTLKISGVEADDVGVYYCMQCIEFI
Macaca mulatta V29 igkv AEHK01060373.1 353 SSGDIVMTQTPLSLPITPGEPASISCRSSQSFLDSDDGYTYLDWYLQKPGQPPQPLIYFVSSRASGVPDRFNGSGSGSDFTLKISGVEADDVGVYYCMQCIEFI
Macaca mulatta V30 igkv AEHK01060380.1 12339 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGADFTLTISSLQPEDIATYYCQQHDNSP
Macaca mulatta V31 igkv AEHK01060380.1 20314 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVLDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca mulatta V32 trbv AEHK01237780.1 2280 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca mulatta V33 trbv AEHK01237781.1 3623 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFVPECPDSSHLHLHLRGLQPEDSALYLCASSQ
Macaca mulatta V34 trbv AEHK01237782.1 2956 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCA
Macaca mulatta V35 trbv AEHK01237782.1 10566 SLDTAVSQTPKYLVTQTGKEEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKKLFINETVSNRFSPDSPDKARLILHIKPLELGDSAVYFCASSQ
Macaca mulatta V36 trbv AEHK01237784.1 6945 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVYFYNGEISEKSEIFEDRFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Macaca mulatta V37 trbv AEHK01237784.1 13467 LLDTAVFQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPESLDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca mulatta V38 trbv AEHK01237785.1 2086 PTDTGVTQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKVKKPPEIMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V39 trbv AEHK01237788.1 5118 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVYWYQQTPGQGLQFLFEYFSETQRQKGNFSNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca mulatta V40 trbv AEHK01237788.1 12721 PANADVTQSPKFQILKTGQSMTLKCAQDMNHNSMYWYRQDPGMGLRLIHYSAAEGTTDPGEVPDGYSVSRLNKKEFLLRLESAAPSQTSVYFCASSE
Macaca mulatta V41 trbv AEHK01237789.1 11474 SLDTAVSQTPKYLVRQTGKNESLKCEQNLGHDTMYWYKQDSKKLLKIIFSYNNKKLFINETVPYRFSPKSPDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca mulatta V42 trbv AEHK01237789.1 14945 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFVPECPDSSHLHLHLHALQPEDSALYLCASSQ
Macaca mulatta V43 trbv AEHK01237789.1 26669 PVNAGVTQTPKFQVLKTGQSLTVQCAQDMNHDCMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Macaca mulatta V44 trbv AEHK01237790.1 713 HTGAGVSQSPSNKVTEKGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca mulatta V45 trbv AEHK01237793.1 987 HTGAGVSQSPSNKVTEKGKDVVLRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAADDSGLRSDRVSATRPEGSFSTLKIQHTEQGDSAMYFCASSL
Macaca mulatta V46 trbv AEHK01237793.1 8714 SVDAGVTQTPKHLITAIGQQVTLRCSPRSGDRSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSALYFCASSE
Macaca mulatta V47 trbv AEHK01237793.1 16718 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca mulatta V48 trbv AEHK01237794.1 5057 FTEAGVAQSPRYKITEKSQTVAFWCDPISGHATLYWYQQILGQGPELLVQFQNKGVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V49 trbv AEHK01237795.1 8731 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca mulatta V50 trbv AEHK01237796.1 5803 LTEAGVAQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V51 trbv AEHK01237796.1 22922 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDSMYWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Macaca mulatta V52 trbv AEHK01237796.1 27143 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPAFLTYFQDDAQRDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca mulatta V53 trbv AEHK01237800.1 825 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGPGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSEMNVNALEAGDSALYLCASSL
Macaca mulatta V54 trbv AEHK01237800.1 4141 LVNVGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPLRLESADPSQTSVYFCASSY
Macaca mulatta V55 trbv AEHK01237800.1 8800 HTGARVSQSPRYKVTKRGQDVALRCDPISGHATLYWYQRALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTQQGDSAVYLCASSL
Macaca mulatta V56 trbv AEHK01237802.1 2092 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQALGQGPQLIFEYYEKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca mulatta V57 trbv AEHK01237808.1 7933 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCTSSL
Macaca mulatta V58 trbv AEHK01237808.1 27756 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V59 trbv AEHK01237808.1 34924 PVNAGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESADPSHTSVYFCGRSY
Macaca mulatta V60 trbv AEHK01237809.1 8647 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V61 trbv AEHK01237809.1 19250 HADAGVSQDPRHKITKTAQNVSFKCVPVSEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSFSTLMIQHTEQGDSAVYLCASSL
Macaca mulatta V62 trbv AEHK01237810.1 4315 SVAAGVTQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Macaca mulatta V63 trbv AEHK01237810.1 11485 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca mulatta V64 trbv AEHK01237811.1 6357 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca mulatta V65 trbv AEHK01237811.1 11957 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPEVSFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V66 trbv AEHK01237811.1 15223 HTDAGVIQSPQHEVTEMGKEVTLRCEPISVHTYLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPEVSFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V67 trbv AEHK01237814.1 5406 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca mulatta V68 trbv AEHK01237816.1 4130 HTEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFLRASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca mulatta V69 trbv AEHK01237816.1 9608 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca mulatta V70 trbv AEHK01237816.1 15427 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGYSYFFWYQRVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca mulatta V71 trbv AEHK01237819.1 10953 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Macaca mulatta V72 trbv AEHK01237819.1 14089 TMDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca mulatta V73 trbv AEHK01237821.1 3479 GSGLAAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca mulatta V74 trbv AEHK01237823.1 898 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINKRFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Macaca mulatta V75 trbv AEHK01237825.1 1099 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca mulatta V76 trbv AEHK01237831.1 3356 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca mulatta V77 trbv AEHK01237831.1 11191 LTEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca mulatta V78 trbv AEHK01237837.1 586 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSVNVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca mulatta V79 trbv AEHK01237837.1 5922 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca mulatta V80 trbv AEHK01237842.1 1262 SVFSAVISQKPSRDVCQRGTSVKIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca mulatta V81 trav AEHK01279731.1 24216 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca mulatta V82 trav AEHK01279732.1 902 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca mulatta V83 trav AEHK01279733.1 10973 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Macaca mulatta V86 trav AEHK01279740.1 5377 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPNLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca mulatta V87 trav AEHK01279740.1 10829 TARSQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDSMVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca mulatta V88 trav AEHK01279740.1 24991 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFFWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca mulatta V89 trav AEHK01279741.1 4084 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSINLVISASQVGDSATYFCAMR
