WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Otolemur garnettii AAQR00000000.3 (AAQR03) 218 9 41 49 65 31 13 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Otolemur garnettii V214 trbv AAQR03083276.1 198491 VRPQTIHQWPVTSVQLRGSPLSLECTVKGTSNPNLYWYRQVNGGPLQLLFYSFGVDQIESEGLQNLLTSRTHESQFFLSSKKLLLSDSGFYLCAWS
Otolemur garnettii V310 trdv AAQR03130769.1 6895 AHTQVVQVNDSMYGFIGTDVVLHCNFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLVPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Otolemur garnettii V317 iglv AAQR03136094.1 19885 SLSQPVLTQPPSLSASPGASARITCTLSSGFVVSGYHMSWYQQRPGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDASANAGILHISGLQADDEADYYCCTYHG
Otolemur garnettii V318 iglv AAQR03136094.1 27224 SLSQPVLTQLPSASASLGASVRLTCTLSSGHSSYPITWYQQQPGKAPRYLIWLYSDGSSSKRDGIPDHFNGFGSGTDHYLTISNLQSEDKADYYCQTYDSSGT
Otolemur garnettii V361 igkv AAQR03150981.1 1527 ASCAIQMTESPSSLSASLGDTVTITCQASQSISRWLTWYQQKPGKSPKLLIYDASNLVPGVPSRFRGSGSGTDYSLTISGLQAEDVADYYCLQRNSFP
Otolemur garnettii V362 igkv AAQR03150983.1 3369 ASCDIQMTQSPSSLSASLGDTVTITCRASQGISKYLNWYQQKPGKSPKLLIYDTSNLATGVPSRFRGSGSGTDFSLTISGLQAEDVADYYCLQYNDW
Otolemur garnettii V363 igkv AAQR03150985.1 2177 ASCAIQMTQSPPSLSASLGDTVTITCRASQGINNYLAWYQQKPGKSPKPLIFSASNLATGVPSRFRGSGSGTDFSLTISGLQAEDVADYFCLQHRSFP
Otolemur garnettii V364 igkv AAQR03150987.1 724 ASCAIQMTQSPSSLSASVGDTVTITCRASQGIRNYLAWYQQKPGKSPQLLIYDASKLATGVPSRFRGSGSGTDYSLTISGLQAEDFADYFCQQYNNW
Otolemur garnettii V365 igkv AAQR03150987.1 9589 AICTIQMTQSPSSLSASVGDTVTITCQASQDINQYLDWYQQKPGTSPKLLIYGATTLQSGVPSRFSGSRSGTDFTFTISGLQAEDFASYYCLRRNSWP
Otolemur garnettii V366 igkv AAQR03150989.1 228 ASCAIQMTQSPPSLSASLGNTVTITCQASQSISRWLAWYQQKPGKSPKLLIYDASNLVTGVPSRFRGSGSGTDFSLTISGLQAEDVADYYCQQHNSSP
Otolemur garnettii V367 igkv AAQR03150991.1 1479 ASCDIQMTQSPSSLSASLGDTVTITCRASQGISKYLNWYQQKPGKSPKLLIYYTSNLETGVPSRFSGSGSGTDYSLTISGLQAEDIADYYCEQYNNW
Otolemur garnettii V368 igkv AAQR03150993.1 6454 ASCDIQMSQSPSSLSASLRDTVTITCQASQGISSWLAWYQQKPGKSPKLLIYAASNLQSGVPSRFRGSGSGKDFTLTISGLQAEDFATYYCQQYNSWP
Otolemur garnettii V369 igkv AAQR03150994.1 4295 ASCAIQMTQSPPSLSASLGDTVTITCKASQSISRRLAWYQQKPGKSPKLLIYYASNLATGVPSRFRGSGSGTDCSLTISGLQAEDVADYYCLQGYSSP
Otolemur garnettii V370 igkv AAQR03150994.1 15642 ASCDIQMTQSPSSLSASLGDTVTISCQASQGISKYLNWYQQKPGKSPKLLIYYTSNLETGVPSRFSGSGSGTDYSLTISGLQAEDVADYFCQQHNSSP
Otolemur garnettii V371 igkv AAQR03150998.1 346 SSGDIVMTQTPLSLPVTPGEPVSISCRSSQSLLDSDGKTYLNWYLQKPGHSPQLLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCLQNL
Otolemur garnettii V372 igkv AAQR03150999.1 616 ASCAIQMTQSPSFLSASVGDTVTITCKASQGINRWLAWYQQKPGASPKLLIYGASTLQSGVPSRFSGSGSGTDFTLTIRGLQAEDFANYYCLQRNSWP
Otolemur garnettii V373 igkv AAQR03151000.1 2295 ASCNIQMTQSPSSLSASVGDTVTITCKASQGISNYLAWYQQKPGTSPKLLIYYASTLQSGVPSRFSGSGSGTDFTLTISGLQAEDFASYYCMQGNSWP
Otolemur garnettii V374 igkv AAQR03151005.1 1272 AKCDIQMTQAPSSLSASVGDKVTITCQASQEISNYLNWYQQKPGKSPKLLIKRISTLQPGVPSRFSGSGSGTHFTLTISRLQAEDFATYYCQQWDSFP
Otolemur garnettii V375 igkv AAQR03151007.1 8572 ASCAIQMTQSPSSLSASLGDTVTIRCQASQGINNELNWYQQKPGASPKLLIYAASTLQSGVPSRFSGSGYGTDFTLTISGLQAEDAATYYCQNDYG
Otolemur garnettii V376 igkv AAQR03151011.1 3544 ARCDIQMTQSPSSLSASLGDTVTIRCQASQGINKALIWFQQKPGSSPKRLIYAASTLQSGVPSRFRGSGSGTDFTLTISGLQAEDFASYYCLQVKSWP