Macaca mulatta V90 trav AEHK01279746.1 5316 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca mulatta V91 trav AEHK01279751.1 9615 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Macaca mulatta V92 trav AEHK01279756.1 3274 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca mulatta V93 trav AEHK01279757.1 3121 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPDLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca mulatta V94 trav AEHK01279758.1 3973 VNSQQGEEDPQALSIQEGENATMNCSYKTSITNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTLKKSSSLLITASRAADTASYFCAR
Macaca mulatta V95 trav AEHK01279760.1 2790 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca mulatta V96 trav AEHK01279760.1 6008 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRENTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYYSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Macaca mulatta V97 trav AEHK01331618.1 5614 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca mulatta V98 trav AEHK01331623.1 5700 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca mulatta V99 trav AEHK01331636.1 183 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca mulatta V100 trav AEHK01331637.1 3868 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca mulatta V101 trav AEHK01331640.1 5847 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNTDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca mulatta V102 trav AEHK01331642.1 2687 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca mulatta V103 trav AEHK01331649.1 3577 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V104 trav AEHK01331655.1 7781 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca mulatta V105 trav AEHK01331657.1 722 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Macaca mulatta V106 trav AEHK01331659.1 12121 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIYWYRQRPSQGPEYVIHGLTSNNNRMASLTITEDRKSSTLILHHATLRDAAVYYCILR
Macaca mulatta V107 trav AEHK01331660.1 3278 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Macaca mulatta V108 trav AEHK01331660.1 16182 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca mulatta V109 trav AEHK01331661.1 1653 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca mulatta V110 trav AEHK01331662.1 1690 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca mulatta V111 trav AEHK01331666.1 15515 SGMAQTVTQSQQEMSVQEAETVILSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca mulatta V112 trav AEHK01331667.1 5712 SGMAQTVTQSQQEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYR
Macaca mulatta V113 trav AEHK01331671.1 4796 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca mulatta V114 trav AEHK01331673.1 1998 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca mulatta V115 trdv AEHK01331685.1 1163 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca mulatta V116 ighv AEHK01377993.1 42 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYWWSWIRQPPGKGLEWIGRIDSSGSNYLNPSLKSRVTLSRDTSKNQFSLKLSSVTAADTAVYYCA
Macaca mulatta V117 igkv AEHK01399817.1 2492 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTHLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLTTP
Macaca mulatta V119 ighv AEHK01399960.1 1197 VQCVEQLVESGGGLVQPGASLRLSCAASEFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYIQMNSLRAEDTAVYYCAR
Macaca mulatta V120 igkv AEHK01399990.1 765 FSADVVMTQSPLSLPVTPGQPASISCRSSQSLLHSNGNTYLSWFLQKPGQPPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQG
Macaca mulatta V121 igkv AEHK01400002.1 4338 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSDGNTYLSWYQQKPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQGTKVP
Macaca mulatta V122 ighv AEHK01400025.1 3784 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca mulatta V123 igkv AEHK01401858.1 12414 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNYLNWYQQKPGKAPKLLIYYANRLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSDP
Macaca mulatta V124 igkv AEHK01401861.1 2210 TTGEIVMTQSPATLSLSPGERATLSCRASQSVGSTLAWYQQKPGQAPRVLIYDASSRVTGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Macaca mulatta V125 igkv AEHK01401862.1 7377 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNDLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFKNYL
Macaca mulatta V126 ighv AEHK01404152.1 10689 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Macaca mulatta V127 ighv AEHK01404152.1 19535 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTVSSYWMSWVRQAPGKGLEWLSDIYGSTMYYGDSVKGRFTVSRDNAKNSLYLQMNSLKTEDTAVYYCTR
Macaca mulatta V128 ighv AEHK01404948.1 2862 AHSEVQLVQSGAEVKKPGASVKVSCKVSGYTFTELSMHWVRQAPGKGLEWMGGVDPVYGEIIHAEKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V130 ighv AEHK01406484.1 8948 VQCEVQLVESGGGLVQPGGSLRLSCAASGFIFSDYYMQWVRQAPGKGPEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Macaca mulatta V131 ighv AEHK01406486.1 10831 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSGYEMHWVRQAPGKWLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Macaca mulatta V132 ighv AEHK01406486.1 16795 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Macaca mulatta V133 ighv AEHK01406486.1 26858 AHSEMQLVQSEAEVKKPGASVKISCKASGYTFTYRYLHWLRQTPGQGLEWMGWITPYNGNTNYAQKFQDRATITRDRSMSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V134 iglv AEHK01406769.1 11632 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca mulatta V135 iglv AEHK01406771.1 7434 SWAQAAPTQSPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca mulatta V136 iglv AEHK01406773.1 10762 SWAQSAPIQSPSVSGSLGQSVTISCAGTSSDIGRYNYVSWYRQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca mulatta V137 iglv AEHK01406776.1 9951 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSLRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V138 iglv AEHK01406783.1 2880 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSLRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V139 ighv AEHK01407727.1 5290 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Macaca mulatta V140 igkv AEHK01408093.1 3980 SSGDIVMIQTPLSLPVTLGEPASISCRSSQSLVYSDGKTYLYWYLQKPGQSPQLLMYLVSKRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Macaca mulatta V141 igkv AEHK01408093.1 12090 ARCDIQMTQSPSSPPASVGDTVTITCRASPGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYNTP
Macaca mulatta V142 ighv AEHK01408097.1 6979 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGRRTEYAASGKGRFTISRDDSKSIASLQMSSLKTEDTAVYYCAR
Macaca mulatta V143 ighv AEHK01408099.1 9869 VQCEVQLVESGGGLVKPGGSLRLSCVASGFTFSSYVMHWVRQAPGKGLEWVSVISESGGTTYYACCVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Macaca mulatta V144 igkv AEHK01411134.1 2241 SGGDIVMTQTPPSLPVTPGEPASISCRSSQSLLHTDGRTYLYWYLQKPGQPPRLLIYRVSNQFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca mulatta V145 igkv AEHK01411134.1 7848 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca mulatta V146 igkv AEHK01412319.1 10689 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINHYLSWYQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Macaca mulatta V147 ighv AEHK01413500.1 236 PRLLLRGAPSSSLQNRKEWLRCLFLPGPGFLFFFFFFLTALEWLASIYWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V148 ighv AEHK01414136.1 10646 AKSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGVIMPLVGVTNYAEKFQGRVTITTDTSTSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V149 iglv AEHK01415696.1 4336 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPHWFQQKPGQAPRGLIYNTNSKHSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca mulatta V150 trbv AEHK01416358.1 1284 LFSAGPGNAAVNQTPKFQVLKTGQSMTLQCAQDMNHECMSWYQQDPGMGLRLIHYSAAEGTTDPGEVPDGYSVSRLNKKEFLLRLESAAPSQTSVYFCGSSY
Macaca mulatta V151 igkv AEHK01417833.1 2178 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALEFP
Macaca mulatta V152 trav AEHK01446334.1 334 VNGQQIMQIPQYQHVQEGEDFTTYCNFSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V153 igkv AEHK01058278.1 1340 VRGDIQMTQCPSSLSASVGDTVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSYP
Macaca mulatta V154 igkv AEHK01058290.1 40019 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca mulatta V155 igkv AEHK01058290.1 10791 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGAYSRATGIPDRFRGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca mulatta V156 igkv AEHK01058290.1 5302 VRCDIQMTQAPSFLSASVGDRVTITCQGSQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca mulatta V157 igkv AEHK01058296.1 4904 STGDVAMTQSPLSLPVTLGQPASISCRSSQSLLHSNGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMEG
Macaca mulatta V158 igkv AEHK01058300.1 18049 SSGDIVMTQTPLSLPVALGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISSLESEDVGVYYCMQTLQTP
Macaca mulatta V159 igkv AEHK01058300.1 9776 TRCAIQMTQSPSSLSASLGDKVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca mulatta V160 igkv AEHK01060328.1 7089 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKGPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGI
Macaca mulatta V161 igkv AEHK01060331.1 5531 ARCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYAASGLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Macaca mulatta V162 igkv AEHK01060360.1 10930 SGDIILSQTPASLTAPPGETVSISCQASAHVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca mulatta V163 trbv AEHK01237854.1 20973 VRSQTVHQWPATLVQPAGSPLSVECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Macaca mulatta V164 trdv AEHK01331695.1 20536 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYCIRPDYNFQFVFYGDKSRSYGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca mulatta V165 ighv AEHK01343014.1 3199 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca mulatta V166 ighv AEHK01343030.1 6162 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGSTWYTDSVKGRFTISKENAKNPLYLQMDSLRTEDTAGYYCAK
Macaca mulatta V167 ighv AEHK01343037.1 6286 VQCEVQLVESGGGLVHPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVEGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCT
Macaca mulatta V168 ighv AEHK01343059.1 16223 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSSTTYGMNWVRQAPGQGLEWMGWMNTYTGSPTYAQGFTERFVFSMDTSVSTVYLQISSLKAEDTAVYYCAR
Macaca mulatta V169 igkv AEHK01377927.1 637 TTGEIVMTQSPATLALSPGERATLSCRASQSVGSTLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVAVYYCLQSSNW
Macaca mulatta V170 igkv AEHK01404947.1 14539 TSGDIVMTRTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLFWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVRVYYCLPDIQLP
Macaca mulatta V171 igkv AEHK01406158.1 2389 TTGETVMMQSPATLSLSPGERATLSCSASQSVGSTLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTEFTLTISSLDPEDVGVYYCQKYNDWP
Macaca mulatta V172 igkv AEHK01406161.1 1901 AKCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSAP
Macaca mulatta V173 igkv AEHK01406164.1 10275 TTGEIVMTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca mulatta V174 igkv AEHK01406694.1 486 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASSRVTGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Macaca mulatta V175 ighv AEHK01408523.1 14291 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYALSVKGRVTISRDDSKSITYLQMNNLKTEDTAVYYCAR
Macaca mulatta V176 ighv AEHK01408523.1 2400 VQCEVQLVESGGGLVQPGGTLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLKLEDTAVYYCAR
Macaca mulatta V177 ighv AEHK01410321.1 1102 AHSQEQLVQSGAEVKKPGASVKVSCKASGYIFTSYVISWLRQAPGQGFEWMGGIHPGYGSTSYAQKFQGRVTITADMSTSTVYMELSSLRSEDMAVYYCAA
Macaca mulatta V178 ighv AEHK01410322.1 3342 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V179 trav AEHK01412099.1 1583 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca mulatta V180 trav AEHK01412101.1 954 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V181 trav AEHK01412380.1 3845 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRVSVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V182 trdv AEHK01412382.1 6529 FSVAQKVTQAQSSVSMPVEKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIRQGSSEQNARDGRYSVNFKKEASFIALTISALQLEDSATYFCALRE
Macaca mulatta V183 trav AEHK01412387.1 1593 VRGIQVEQSPADLILQEGANSTLRCNYSATANNLQWVHQNPWGQLINLFYIASGTKQSGRLSATTVTTERYSFLHISFSQTTDSGIYFCAVESQCSP
Macaca mulatta V184 trav AEHK01412393.1 4231 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca mulatta V185 trav AEHK01412395.1 4175 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca mulatta V186 ighv AEHK01412772.1 1178 AAGAVWGLGEEAWASVKVSCNFSGFIITSYRIPWARQAPGQGLKWMGWNNSSNGNRVYKQKFKGRLTMTRDTSRSSAYTELSSLRSEDTAVYYCA
Macaca mulatta V187 ighv AEHK01413240.1 689 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTTGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V188 trbv AEHK01415286.1 2653 PVNAGVTQTPKFQILKTGQNMTLKCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASS
Macaca mulatta V189 ighv AEHK01415348.1 1992 VQCEVQLVESGGGLVQPGGALRVSCVASGFTFSDYGMAWVRQATGKGLEWVSSISQPSGSNTYYLDPVKGRFTISRDNAKNTLYLQINSLRAEDTAVYYCAR
Macaca mulatta V190 ighv AEHK01418441.1 534 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTTGTGVGWIRQPPGKGLEYLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V44 trav AANU01094772.1 15890 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca mulatta V0 iglv AANU01000039.1 4452 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V4 iglv AANU01004166.1 806 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQVPVLVIYKDSERPSGIPERFSGSSSGTTVTLTVSGAQAEDEADYYCYSGDGNS
Macaca mulatta V5 iglv AANU01004282.1 5098 SVASYELTQPPSVSVSLGQTAKITCSGDVLAKYYAHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCYSGDDNN
Macaca mulatta V8 trav AANU01007870.1 1500 VIGIQVEQSPPDLILQEGANSTLRCNYSATVNNLQWFHQNPWGQLINLFYIASGTKQNGRLSATTVTTERYSFLHISFSQTTDSGIYFCAVESQCSP
Macaca mulatta V11 trbv AANU01010951.1 4679 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca mulatta V15 ighv AANU01015240.1 596 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSNYWMYWFRQAPGKGLEWVSSISGSSSNTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V21 trbv AANU01024413.1 355 PVNAGVTQTPKFQVLKTGQSLTVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESADPSQTSVYFCGSSY
Macaca mulatta V22 ighv AANU01031089.1 227 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Macaca mulatta V25 iglv AANU01063861.1 215 SAVSYELTQPRSVSVSPGQTARITCGGDNIGSKSVQWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V26 ighv AANU01065946.1 773 VQCEVQLVESGGGLVQPGGSLRLSCAAPGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca mulatta V27 igkv AANU01067440.1 39 ARCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca mulatta V28 ighv AANU01085181.1 332 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGGIYSNSESTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V34 trdv AANU01094767.1 3494 FSVAQKVTQAQSSVSMPVEKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIRQGSSEQNARDGRYSVNFKKEASFIALTISALQLEDSATYFCALRE