Otolemur garnettii V377 igkv AAQR03151011.1 9853 SSGDIVMTQTPLSLVVTPGEPASISCRASKSLLHSNGKTYLHWFLQKPGQSPQRLIYRVSNRDPGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCMHGLEA
Otolemur garnettii V378 igkv AAQR03151012.1 3376 ARCDIQMTQSPSSLSASLGDTVTIRCQASQGISNELSWYQQKPGASPKLLIYAASTLQSGVPSRFRGSGSGADYTLTISGLQAEDFASYYCLKDYRWP
Otolemur garnettii V379 igkv AAQR03151012.1 9618 SSGDIVMTQTPLSLVVTPGEPASISCRASKSLLYSDGKTYLYWFLQKPGQSPQRLIYRVSNRDPGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCLQALEY
Otolemur garnettii V380 igkv AAQR03151013.1 1600 SSGDIVMTQTPLSLAVTPGEPASISCRASKSLLHSNGKTYLHWFLQKPGRSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCMHDLEA
Otolemur garnettii V381 igkv AAQR03151014.1 3708 SSGDIVMTQTPLSLPITPGEPASISCRASQSLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCMQALEV
Otolemur garnettii V382 igkv AAQR03151016.1 4287 ARCDIQMTQSPSSLSASLGDTVTIRCQASQGISNYLSWFQQKPGSSPKRLIYAASTLQSGVPSRFRGSGSGTDYTLTISGLQAEDLATYYCLQDYTIP
Otolemur garnettii V383 igkv AAQR03151016.1 10541 SSGDIVMTQTPLSLSVTPGEPASISCKASKSLLHSNGNTYLYWFLQKPGRSPQRLIYKGSNRDSGVPDRFSGSGSGTDFTLKISRVQAEDAGDYYCSQALED
Otolemur garnettii V384 igkv AAQR03151021.1 3341 ARCDIQMTQSPSSLSATLGDTVTIRCQTSQGISNELSWYQQKPGASPKLLIYAASTLQSGVPSRFRGSGSGTDFTLTISGLQAEDFASYYCLQDYNNP
Otolemur garnettii V385 igkv AAQR03151025.1 2078 SSGDIVMTQTPLSLAVTPGEPASISCKASKSLLHSNRYTYLYWFLQKPGRSPQHLIYGGSNLDSGVPDRFSGSRSGTDFTLKISRVQPEDAGVYYCMQALEF
Otolemur garnettii V386 igkv AAQR03151026.1 751 SSGDIVMTQTPLSLAVTPGDPVSISCRASKSLLHSDGNTYSYWFLQKPGRSPQRLIYFVSNRASGVPDRFNGSGSGTDFTLKISRVQAEDAGDYYCSQGLEY
Otolemur garnettii V387 igkv AAQR03151029.1 3599 SSGDIVMTQTPLSLPITPGEPASISCRASQSLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVQAEDAGVYYCMQALEV
Otolemur garnettii V388 igkv AAQR03151032.1 3744 SHEATVLTQSPSLVSVAVGESVSISCKASQSLIHSDGNTYLNWFQQKPHQSPQLLIYKVSDRAPGVPARFSGSGSGTDFSLTVTSVEPGDAAQYFCEQ
Otolemur garnettii V389 igkv AAQR03151033.1 3639 SSGDIVMTQTPLSLSITPGEPTSISCRSSQSLLGSDGITYLYWYLQKPGQSPQRLIYKVSNQDSGVPDRFSGSGSGTNFTLKISKVEAEDAGVYYCAQA
Otolemur garnettii V390 igkv AAQR03151034.1 4586 SGDITLTQTPASLSAHPGETVSISCQASADVHGELSWIRIKLGQRLEPLISHVTTLAPGVPNRYSSRGSGNSYVFSISTLEPGDSGEYYCMH
Otolemur garnettii V391 igkv AAQR03151035.1 4147 SNGAIVMTQSPLSLPVTPGEPASISCRSSQNLLHTSGLNLMSWYLQKPGQSPQPLIYFGLNRAPGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGLQLP
Otolemur garnettii V392 igkv AAQR03151036.1 661 ASCAIQMNQSPSSLSASLGDTVTITCRANQGISNNLNWYQQKSGSSPNLLIYYASNLYTGVPSRFRGSGSGTGFTLTISGLQAEDVATYYCVLDYSWL
Otolemur garnettii V393 igkv AAQR03151036.1 9155 LKLGKSVTQSPPTLALYPGDRTTITCTTNPNEKTKFAWYQQRPGQFPKVLVYDTSTRASGVPTRFSGNHSGTDFTLTISNVDTTDVATYYCHEWP
Otolemur garnettii V435 trav AAQR03175665.1 863 FSVAQTVTQTQPEMSVQEGEIVTLSCTYDTSYTNYILYWYKQLPSGQMVFVIAQESEQQNARQNRFYVNFHKAAKFISLTISDSQLKDTAVYFCALRE
Otolemur garnettii V436 trav AAQR03175666.1 7869 SSMAQTVTQTQPEMSVREGESVTLRCTYRTSYTYYDLYWYKQLPSGQMVFVIGQASDQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALRE
Otolemur garnettii V437 trdv AAQR03175670.1 32140 VSLDIILESDNETLTVLAGEPATLRCRITRGNLRNYQMSWYKKNEDNSLILMYKLSNNSNDDPRNNFKGKIDPVKSQLILDIRKATTKDAGTYYCASD
Otolemur garnettii V438 trdv AAQR03175671.1 2347 VMPAAVLVPVKPEVPVSVGESATLRCSMQGETIGNYYLNWYKKTQDGALTFIYREPNTYGPGFTDRFKGAVDNQNNQGVLNISMVSERDEGLYYCACD