Macaca mulatta V35 trav AANU01094767.1 12312 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSSFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V36 trav AANU01094768.1 3667 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSSFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V37 trav AANU01094768.1 11107 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLIFQFGEANKNSSLHITATQTTDVGTYFCA
Macaca mulatta V38 trav AANU01094769.1 6460 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSEGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V39 trav AANU01094769.1 15577 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca mulatta V40 trav AANU01094770.1 11722 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca mulatta V41 trav AANU01094770.1 31043 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Macaca mulatta V42 trav AANU01094771.1 7891 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTITEDRKSSTLILHHATLRDAAVYYCILR
Macaca mulatta V43 trav AANU01094772.1 2964 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Macaca mulatta V45 trav AANU01094774.1 7896 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFDLYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca mulatta V46 trav AANU01094777.1 3326 SGMAQTVTQSQQEMSVQEAETMILSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca mulatta V47 trav AANU01094777.1 12833 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYR
Macaca mulatta V48 trav AANU01094777.1 36437 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca mulatta V49 trav AANU01094777.1 53800 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca mulatta V50 trdv AANU01094778.1 43344 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca mulatta V51 trdv AANU01094779.1 7361 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTLGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca mulatta V63 ighv AANU01099956.1 5352 VQCEVQLVESGAGLVQPGGSLRLSCAASGFTFSNSWMSWVRQAPGKGLEWVARIKRKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Macaca mulatta V64 ighv AANU01099961.1 9647 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Macaca mulatta V65 ighv AANU01099964.1 3219 VQGVVQLVESEGNFVQPGGSLRLSCAVSGFTFSSCDLDWIRHAPGKGLEWVSGISIAGSTYYANSVNSLFAISRENAKNTLYLQMNSLIAEDTAIYYCVSE
Macaca mulatta V66 ighv AANU01099964.1 14618 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLDWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMSSLNTEDTAVYYCTR
Macaca mulatta V67 ighv AANU01099966.1 20699 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCT
Macaca mulatta V68 ighv AANU01099967.1 9307 VQCEVQLVESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPEEGLVWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca mulatta V69 ighv AANU01099972.1 12998 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWVRQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMDSLRAEDTAVYYCAK
Macaca mulatta V70 ighv AANU01099976.1 3288 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca mulatta V83 igkv AANU01104916.1 35994 CNGDIVLTQSPASLAVSPGQRATITCRASETVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca mulatta V84 igkv AANU01104916.1 53812 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQENSI
Macaca mulatta V85 igkv AANU01104917.1 4213 AKCDIQMTQSPSSLSASVGDKVTITCQASQSISSWLAWYQQKPGKAPKPLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSAP
Macaca mulatta V86 igkv AANU01104920.1 1381 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYDDLP
Macaca mulatta V88 igkv AANU01104950.1 9874 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVKAEDVGVYYCMQALQTP
Macaca mulatta V89 igkv AANU01104950.1 14869 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca mulatta V90 igkv AANU01104950.1 33788 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca mulatta V91 igkv AANU01104950.1 55666 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQHDNSP
Macaca mulatta V92 igkv AANU01104950.1 63631 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca mulatta V93 igkv AANU01104951.1 9218 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLHWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHSYGTP
Macaca mulatta V94 igkv AANU01104952.1 24617 SSGDIVMTQTPLSLPITPGEPASISCRSSQSFLDSDDGYTYLDWYLQKPGQPPQPLIYFVSSRASGVPDRFSGSGSGSDFTLKISGVEADDVGVYYCMQCIEFI
Macaca mulatta V95 igkv AANU01104954.1 3353 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGI
Macaca mulatta V96 igkv AANU01104956.1 7411 ARCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca mulatta V97 igkv AANU01104970.1 13491 SGDIILSQTPASLTAPPGETVSISCQASAHVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca mulatta V98 igkv AANU01104973.1 17665 TSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQLLIYEVSKRASGVPERFSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Macaca mulatta V99 igkv AANU01104973.1 22552 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQGIEYP
Macaca mulatta V127 trbv AANU01114155.1 37742 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVIFFDNNISEKSEIFEDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Macaca mulatta V128 trbv AANU01114155.1 44709 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKQLIINETVPNRISPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca mulatta V129 trbv AANU01114155.1 49353 PIDSGVTQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKVKKPPEIMFIYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V130 trbv AANU01114155.1 57575 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Macaca mulatta V131 trbv AANU01114155.1 65169 SLDTAVSQTPKYLVTQTGKEEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKKLFINETVSNRFSPDSPDKARLILHIKPLELGDSAVYFCASSQ
Macaca mulatta V132 trbv AANU01114155.1 73679 HTEPEVTQTPSHQVTRMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVYFYNGEISEKSEIFEDRFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Macaca mulatta V133 trbv AANU01114155.1 80197 PLDTAVFQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPESPDKAHLNLHIKSVELGDSAVYFCASSQ
Macaca mulatta V134 trbv AANU01114157.1 5054 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVSWYQQTPGQGLQVLFEYFSETQRQKGNFSNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca mulatta V135 trbv AANU01114157.1 12986 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSAAEGTTDPGEVADGYSVSRLNKTEFLLRLESAAPSQTSVYFCASSE
Macaca mulatta V136 trbv AANU01114158.1 10713 SLDTAVSQTPKYLVRQTGKNESLKCEQNLGHDAMYWYKQDSKKLLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca mulatta V137 trbv AANU01114158.1 14146 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFVYNFKERAENNSVPSRFVPECPDSSHLHLHLHALQPEDSALYLCASSQ
Macaca mulatta V138 trbv AANU01114162.1 8638 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAADDSGLRSDRVSATRPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca mulatta V139 trbv AANU01114162.1 16365 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSALYFCASSL
Macaca mulatta V140 trbv AANU01114162.1 24672 HRDAEIIQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca mulatta V141 trbv AANU01114163.1 336 FTEAGVAQSPRYKITEKSQTVAFWCDPISGHATLYWYRQILGQGPELLVQFQNKGIVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V142 trbv AANU01114163.1 12927 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca mulatta V143 trbv AANU01114163.1 22084 LTEAGVAQSPRYKVIEKSQAVTFWCNPISGHATLYWYQQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Macaca mulatta V144 trbv AANU01114163.1 39194 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDRMYWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Macaca mulatta V145 trbv AANU01114163.1 43427 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHEYLYWYQQALGQGPAFLTYFQNDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTQQGDSAVYLCASSL
Macaca mulatta V146 trbv AANU01114165.1 418 PVQAGVTQSPTHLIKTRGQQVTLRCSPISGHTNVYWYQQALGQGLQFILWYDEEEERDRGTFPPRFSGHQFPNYSSELNVNALEVEDSALYLCASSL
Macaca mulatta V147 trbv AANU01114166.1 1740 HTGARVSQSPRYKVTKRGQDVALRCDPISGHATLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca mulatta V148 trbv AANU01114166.1 12374 SVDTGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V149 trbv AANU01114166.1 23306 HTGAGVSQSPRYKVTERGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFNDKAQPDKSGLPNDRFSAERPEGSVSTLKIQRTEQRDSAVYLCASSL
Macaca mulatta V150 trbv AANU01114166.1 28374 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQLIFEYYEKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca mulatta V151 trbv AANU01114166.1 34404 LFSAGPGNAAVNQTPKFQVLKTGQSMTLQCAQDMNHECMSWYRQDPGMGLRLIHYSAAAGITDKGEVPNGYNVSRSNTEDFPLRLESAASSQTSVYFCGSSY
Macaca mulatta V152 trbv AANU01114169.1 8307 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCTSSL
Macaca mulatta V153 trbv AANU01114169.1 15742 PGNADVTQTPKFQVLKTGQSMTVQCAQDMNHDCMYWYRQDPGMGLKLIHYSVGAGITDKGEVPNGYNVSRLNTEDFPLRLESAALSQTSVYFCASS
Macaca mulatta V154 trbv AANU01114169.1 28133 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSNVYWYQQALGQGPQFIFQYYEKEERERGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca mulatta V155 trbv AANU01114170.1 3723 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKAQPDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca mulatta V156 trbv AANU01114172.1 304 PVDAGVVQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQALGQGPQLIFQYYRGEDRGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Macaca mulatta V157 trbv AANU01114172.1 11031 HADAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDLAMYLCASSL
Macaca mulatta V158 trbv AANU01114172.1 17853 SVAAGVIQSPRHLIKEKRETATLQCYPLPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASNL
Macaca mulatta V159 trbv AANU01114173.1 5392 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca mulatta V160 trbv AANU01114173.1 16431 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca mulatta V161 trbv AANU01114173.1 22032 HTDAGVIQSPRHKVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V162 trbv AANU01114173.1 25300 HTDAGVIQSPQHEVTEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPEVSFSTLKIQPSEPRDSAVYFCASSL
Macaca mulatta V163 trbv AANU01114173.1 40642 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca mulatta V164 trbv AANU01114173.1 47628 HTEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFLRASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca mulatta V165 trbv AANU01114174.1 3967 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca mulatta V166 trbv AANU01114174.1 9845 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGYSYFFWYQRVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca mulatta V167 trbv AANU01114174.1 24472 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Macaca mulatta V168 trbv AANU01114175.1 2294 TMDGRITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca mulatta V169 trbv AANU01114175.1 10234 GSGLAAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca mulatta V170 trbv AANU01114176.1 9717 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINKRFSAQCPQNSSCTLEIQSTESGDAALYFCASK
Macaca mulatta V171 trbv AANU01114176.1 18694 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca mulatta V172 trbv AANU01114177.1 10711 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca mulatta V173 trbv AANU01114177.1 18540 LTEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca mulatta V174 trbv AANU01114178.1 24744 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSVNVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca mulatta V175 trbv AANU01114178.1 30077 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca mulatta V176 trbv AANU01114179.1 9969 SVFSAVISQKPSRDVCQRGTSVKIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca mulatta V230 ighv AANU01128647.1 1482 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWNWIRQPPGKGLEWIGYIGGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V232 ighv AANU01128648.1 9767 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPRQGLEWMGWINPYNGNTKYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V233 ighv AANU01128649.1 3536 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQALGKGLEWVSSISNTGKTIYYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCTR
Macaca mulatta V234 ighv AANU01128650.1 2724 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLASIYWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V235 ighv AANU01128652.1 2386 VLSQVQLQESGPGLVKPSETLPLTCAVSGASISSNYWSWIRQAPGKGLEWIGRIYGSGGSTDYNPSLKSRVTISIDTCKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V236 ighv AANU01128658.1 4114 VQCVEQLVESGGALVQPGASLRLSCAASEFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V237 ighv AANU01128666.1 16831 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYYWSWIRQPPGKGLEWIGYITYSGSTSYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V238 ighv AANU01128673.1 1641 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYETGYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTT
Macaca mulatta V239 ighv AANU01128676.1 57 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGPEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Macaca mulatta V240 ighv AANU01128679.1 1333 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSGYEMHWVRQAPGKGLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCA
Macaca mulatta V241 ighv AANU01128694.1 1005 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYEMHWVRQAPGKGLEWVSVISESGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR
Macaca mulatta V242 ighv AANU01128694.1 4967 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEYIGYISGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V243 ighv AANU01128699.1 2387 VLSQVQLQESGPAVVKPSETLSLTCAVSGGSISSSNWWSWIRQSPGKGLEWIGGIYGSGGSTEYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCA
Macaca mulatta V244 ighv AANU01128721.1 3770 VLSQLQLQESGPGLVKPSETLSVTCAVSGGSISSSYWSWIRQAPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQLSLKLSSVTAADTAVYYCAS
Macaca mulatta V245 ighv AANU01128722.1 13110 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISDYYYWNWIRQPPGKGLEWIGNIYGNSASTYYNPSLKSRVTISKDTSKNQFFLKLSSVTAADTAVYYCAR
Macaca mulatta V246 ighv AANU01128725.1 2200 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISDSYWWSWIRQPPGKGLEWIGYIYGSSTSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V247 ighv AANU01128725.1 47190 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGNIGGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCA
Macaca mulatta V248 ighv AANU01128725.1 74958 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMHWVRQASGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYFQMDSLRAEDTAVYYCAR
Macaca mulatta V249 ighv AANU01128725.1 82726 VKCEAQLMETGGGLVQPGGSLRLSCADSGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRFTISRDDSKSITYLQMNNLKTEDTAVYYCAR