Otolemur garnettii V450 iglv AAQR03183734.1 242 SLSQPVLTQPPSLSASLGASARLTCTLSSGFPVGDFLIWWFQQNPGSPPRYLLRFKSDSDKHQGSRVPNHFSGSKDASTNAGILHISGLQAEDKADYYCGT
Otolemur garnettii V451 iglv AAQR03183741.1 1189 SLTQPVLTQPPSASAFLGSSDKLTCSLDSGHSSYGIVWHQQQPGKAPQYLRWIGSAGTRTRIPESFSGSGSWADCYLTISNLQSEAEADYYCEVV
Otolemur garnettii V452 iglv AAQR03183741.1 10845 SLSQLIPTQPPSASASLGSSVNIPCTLSSAHSSSYMYWYQQQPGKAPRYLMYVSRTGSTSNGYGIPDRFSGSGSGTNCYLTISNLQSEDEADYYCQTYDSNGI
Otolemur garnettii V457 iglv AAQR03185489.1 126 PLSQPVLTQPPSASASLGYSVKLTCTLSSGYSSVAVAWHQQQPGKAPRYLMYVTSDGIHGKGDGIPDCFSGSGSGLQRYLTISNLQSEDEADYYCQTYDSSGI
Otolemur garnettii V458 iglv AAQR03185491.1 1230 SLSQAVLTQQPSSSASLGAWVKLTCTLSPGYRYNTTGWHQQQPEKTPQYLMYVNSDGTSINGDGIPDCFSGSGSGADRYLTISNLQSEDEADYYCQSYDSSGI
Otolemur garnettii V459 iglv AAQR03185496.1 1566 SLADFALTQPRSVSGSPGQKVTISCTRSSGNIGSYYVHWYQQQPGRAPTTVIYNDNQRPSGVPDRFSGSIDSSSNSASLTISALQAEDEADYYCQSYDNSD
Otolemur garnettii V460 iglv AAQR03185497.1 1231 ALSQPLLTQPPSLSASPGASARLPCTLRSDLDLGYYPIHWFQQKPGSPPRYLLSFKSDSNKHQGSGVPSRYSGSKDASAHAGILHISGLQAEDEADYYCLI
Otolemur garnettii V461 iglv AAQR03185510.1 5062 SLSQLVLTQPPSASASLGALVKLTCTLDSGHSTYGIGWQQQQPGKAPRYIVGLSNDGTSSKGDGIPDLFSGSSSGTDRYLTISNLQSEDAADYYCQTSDWGI
Otolemur garnettii V462 iglv AAQR03185511.1 920 SLSQLALTQPPSASASLGASVKLTCTLDSGHSSYTIAWHQQQPGKAPRYLMKVYSSGNHNKGDGIPDRFSGSSSGADRYLTISNLQSEDEADYYCLTGDSSG
Otolemur garnettii V468 iglv AAQR03189714.1 10915 SLSQPVLTQPPSASASLGASVKLTCTLSSELSDYTIGWHQQQPGKAPRYLMYVNTYGSSSNGDGIPDRFSGSGSGADRYLTISNLQSEDEADYYCQSYDSSGI
Otolemur garnettii V469 iglv AAQR03189717.1 1090 SLSQAVLTQQRFASASLGAWVKLTCTLSPGYRYNTTGWHQQQPGKAPWYLMYVNSDGTSINGDGIPDCFSGSGSGADRYLTISNLQSEDEADYYCQSYDSSGI
Otolemur garnettii V470 trgv AAQR03189880.1 30598 GQISSILEGTMLSVTSKAGSACVITCDVQQSSSYIHWYLFQEGKAPRRLLYYDFLNSKKVVESGVSTGKYNAYQATQRSFKLWLRVLEASDSGVYYCATWV
Otolemur garnettii V471 trgv AAQR03189880.1 38306 SQIASNLEGSIVSVTRKTGLAVVINCDISQSTSYLHWYLSQEGRPIQRFLYYHVGTTRTLVDSGFSQEKYSAYQGRDGNYKLLLKNVKASDSGVYYCASWS
Otolemur garnettii V472 trgv AAQR03189881.1 10323 IRIASNLEGRMMSITRKTGSAYAITCDIQLGTNYIHWYLFQESRAPRHFLYYDFLNSKKMVQSGISPGKYNTVKATDKRFKLILTKLEASDSGVYYCATWD
Otolemur garnettii V473 trgv AAQR03189881.1 15080 GRIASSLERTMTSITRQTASAATVVCDAPLSTTYIHWYLFPEGEAPRQLLYKSFLKSPQEQGIRLGEYNAYKVTGRTFKLLLTNVKASDSGVYYCAHWI
Otolemur garnettii V474 trgv AAQR03189883.1 67 NQVSSNLEGKMMSVTRKTGSAVDITCHVEESASYIHWYLFEDGKAPRRLLYYAVSNYKAVVDSGVSKEKYYPVMGTEKSFKLLLQRLEAGDSGVYYCASWDSS
Otolemur garnettii V475 trgv AAQR03189884.1 15860 SRVSSNLEGKMISVTRKTGSAVDITCHIEQSASYIHWYQFREGRAPRRLLYYAVSNYKVVVDSGVSKEKYNPFLGTEKSFKLRLQHLEAGDSGVYYCAGSSSL
Otolemur garnettii V476 trgv AAQR03189886.1 49 SQVSSNLEGKMISVTRKTGSAVIITCHVEESASYIHWYLFQEGKAPRRLLSYAISNYKVVVDSGVSKEKYYAFMGTEKSFRLRLQHLEAGDSGVYYCASWYSS
Otolemur garnettii V477 trgv AAQR03189888.1 4236 SQVSSNLEGKMISVTRKTGSAVDITCHIERRSSYIHWYLFQEGKAPRRLLYYDISNYKAVVDSGVSKEKYHPFAGTEKSFKLQLKRLEARDSGVYYCANWDLS
Otolemur garnettii V478 ighv AAQR03190620.1 422 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFTDYSMNWVRQAPGKGLEWVAEVSQPSGSKQWYSPSVQGRFTIARDNPTNTVSLEMTNLKAEDTALYYCTR
Otolemur garnettii V479 ighv AAQR03190623.1 657 VGAQVQLVQSGAEVRRPGESLTISCKASGYTFTSYWISWVRQRPGKGLEWVGNIYPGDSDTEYSPAFQGRVTISADNSISTASLRWSSLKADDRAMYYCTR