Macaca mulatta V250 ighv AANU01128725.1 86235 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGRISGSGGSTSDNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V251 ighv AANU01128725.1 94588 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLKLEDTAVYYCAR
Macaca mulatta V252 ighv AANU01128727.1 29067 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSSTRINWIRQSPGKRLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca mulatta V253 ighv AANU01128728.1 3267 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSSWISWVRQMPGKGLEWMGSIYPGDSDTKYNPSFQGHVTISADKSISTTYLQWSSLKASDTATYYCAK
Macaca mulatta V254 ighv AANU01128729.1 20139 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca mulatta V255 ighv AANU01128730.1 8440 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSPRAEDTAVYYCAR
Macaca mulatta V256 ighv AANU01128730.1 17781 VQCEVQLVAYGGGLEQPGGSLRLSCGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLKTEDTAVYYCAR
Macaca mulatta V257 ighv AANU01128731.1 8807 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca mulatta V262 ighv AANU01131001.1 4656 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMDWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKNTAYLQMSSLKTEDTAVYYCTR
Macaca mulatta V263 ighv AANU01131004.1 3347 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPSRKTLEWLAHIYWDDDKRYSTSLKSRLTISKDTSKNQVVLTMTNMDPMDTATYYCARR
Macaca mulatta V264 ighv AANU01131004.1 18021 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGRISGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V265 ighv AANU01131005.1 5226 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTISSYWMSWVCQAPGKGLEWLSDIYGSTMYYGDSVKGLFTVSRDNAKNSLSLQMNSLRAEDTAVYYCTR
Macaca mulatta V266 ighv AANU01131006.1 9907 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQINSLKIEDTAVYYCT
Macaca mulatta V267 ighv AANU01131007.1 43720 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Macaca mulatta V268 ighv AANU01131007.1 50382 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Macaca mulatta V269 ighv AANU01131009.1 8005 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYGMHWVRQAPGKGLEWVSSISNTGKTVYYADSVKGRFTVSRDNAKNSLSLQMSSLRAEDTAVYYCTR
Macaca mulatta V270 ighv AANU01131011.1 1169 AQCEVQLVESGGGLVQPGGSLRPSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATEYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCAR
Macaca mulatta V271 ighv AANU01131011.1 11100 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSIAYLQMSSLKTEDTAVYYCTR
Macaca mulatta V272 ighv AANU01131013.1 10372 AHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKGEDTAVYYCAR
Macaca mulatta V278 igkv AANU01150886.1 184 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIHEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca mulatta V306 trav AANU01176981.1 9526 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca mulatta V307 trav AANU01176985.1 2731 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca mulatta V309 trav AANU01176993.1 6343 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYVTGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca mulatta V310 trav AANU01176993.1 18499 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca mulatta V311 trav AANU01176993.1 37234 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca mulatta V312 trav AANU01176994.1 3369 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca mulatta V313 trav AANU01176996.1 15746 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYHKETTSFHLEKDSVQESDSAVYFCALS
Macaca mulatta V314 trav AANU01176996.1 28980 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca mulatta V315 trav AANU01177000.1 880 VWSQQKEVEQDSGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Macaca mulatta V316 trav AANU01177000.1 6320 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca mulatta V317 trav AANU01177003.1 10716 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNAHEKKNQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca mulatta V318 trav AANU01177003.1 33295 VWSQQKVEQNSGPLNVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCAV
Macaca mulatta V319 trav AANU01177003.1 45359 TARSQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDSVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca mulatta V320 trav AANU01177003.1 59214 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFFWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca mulatta V321 trav AANU01177004.1 4822 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca mulatta V322 trav AANU01177004.1 23143 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca mulatta V323 trav AANU01177006.1 12916 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLRLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca mulatta V324 trav AANU01177007.1 8032 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca mulatta V325 trav AANU01177007.1 17500 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTLKKSSSLLITASRAADTASYFCATD
Macaca mulatta V326 trav AANU01177007.1 29724 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca mulatta V327 trav AANU01177007.1 32943 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRQNSFDEQNEINGRYYSNFQKSTSSFNLTITASQIVDSAVYFCALNE
Macaca mulatta V328 trav AANU01177010.1 6601 LSGEDQVTQSPEALSLQEGDSSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca mulatta V329 trav AANU01177010.1 16953 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAV
Macaca mulatta V414 iglv AANU01210659.1 20205 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRAGKAVLAITGAQPEDEAFYYCALW
Macaca mulatta V637 ighv AANU01300806.1 632 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSSVSGSSSNTYYPDSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Macaca mulatta V638 ighv AANU01300866.1 456 VQCEVQLVAYGGGLEQPGGSLRLSCGFTFSDHYMSWVCQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLNTEDTAMYYCAR
Macaca mulatta V639 igkv AANU01300896.1 182 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNNLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Macaca mulatta V640 ighv AANU01300995.1 267 VLSQVQLQESGPGLVKPLETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca mulatta V641 ighv AANU01001652.1 1229 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVSSISSGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Macaca mulatta V642 ighv AANU01001655.1 2203 AHSEVQLVQSGAEVKKPGASVKISCKASGYTFTDYYLHWVRQAPGKGLEWMGRVDPEDGEAIHAQKFQDRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Macaca mulatta V643 igkv AANU01002881.1 1214 ARCDIQMTQSPSSLSASVGDTVTITCQASQGIGNNLNWYQQKPGKAPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca mulatta V644 igkv AANU01002883.1 1599 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca mulatta V646 iglv AANU01004003.1 6970 SVVSSGLTQEPALSVALGHTVRMTCQGDSLKTYYGWYQQKPGQVPVLVVYGNNYRPSGIPERFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca mulatta V647 iglv AANU01004003.1 482 SWAQSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Macaca mulatta V648 trbv AANU01007801.1 4090 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca mulatta V650 iglv AANU01009059.1 1749 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Macaca mulatta V654 iglv AANU01015434.1 1582 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V655 iglv AANU01015435.1 6169 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFILWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V656 ighv AANU01015739.1 1361 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Macaca mulatta V661 igkv AANU01018014.1 579 SSGDVVMTQSPLSLPITPGQPASISCRSSQSFVHSDGNTYLSWYQQKPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQGTKVP
Macaca mulatta V664 iglv AANU01025908.1 699 SAASYELTQPPSVSVSPGQMARITCGGDNIGSKNVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V668 trbv AANU01052768.1 1144 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDRSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSGLYFCASSE
Macaca mulatta V669 ighv AANU01053589.1 478 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTTGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca mulatta V670 igkv AANU01055052.1 871 ARCDIQMTQSPSSLSASVGDRVTVTCRASQGINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYSYP
Macaca mulatta V678 trav AANU01094773.1 1597 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca mulatta V679 trdv AANU01094779.1 54804 RGMLCDKVTQSSPDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca mulatta V693 ighv AANU01099958.1 4614 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSNYWMHWVRQAPGKGLEWISAINSAGSSTYYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAG
Macaca mulatta V704 igkv AANU01104903.1 981 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGSDFTLTISGLQAEDVAVYYCQQYY
Macaca mulatta V705 igkv AANU01104911.1 1837 ARAEMILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Macaca mulatta V706 igkv AANU01104915.1 5047 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Macaca mulatta V707 igkv AANU01104916.1 61512 ARAETILTQSAAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca mulatta V708 igkv AANU01104923.1 62034 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPKLLIYGASSRATGIPDGFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Macaca mulatta V709 igkv AANU01104923.1 19106 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Macaca mulatta V710 igkv AANU01104924.1 15654 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLLYKAPGLQSGVPSMFSGSGSGTDFTLTISSLQPEYFATYYCQQFSSAL
Macaca mulatta V711 igkv AANU01104925.1 4594 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYKSYP
Macaca mulatta V712 igkv AANU01104926.1 55208 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISNALAWYQQKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQRNSYP
Macaca mulatta V713 igkv AANU01104926.1 43520 ARCDIQMSQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYANSLASRVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQGNSNP
Macaca mulatta V714 igkv AANU01104926.1 25030 TTGEIVMTQSPATLSLSPGETATISCRTSQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Macaca mulatta V715 igkv AANU01104930.1 22101 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISDYLSWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQGYSTP
Macaca mulatta V716 igkv AANU01104930.1 11555 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYDASNRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQQESNW
Macaca mulatta V717 igkv AANU01104931.1 13567 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Macaca mulatta V718 igkv AANU01104931.1 6944 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Macaca mulatta V719 igkv AANU01104933.1 29241 TAGEIVMTQSPATLSLSPGETATLSCRASESVGSYLAWYQQKPGQAPKLLVHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLL
Macaca mulatta V720 igkv AANU01104935.1 343 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNDLNWYQQKPGKAPKLLIYAASSLESEVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQPFKNYL
Macaca mulatta V721 igkv AANU01104937.1 17152 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYNSDP
Macaca mulatta V722 igkv AANU01104937.1 2208 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNW
Macaca mulatta V723 igkv AANU01104938.1 19191 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca mulatta V724 igkv AANU01104939.1 1637 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Macaca mulatta V725 igkv AANU01104941.1 30947 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca mulatta V726 igkv AANU01104941.1 25467 VRCDIQMTQAPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca mulatta V727 igkv AANU01104945.1 19517 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca mulatta V728 igkv AANU01104947.1 15866 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca mulatta V729 igkv AANU01104947.1 7602 ARCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca mulatta V730 igkv AANU01104948.1 19727 SSGDVVMTQSPLSLPITPGQPASISCRSSQSFVHSDGNTYLSWYQQKPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQGTKVP
Macaca mulatta V731 igkv AANU01104958.1 18743 TSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYHCMQG
Macaca mulatta V732 igkv AANU01104961.1 72812 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQPLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQY
Macaca mulatta V733 igkv AANU01104961.1 50117 SSGDIVMIQTPLSLPVTLEEPASISCRSSQSLVYSDGKTYLYWYLQKPGQSPQLLMYLVSKRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Macaca mulatta V734 igkv AANU01104961.1 42016 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYNTP
Macaca mulatta V735 igkv AANU01104961.1 33925 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTHLHWYLQKPGQSPQLLMYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Macaca mulatta V736 igkv AANU01104961.1 8843 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLFWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQDIQLP
Macaca mulatta V737 igkv AANU01104961.1 621 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSGLAWYQQKPGKAPKLLIYAASRLQSGIPSRFSGSGSGTDFTLTISSLQPEDSAAYYCQQVYSNP
Macaca mulatta V738 igkv AANU01104962.1 8951 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca mulatta V739 igkv AANU01104963.1 23190 ARCDIQMTQSPSSLSASVGDTVTITCRASQGINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYNTP
Macaca mulatta V740 igkv AANU01104969.1 7088 SSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP
Macaca mulatta V765 trbv AANU01114156.1 5712 PTDTGVTQTPKHLVMGMTNKKSLKCEQHMGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca mulatta V766 trbv AANU01114159.1 2681 PVNAGVTQTPKFQVLKTGQNMTLKCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSEATV
Macaca mulatta V767 trbv AANU01114189.1 9685 VRSQTVHQWPATLVQPAGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Macaca mulatta V798 ighv AANU01128716.1 2174 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSYAISWVRQAPGQGLEWMGVIIPLVGITNYAEKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca mulatta V799 igkv AANU01129080.1 12017 TTGETVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQESNWK
Macaca mulatta V800 igkv AANU01129082.1 7692 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSYP
Macaca mulatta V801 igkv AANU01129082.1 3240 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTVSSLEPEDFAVYFCQQESNW
Macaca mulatta V808 iglv AANU01131255.1 8166 SAASYDLTQPPSVSVSPGQTARITCGGDNIGSEVVNWYQQKPPQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDISSDH
Macaca mulatta V809 iglv AANU01131255.1 723 SVVSSGLTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca mulatta V810 igkv AANU01139184.1 760 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNYLSWYQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Macaca mulatta V811 ighv AANU01146865.1 1856 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYWMNWVRQTPGKGLEWISAINSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca mulatta V814 iglv AANU01162709.1 530 SWAQSAPTQPPSVSGSPGQSVTISCTGTSSDIGYYNAVSWYQQHPGTAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Macaca mulatta V836 trav AANU01177014.1 1629 VRGIQVEQSPADLILQEGANSKLRCNFSATVSNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTTERYSLLHISSSQTTDSGIYFCAVKSQCSP