Otolemur garnettii V480 trav AAQR03191286.1 5739 SSMAQTVTQTQPEMSVPEGEPVTLNCTYDTSYTYYRLYWYKQLHSGQMVFVIRQASEQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALEE
Otolemur garnettii V481 trav AAQR03191289.1 5568 SSMAQTVTQSQPEMSVQEGESVTLHCTYSTSYTYYALYWYKQLPSGQMVFVILQASNQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALTE
Otolemur garnettii V482 ighv AAQR03191884.1 1820 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFADYYMHWVRQAPGKGLEWVGFIRNKANGGTAEYATSVKGRFTISRDDSKSVTHLQMNNLKPEDTALYYCAR
Otolemur garnettii V483 ighv AAQR03191951.1 2180 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFTDYWMNWVRQAPGKGLEWVGFIRNKANGGTTEYAASVKGRFTISRDDSKSVTHLQMNNLKPEDTAVYYCMR
Otolemur garnettii V484 ighv AAQR03191953.1 4469 VCAQVQLVQSGAEVKRPGESLTISCKPSGYTFTSYWMHWVRQRPGKGLEWVGRIYPGNFKTYKSPAFQGHVTISTDNSISTASLRWSSLKAEDTAVYYCAK
Otolemur garnettii V485 trav AAQR03191991.1 5797 SSMAQTVTQSQPEMSVQEGESVTLHCTYSTSYTYYALYWYKQLPSGQMVFVILQASNQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALTE
Otolemur garnettii V487 trav AAQR03194235.1 212 FSVAQTVTQSQPEMSVQEGESVTLRCTYRTSYTYYDLCWYKQLPSGQMVFVICQASDQQNARQNRFSVNFHKAAKSISLTISHSQLEDSTVYFCALRE
Otolemur garnettii V488 trav AAQR03194372.1 145 VRGIQVDQSPPALSLHEGANSTLWCNFSSSVNNVQWFRQNPGGPLINLFFIPTGTKQKGRLTATTVVQKRQSSLHISSSQITDSAIYFCAVEA
Otolemur garnettii V490 igkv AAQR03195055.1 1468 SCEDTVMTQTPLSLSVTPGESASISCRASQSLLHSDGNTYLNWFLQKPGQSPRLLIYKVSNRDSGVPDRFSGSGSGSDFTLKISRVQPEDAGVYYCGQGSWFP
Otolemur garnettii V491 iglv AAQR03195256.1 680 SVASSELTQEPAMSVALGQTARITCQGDLLRSYYSAWHQQKPGQAPVQVMYHNDKRSSGIPDRFSGSYSGNTVTLTISGAQAEDEADYYCLVWDSENKK
Otolemur garnettii V493 trav AAQR03196051.1 423 SSMAQTVTQTQPEMSVQEGESVTLPCTYSASYTYYDLYWYKQLPSGQMVFVIHQGSEQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALRE
Otolemur garnettii V494 trav AAQR03196466.1 444 VRSQQKEVEQNPEFLSVSEEAMATLNCTYSNSNNHYFIWYRQYSGKGPELLVSIYSTGEKTEGRFTAHLNKASKYVSLLIRDSQPSDSATYLCAV
Otolemur garnettii V636 trgv AAQR03057839.1 35657 GLGLSKLEQSFVSVSIEVKKSVKIPCTVWSANFETEVIHWYQQKPNQALQHLLQVTSTKSPVSMQGREDKIKASKDSRSSTSILTINSIQEEDVGVYYCAGWD
Otolemur garnettii V637 trgv AAQR03057839.1 31021 GLGNLEQSEISISRGRDKSAQISCTASIENFNSAAIHWYRQKTNQGLEHLLYVTQALARAKNNKFEARKEFPASIITLKINSLEKEDEAMYYCAWW
Otolemur garnettii V638 trgv AAQR03057839.1 18193 GDAKMRISQDQLSSTRGPDRTVHISCKLSGVPLKDTIVHWYQQKEGEPPRRILYGSAKNYKQDIPNSRMETDEKDNGVFYLIINNVVKSDEATYYCACWD
Otolemur garnettii V639 trgv AAQR03057840.1 12032 SQTSSKLEGKMMSLSRPVGSAIGITCDVPEERDKYIHWYLSQDDEAPHHLLYYSYECKVGDDPNRSSGKYNAYVGAGSRCKLALQNLEASDSGVYYCATWV
Otolemur garnettii V640 trgv AAQR03057842.1 3061 SQVSSNLEGKMMSVTGKIGSAVDITCHVEQSVADIHWYLFQEGKAQRRLLYYDVLNYEMVVESGVSKEKYNPVIGTVKSFKLRLQHLEAGDSGVYYCTSWDWS
Otolemur garnettii V686 trbv AAQR03083279.1 80579 AMDTGVTQTPRNRITKTGQSISLECSQTKGHNVMYWYRQDPELGLRLIYYSVGINDTQKGEVSDGYRVSREKQPKFSLLLVTAVPSQTAVYFCASSA
Otolemur garnettii V687 trbv AAQR03083279.1 48264 PMEAQVTQTPRYIITETGKNVTVTCSQNMNHNYMLWYRQDPALGLKLIYYSINVNMVDKGDVPDGYNVSRKEKGRFPLTVESASTTQTALYLCASSL
Otolemur garnettii V688 trbv AAQR03083279.1 42426 LVGTNVTQTPRYLVKRMGEEVLLECSQDMGHENMFWYRQDPGQGLRLIYYSYDVGKNEKGDVPEGYNVFRNKKQHYSLALESASTSQTAVYLCASS
Otolemur garnettii V689 trbv AAQR03083279.1 33248 SVFAVLVSQKPSRDICQQGTSVIIQCQLDSQVNFMFWYRQVQGQNLILMATANQGSDATYESGFSKDKFLISRPNLTFSTMTVKNLSPEDSSLYFCSAG