Macaca mulatta V837 trav AANU01177016.1 2970 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRLETAKIPKALFVMTLNGDEKKKGRVRVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Macaca mulatta V838 trav AANU01177017.1 16759 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLITLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca mulatta V839 trav AANU01177017.1 5856 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Macaca mulatta V919 iglv AANU01210623.1 19682 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIFWYQQRPGRSPRYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca mulatta V920 iglv AANU01210630.1 14108 SWAQAALTQSPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca mulatta V921 iglv AANU01210631.1 7496 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca mulatta V922 iglv AANU01210636.1 4784 SWAQAAPTQSPSVSGSAGQSVTISCTGTSSDIGYYNAVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGT
Macaca mulatta V923 iglv AANU01210639.1 1342 SWAQAALTQPPSMSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca mulatta V924 iglv AANU01210640.1 17097 SWAQAALTQPPSVSKSLGQSVTISCAGTSSGIASYSDVSWYQQHPGTAPRLLIYRVSNRPSGVSDRFSGFKSGSTASLTISGLQAEDEAIYYCCSYRSG
Macaca mulatta V925 iglv AANU01210640.1 8688 SATSYELTQPPSVSAASGQTARITCGGDNIGSKNVHWYQQKPAQAPVLVIYADSKRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSKY
Macaca mulatta V926 iglv AANU01210641.1 14311 SAASYDVTQPRSVSVSPGQTARITCGGDNIGSKVVHWYQQKPAQAPVLVIYRDSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V927 iglv AANU01210641.1 6670 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVVYGNNNRPSGIPERFSGSSSGNTASLTITGAQVEDEADYYCDSWDSSGTH
Macaca mulatta V928 iglv AANU01210642.1 18435 SAVSYELTQPPSVSVSPGQTARITCGGDNLGSKYVHWYQQKPAQAPVLVIYYDSDRPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca mulatta V929 iglv AANU01210642.1 13957 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGTH
Macaca mulatta V930 iglv AANU01210642.1 7465 SWAQAALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYAVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Macaca mulatta V931 iglv AANU01210660.1 49383 SLSKPMLTQPASLSASPGASASLTCTFSGGINVAGYHIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Macaca mulatta V932 iglv AANU01210660.1 44835 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca mulatta V933 iglv AANU01210663.1 21160 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYDVYWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLTITGLQSEDEAEYYCETWDNSLNG
Macaca mulatta V934 iglv AANU01210663.1 16151 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYYVYWYQQFPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDSSLS
Macaca mulatta V935 iglv AANU01210663.1 10327 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVSWYQQLPGTTPKLLIYQDNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYYCLSYDSSLS
Macaca mulatta V936 iglv AANU01210666.1 7223 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHSPHWCQQKPGQAPRTLIYNTSFKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCL
Macaca mulatta V937 iglv AANU01210667.1 5842 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca mulatta V938 iglv AANU01210667.1 1266 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDSSLSG
Macaca mulatta V939 iglv AANU01210668.1 20955 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPHWFQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCWLYYSGA
Macaca mulatta V940 iglv AANU01210668.1 11430 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGMAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCEAWDNSLSG
Macaca mulatta V941 iglv AANU01210668.1 2358 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDKAEYYCWLYYSGA
Macaca mulatta V942 iglv AANU01210669.1 18691 SLSQPVLTQPSSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Macaca mulatta V943 iglv AANU01210669.1 11945 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRIFWYQQKPGSPPRYLLNYHTDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Macaca mulatta V944 iglv AANU01210669.1 7306 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDNSLSS
Macaca mulatta V945 iglv AANU01210670.1 22005 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca mulatta V946 iglv AANU01210670.1 12679 SWAQSVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVNKRPSGVSDRFSGSQSGTSATLGISGLRPEDEADYYCSAWDSSL
Macaca mulatta V947 iglv AANU01210670.1 7339 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSQSGTSASLTITGLQSEDEADYYCQSYDSSLS
Macaca mulatta V948 iglv AANU01210673.1 15520 SWAEVVFTQPHSVSGSPGQTVTISCTHSSGSIDNSYVYWYQQRPGSAPTTVIYNDDQRPSGVPDRSSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSG
Macaca mulatta V949 iglv AANU01210689.1 16320 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQQGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Macaca mulatta V950 iglv AANU01210691.1 60585 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGNAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADGSYN
Macaca mulatta V951 iglv AANU01210691.1 19873 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRISGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca mulatta V952 iglv AANU01210692.1 5918 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSYDSYN
Macaca mulatta V953 iglv AANU01210693.1 5236 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca mulatta V954 iglv AANU01210697.1 12612 QSMLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCSSLVIVTDPQESLTDFSGSKSGNLASLTITGLWPENEADYHCQS
Macaca mulatta V955 iglv AANU01210704.1 6809 VDSETVVTQEPSLSVYPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCTLYMGSGI
Macaca mulatta V983 trgv AANU01218518.1 1955 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACWD
Macaca mulatta V985 trgv AANU01218521.1 34426 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Macaca mulatta V986 trgv AANU01218521.1 29696 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYGSTRNNLRLILRNVIENDSGVYYCANWD
Macaca mulatta V987 trgv AANU01218521.1 25302 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Macaca mulatta V988 trgv AANU01218521.1 15781 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQVGKAPQRLLYYDTSNSRVVLESGISPGKYDSYGSTRNNLRLRLRNLIENDSGVYYCANWD
Macaca mulatta V989 trgv AANU01218521.1 1013 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Macaca mulatta V1108 trav AANU01276022.1 1397 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Macaca mulatta V1158 ighv AANU01300715.1 588 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca mulatta V1159 ighv AANU01300716.1 1338 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMHWVRQASGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Macaca mulatta V1160 igkv AANU01300775.1 543 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Macaca mulatta V1161 ighv AANU01300961.1 762 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSSYWSWIRQAPGKGLEWIGYIYGSGSSTNYNPSLKSRVTLSVDTSKNQLSLKLSSVTAADTAVYYCAR
Macaca mulatta V1162 trdv AANU01300996.1 1039 SSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYYLFWYEQLPGKEMIFLIRQGSSEQNARNGRYSVNFKKEASSIALTISALQLEDSAMYFCALWE