Otolemur garnettii V690 trbv AAQR03083281.1 43038 HVWAMIIQNPRYQITRAGKPVTLSCSQNMNHDVMYWYQQKLNQAPKLLFYYYDTQFNNETDTSDNFQPSRPNTSFCSMDVRSPGVGDSAMYLCASSR
Otolemur garnettii V691 trbv AAQR03083281.1 31643 LTNAGVHQNPRHLIRRRGQEATLRCSPEKEHNHVYWYQQLLEEGPKFMIYLQKERTIDESGMPTKRFSAEFPKEGRSILKIQQAEPVDSAVYFCASSV
Otolemur garnettii V692 trbv AAQR03083281.1 23049 SGLDPLVSQHPPRVVCESRASVRIECHAVGFQATTMLWYRQFPKQSLVLIATSNAGSDATYEQGFNETKFPIHHPNLTFSALTVTSAHPEDSSFYLCSGS
Otolemur garnettii V693 trbv AAQR03083281.1 14371 VVDTEVTQHPRYLVKGKGQETEMNCVPKKGHSYVYWYRKKLNEEFKFMVYLQNEEDIIDKTELFNERFSARCPQNSPCSLMIYSTESGDSALYFCASSE
Otolemur garnettii V694 trbv AAQR03083281.1 6560 SFEAKVTQTPGHLVKGIGQKAKMDCIPQEGHNFLYWYQLSQNKELQFLISFQFKRIFDQTEMYKERFSAECPSDSPCSLEIPSPQPGDSALYFCASSE
Otolemur garnettii V695 trbv AAQR03083282.1 159779 PVGTAITQTLKHPVTSVASKKTLKCEQHLGHNSKYWYRQKAKKSLELMFFYNYKELTENVSVPSCFIPNYPDSSQLHLHVGALETEDTAAYLCASSK
Otolemur garnettii V696 trbv AAQR03083282.1 158189 HTEPGVIQIPTHQVTEMGQQVTLSCDPISGHLYFYWYQQVWGQKLEFLVSFYNDKVLDKSGIFSDRFSVERQKGSYLTLKIQPTKLEDSAVYLCASSS
Otolemur garnettii V697 trbv AAQR03083282.1 149738 PMDTRVTQTPRHLVMGMTDKKFLKCEQNLGHNAMYWYKQSDKKPPELMFAYYLKELRENTTVPSRFLPEYPNSTHLYLHLDALQPEDSATYLCSSSQ
Otolemur garnettii V698 trbv AAQR03083282.1 139471 PLDTAVFQTPKYLVTQMGRNGSLKCEQTLGHNAMYWYKQDSEKLLKLMFSYYNTELNVNETVPSRFFPESSDKAHLQLNIMSLEPGDSAVYFCASSQ
Otolemur garnettii V699 trbv AAQR03083282.1 133053 PLDTAVFQTPKYLVTQVGRNGTLKCEQTLGHNAMYWYKQDSEKLLKIMFVYSNKERIVNETVPSRFFPESSDKARLKLKITSLEPGDSAVYFCASSQ
Otolemur garnettii V700 trbv AAQR03083282.1 128166 PMDTGVTQTPRHLVMGMTGEKSLKCEQTLGHNAMYWYKQSDKKPPELMFIFNYKRLSENMSVPSRFSPEFRDSSQLHLRLEALQPEVSATYLCASSQ
Otolemur garnettii V701 trbv AAQR03083282.1 123424 PAEAGVTQTPRHLIKARGQQVALRCSPVSGHRRVYWYKQALGQGLQFLIQYYEGEEGEKGDFPDRFSGHQSRDYHSELNVSSLELVDSALYLCASSL
Otolemur garnettii V702 trbv AAQR03083282.1 114877 SVNTGVTQSPKFQILVTGQNMTLECVQDMNHDSMYWYRQDPGLGLRLIHYSVGVRFTDDGEVPEGYSASRLSEESFLLTLDSATPSQTSVYFCA
Otolemur garnettii V703 trbv AAQR03083282.1 96014 HTDAGITQNPRYKVAETGKQVTVECHQTNKHDYMYWYRQDLGHGLRLIYFSYDVNSTDKGEVPDGYSVSRLHTEHFPLTLESATRSQTSVYFCASSD
Otolemur garnettii V704 trbv AAQR03083282.1 90372 HTDAGVIQTPKHKVTEVGQAVTLTCEPISGHDALYWYRQTLVQGLELLTYFRTRTTVDDSGMSKDRYSAKMPNASFSSLKIEPTEPRDSAMYLCASSQ
Otolemur garnettii V705 trbv AAQR03083282.1 78707 LVNAGVTQSPKSQILVTGQNVTLECTQDMYHDNMYWYRQDPGLGLRLIHYSVGSGFTDKGEVPSGYSVSRLDKNSFPLTLDSATPSQTSVYFCASRY
Otolemur garnettii V706 trbv AAQR03083282.1 75584 LTDAGISQSPRHKVINKGQDVVLWCDPISGHVALYWYQQILGQGPKFLVEFQGTQATDKSGLPGDWFSAERPEGSFSTLTIQSTEVQDSAMYICSSSF
Otolemur garnettii V707 trbv AAQR03083282.1 68977 LVNAGVTQSPKSQILVTGQNVTLKCAQNMNHNRMYWYRQDPGLGLRLIYYSVGIKVIDKGEVSDGYSVSRSEVGSFPLTLDSATPSQTSVYFCASSD
Otolemur garnettii V708 trbv AAQR03083282.1 65274 ITSAGISQFPRHKVVKRGQEVTLRCDTVSGHFTLSWYRQTLRQEPEFLIYFRGKEATDRSGLPSDRFSAERPEGSFSTLNIKSAEEGDSALYLCASSE
Otolemur garnettii V709 trbv AAQR03083282.1 54034 LNASVTQIPKFQILVTGQNVTLECAQDMNYDSMYWYRQDLGLGLRLIHYSAVAGATDKGEVPDDYSVSRLSKGSFSLTLDSATPSQTSVYFCAGSY
Otolemur garnettii V710 trbv AAQR03083282.1 52591 LTGAGVFQSPRHRVTKKGQDVTLSCDPIAGHTALYWYQQKMGKGPEFLIYFQGKDPTDTSGLPKARFSAKRPKGSFSTLDITSAEPDDSAVYLCASSV
Otolemur garnettii V711 trbv AAQR03083282.1 45645 PAEAGVTQTPRHLIKARGQQVTLRCSPVPGHNRVYWYKQALGQGLQFLIEYYEGAEGEKGDFPDRFSGHQSHDYHSGLNVSALKLEDSALYLCA
Otolemur garnettii V712 trbv AAQR03083282.1 29887 LVDAGVIQSPRHLIKGKQEAATLKCYPFPGHDTVYWYQQVPDQGLQFLISFYEKMQRDQGNIPHRFSAQQFTDYHSEMNLSSLEVGDSALYLCASSV
Otolemur garnettii V713 trbv AAQR03083282.1 26495 HTDAGITQNPRYKVAETGKQVTLECHQTNKHDYMYWYRQDLGHGLKLIHYSVGATITDKGEVPDGYSVSRPSIENFNLSLASATHSQTSVYFCASSD
Otolemur garnettii V714 trbv AAQR03083282.1 17697 LKESGVVQSPRYKIAEKRQAVAFWCNPVSGHNTLYWYQQTPGKGLELLIQYQNKDPVDESQLFKDRFFAERSKGVDSTLRIQQAGLEDSATYLCASS
Otolemur garnettii V715 trbv AAQR03083282.1 7654 PTVAGVTQTPKHKVTEIGQAVTLNCEPISGHVAIYWYRQTKMQGPEFLIYFNNMQPIDNSGMPKDRFSARMLNASFSTLKIQPTAPGDSAMYLCASSL
Otolemur garnettii V884 igkv AAQR03151036.1 23961 TVESTVLIQSPVSLSVSLGDSVAINCKASQSVSDYVCWYQQKPGQPPKLLIYDADDRHSGVSSRFTGIQSGTEFIFTISNIQADDAAIYYCQQGYTVP
Otolemur garnettii V885 igkv AAQR03151036.1 15151 SSGDVVMTQTPLSLPVTPGEPVSISCRASQSLLHSNGNTYLHWYLQKPGRSPQLLIYKVSNRESGVPDRFSGSGSGTDFTLKISRLQAEDVGVYYCLQG
Otolemur garnettii V886 igkv AAQR03151038.1 16524 SGGQIVLTQPAAFLSTSPGERVSISCTASESLLYQDGKHYLSWYQHRPGQSPKALIYHASTRVDGVSARFSGSGSGMGFSLTIADLEPEDFTTYFCLQTLRSP
Otolemur garnettii V887 igkv AAQR03151038.1 10468 ASCDIQMTQTPPSLSASLGDTVTITCRASQGISNNLHWYQQKPGSSPKLLIYYASSLHSGVPSRFRGSRSGTDFTLTINGLQAEDVGIYYCQQSSSLP
Otolemur garnettii V888 igkv AAQR03151038.1 1382 TKAETTLTQSPELVSVAPGDKATITCKASQDIDDDIHWYQQKPGEAPRFIIKYVSTLISGVPSRFSGSGYGTDFTLTINNVQSEDAAYYFCQQDDNLP
Otolemur garnettii V889 igkv AAQR03151039.1 27160 TCGDIVMTQSPDSLAVSPGERVSLNCKSSQSLYYQSNKKNYLAWYQQKPGQSPKLLISWASNRESGVPDRFSGSGSGTDFTLTISSLQAEDVAAYYCQQYYSFP
Otolemur garnettii V891 igkv AAQR03151592.1 1921 SCEDTVMTQTPLSLSVTPGESASISCRASQSLLHSDGNTYLNWFLQKPGQSPRLLIYKVSNRDSGVPDRFSGSGSGSDFTLKISRVQPEDAGVYYCGQGSWFP
Otolemur garnettii V892 igkv AAQR03151593.1 12895 ASCAIQMTQTPPSLSASLGDTVTINCQASQSISNWLAWYQQKPGDSPKLLIYKASNLETGIPSRFRGSGSGTDYSLTISGLQAEDVADYYCQQYNSYP
Otolemur garnettii V893 igkv AAQR03151593.1 1330 ASCATQMTQSPSTLSVSLGDTVTITCRASQGINNILDWYQQKAGKPPKRLIYGASNLDSGVPSRFRGSGSGTDYSLTISGLQAEDVADYYCLQYDSFP
Otolemur garnettii V894 igkv AAQR03151595.1 455 SSGDIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLNWVLHKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGSDFTLKISRVQPEDAGVYYCWQGSWYP
Otolemur garnettii V895 igkv AAQR03151599.1 1272 SRCAIQMTQSPSSLSASVGDTVTITCQASQGISNELNWYQQKPGKSPKPLIYYASRLETGVPSRFRGSGSGTDFTLTISGLETDDVGNYYCQQDYSYP
Otolemur garnettii V896 igkv AAQR03151604.1 2607 ASCAIQMTQSPSSLSASVGDTVTITCRAGQSIYNVLAWYQQKPGKPPKLLIYGTSNLATGVPSRFRGSGSGTDYSLTISGLEAEDVGNYYCQQGSSYP
Otolemur garnettii V897 igkv AAQR03151607.1 1053 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGRSPQLLIYEVSNRHSGVPDRFSGSGSGTDFTLKISRLQAEDVGVYYCAQG
Otolemur garnettii V898 igkv AAQR03151608.1 8154 ASCAIQLTQSPSSLSASLGDTVTITCQASQGVSNYLHWYQQKPGNSPKLLIYSTSNLYPGVPSRFRGSGSGTDYSLTISGLQAEDVADYYCQHGYGT
Otolemur garnettii V963 trav AAQR03183024.1 2802 AVRGLQVEQSLSAQTPQEGTSHTLRCNFSDIVTNMQWFLQNPGGSLINLFNLASETKQKGRLKSTLNSKERYSTLHITTTRLEDSGTYFCAAQ
Otolemur garnettii V964 trav AAQR03183025.1 9303 GSSGDSVTQTEGQIILSEAASLTVNCSYESTRYPALFWYVQYPGEGPQLLLKAVKANDEGSNKGFEAKYLKETTSFHLKKASVQVSDSAVYYCALQ
Otolemur garnettii V965 trav AAQR03183025.1 4620 DARAQSVTQPDPYVSVSEGDSLELRCNYSYGGALYLFWYVQYPGQGFQFLLRYYSGDTVVQGIKGFEAEIKKRESSFNLRKQSVHWSDTAKYFCVLG
Otolemur garnettii V966 trav AAQR03183026.1 21604 TSRGEEVKQSPFLSVREGDNSVINCTYTDSTSTYFYWYKQGPEGLQWLITILSNAEKKQDGRLSVWLNKTEKHLSLNISDTQPGDSAVYFCATS
Otolemur garnettii V967 trav AAQR03183026.1 19536 VTSQKIEQDSQGLSIHEGEMAALTCNYTSYSPTLFQWYRQDPGRGLIFLLLIRENEREKREGRWRVTFDTTLKQSSFYIRASQPADSATYLCAA
Otolemur garnettii V968 trav AAQR03183026.1 8639 DARAQTVTQQDSPVTISEGDILELGCNYAYDATHSLYWFVQYPGRGLQLLLKYYSGDPFVKGTNGFEAEFRKSESSFNLRKHPVHWSDSAVYFCALR
Otolemur garnettii V969 trav AAQR03183028.1 7591 GTGAQSVTQPDDRIPVSEGDPLELRCNYSSSVPPSLFWYVQYPNQGLQLLLKYTSGNSIVTGFKNFQAEFKKSETSFHLKKASAHLSDSALYFCAVS
Otolemur garnettii V970 trav AAQR03183029.1 26445 GLRAQSVTQPDAQVTVSEGNPLTVKCTYSVSRSPYLFWYVQYPQEGLQFLLKYITGDNLVKGNYGFEAEFNKSQTSFHLKKASALGSDSAVYFCAVS
Otolemur garnettii V971 trav AAQR03183029.1 17560 TLSLAKTTQPISMDSHEGEEVNLPCSHTTIATNDFIFWYRQLPKQGPQFIIQAYKTNVTNEVASLFLLADRKSSTLSLPRVAVSDSAVYYCIVT
Otolemur garnettii V972 trav AAQR03183029.1 12086 DVRAQTVTQQVGPVTVSEGDVLELGCNYSYGATPSLYWYVQYPGQGLQLLLKYYSGDSIVKGIKGFEAEFRKSESSFNLRKHPVHWSDSAVYFCALR
Otolemur garnettii V973 trav AAQR03183029.1 5488 GLRAQSATQPDAQVTVSEGNPLTVKCTYSFSGSPYLFWYVQYPKEGLQFLLKYITGDNLVKGNYGFEAEFNKSQTSFHLKKPSALVSDSAMYFCAVS
Otolemur garnettii V974 trav AAQR03183033.1 335 TLSLAKTTQPISMDSHEGEEVNLPCSHTTIATSDYIFWYRQFPNQGPRFIIQGYKTNVTNEVASLFLLADRKSSTLSLPRVAVSDSAVYYCIVT
Otolemur garnettii V975 trav AAQR03183037.1 4704 DARAQTVTQQVGPVTVSEGDILELGCNYSYSGTVSLYWYVQYPGQGLQLLLRYYSGDPIVKGIKGFEAEFKKSESSFNLRKYAVHWSDSAAYFCAVN
Otolemur garnettii V976 trav AAQR03183038.1 1719 DARAQTVTQQVGPVTVSEGDVLELGCNYSYSATVYLYWYVQYPGQGLQLLLRYYLGDPIVKGIKGFEAEFKKSESSFNLRKYPVHWSDSAVYFCAVS
Otolemur garnettii V977 trav AAQR03183048.1 21901 TAGQSIEQPSELTAVEGDFIQVNCTYQTSRFNGLSWYQQYNGGTPVFLFYHVLDGLEGKGRFSSFLKLSASYSYLLLKELQMKDSASYLCAVR
Otolemur garnettii V978 trav AAQR03183052.1 934 TAGQSIEQPSELTAVEGAFIQVNCTYQTSGFYGLSWYQQHDGRAPVFLSYHALDGLEGKGRFSSFLKRSASYSYLLLKELQMKDSASYLCAVR
Otolemur garnettii V984 iglv AAQR03185530.1 14117 SVSSYELTQPLSVSVALGETARITCGGNNIGRKVANWYQQKPGQSPVLVMSDSSRPSGIPERFSGSNSGNMATLTVSGAQAGDEADYYCGVWDS
Otolemur garnettii V985 iglv AAQR03185531.1 5918 SVASYELTQPPLESMALGDTARITCEGNNIGSSAVNWYQQKPGQSPVLVIYGDSNWPSGIPERFSGSNSGNTATLTINGAQAKDDVDYYCQVWDFGSDI
Otolemur garnettii V986 iglv AAQR03185536.1 17663 SWAQSALTQPPSMSGAPGQSVTISCAGTSNDIGRYNGVSWYQQRPGTVMKLLIYGVSTRPSGIPDRFSGSKSGNTASLTISGLRAEDEADYYCCSYRSG
Otolemur garnettii V987 iglv AAQR03185536.1 5748 FVASYELTQPPSVSVALGETARITCRGNNIGSKAVHWYQQKPGQSPVLVIYGDSNRLSGIPERFSGSNSGNTATLTISGAQAEDDADYYCQVWDFSNDI
Otolemur garnettii V988 iglv AAQR03185537.1 759 SWAQSALTQPPSMSGAPGQSVTISCAGTSSDVGGYNYVSWYQQCPGTVMKLLIYDVSTRPSGIPDRFSGSKSGNTASLTISGLRAEDEADYYCSSYRSG
Otolemur garnettii V989 iglv AAQR03185539.1 2065 SWAQSALTQPPSMSGAPGQSVTISCAGTSNDVGRYNLVSWYQQRPGTVMKLLIYGVSTRPSGIPDRFSGSKSGNTASLTISGLRAEDEADYYCG
Otolemur garnettii V990 iglv AAQR03185541.1 2727 SWAQSALTQPPSMSGAPGQSVTISCAGTSNDVGGYNSVSWYRKQRPGTVMKLLIYDVSTRPSGIPDHFSGSTSGNTASLTISGLRAEDEADYYCSSYRSG
Otolemur garnettii V991 iglv AAQR03185563.1 11221 ATSQAMVTQETSLSTNPGGTVTLTCGSSTGAVTTSNYACWVQQKPYQSPRGLIFDSSNRNPGVPARFSGSLLGDKATLTITGAQSEDEAEYYCALWYSNH
Otolemur garnettii V992 iglv AAQR03185564.1 8467 SWAQSVLTQPPSMSGAPRETVTIPCLGSSSNIGDGYSVHWYQQLQAKAPKPIIYDNSNRPSGVPDRFSGSKSGSSGSLTIRGLQSEDEGDYFCQSYDSNLDA
Otolemur garnettii V993 iglv AAQR03185564.1 3915 SSSQAVVMQEPSLTVSPGETVTLTCGSSTGAVTTGHYPYWFQQKSGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWL
Otolemur garnettii V994 iglv AAQR03185567.1 13265 SWAQSVLTQPPSMSGSPRETVTISCLGSSSNIGRGYNVHWYQQPQGMAPKLIIYGNSNRPSGVPDTFSGSKSGSSGSLTIRGLQSEDEADYFCQSYDSSLRA
Otolemur garnettii V995 iglv AAQR03185567.1 8301 SWAQSVLTQPPSMSGAPRETVTISCLGSSSNIGLGNYVHWYQQPQGMAPKLIIYDNSNRPSGVPDRFSGSTSGSSGSLTITGLQSEDEADYFCQSYDDSLGA
Otolemur garnettii V996 iglv AAQR03185571.1 11586 SSSQAVVMQEPSQTVSPGETVTLTCGSSTGAVTTGHYPYWFQQKSGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDQAEYYCWLLYSGA
Otolemur garnettii V997 iglv AAQR03185571.1 5770 SWAQSVLTQPPSMSGSPRETVTISCLGSSSNIGGGYSVQWYQQPQGMAPKLIIYGNSNRPSGVPDRFSGSKSGSSGSLTITGLQSEDEADYYCQSYDSSLRA
Otolemur garnettii V998 iglv AAQR03185575.1 2721 SWAQSVLTQPPSMSGSLRETVTISCLGSSNNIGGGNSVHWYQQLQGKAPRTIIYGNSNRPPGVPDRFSGSKSGSSGSLTIRELQSEDDAEYFCQSYDDSLDA
Otolemur garnettii V999 iglv AAQR03185576.1 3980 SWAQSVLNQPPSMSGSLRETVTISCTGSSNNIGGGYNVHWYQQLQGRAPKLIIHENSNRPSGVPDRFSGSKSGSSGSLTIRGLQSEDEADYYCQSYDSSQGA
Otolemur garnettii V1000 iglv AAQR03185578.1 11964 ADSQTVVIQKPSLSVSPGGMTTLTCGLSSESVSTGHYPSWYQQAPGQSPQKLIYNTNNCPSGVPDGFSGSIAGNKAALTITRTQAEDESDYYCSLFLGGGI
Otolemur garnettii V1001 iglv AAQR03185578.1 9589 SLSQPVLTQPFSATASLGALVKLTCTLSSELTVYAISWYQQQPGKAPRYLMYVTSYGSSSNGDGIPDRFSGSGSGADRYLTISNLQSEDEADYYCQSSYGYT
Otolemur garnettii V1002 iglv AAQR03185578.1 8072 SLPQPVLTQPPSLSASLGASARLTCTLSSGSSVGGYGTSWPQQKPGSPSWYLLYYQSGKDQSPRVPSHFSESEDASANSGILHISGLQAEDEVDYYCTTWQDST
Otolemur garnettii V1003 iglv AAQR03185582.1 10307 SLSQLALTQPPSASASLGSSVKVTCTLDSGHSSYGIAWHQQQPGKAPRYLMWLQSDGTSNKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCESNDSSG
Otolemur garnettii V1004 iglv AAQR03185586.1 1010 SLSQLALTQPPSASASPGASVKLSCTLDSGHSSYAVAWHQQQPGKAPRYLMWLYSDGSSNKGTGIPDRFSGSSSGADRYLTISNVQAEDEADYYCGSGDSSG
Otolemur garnettii V1005 iglv AAQR03185587.1 7379 SLSQLALTQPPSASASPGASVKITCTLDSGHSSYDIAWHQQQPGKAPRYLMYVSSNGNHNKGAGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWGSDIN
Otolemur garnettii V1006 iglv AAQR03185588.1 3430 SLSQPVLTQPPSATASLGASVKLTCTLSSGYSSYGVGWHQQQPGKGPRYLMWLYSDGTSNKGDGIPDRFSGSSSGLQRYLTISNLQSEDEADYYCQSEENAA
Otolemur garnettii V1009 trav AAQR03187225.1 5420 FSMAQTVTQSQSQMSVRERQSVTLHCTYDTSYTYYALYWYKQLPSGQMVYVIAQGSTQQNARQNRFSVNFQKAAKSISLTISNSQLEDTAVYFCALRE
Otolemur garnettii V1010 trav AAQR03187226.1 8957 FSVAQTVTQSQLEMSVQEGEMVTLPCTYRTSYTYYVLYWYKQLPSGQIVLVIRQASDQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALGE
Otolemur garnettii V1011 trav AAQR03187229.1 3448 FSMAQTVTQSQREMSVQEGESVTLPCTYRTSYTYYDLHWYKQLPSGQMVFVILQESNQQNARQNRFSVNFQKAAKSISLRISDLQLEDTAVYFCALEE
Otolemur garnettii V1012 trav AAQR03187231.1 4876 SSMAQTVTQTQSQRYVQERQSVILHCTYDTSYTYYVLYWYKQLPSGQMVLVIRQASDQQNARQNRFSVNFQKAAKSISLRISNSQLEDTAVYFCALRE
Otolemur garnettii V1013 trav AAQR03187238.1 2566 FSVAQTVTQSQPEMSVQEGEIVTLSCTYDTSYTNYILYWYKQLPSGQMVFVILQASNQQNARQNRFYVNFHKAAKFISLRISDSQLEDTAVYFCALEE
Otolemur garnettii V1014 trav AAQR03187240.1 11039 SSMAQIVTQTQSEMSVQEGEPVTLHCSYGAIYTYYNLYWYKRLPSGQMVFVIAQGSEQQNARQNRFSVNFQKAAKFISLMISDSQLEDTAVYFCA
Otolemur garnettii V1015 trav AAQR03187242.1 7447 SSTAQTVTQSQPEMSVQEAETVTLGCTYDTSESDYYLFWYKQPPNREMILIIRQEAYKQENATKNRFSGNFQKAAKSFSLKISDSQLGDAAVYFCAFMK
Otolemur garnettii V1016 trav AAQR03187244.1 3682 VSSEDKVVQSPPYLAVHEGDSATISCSYEVAYFQSLQWYKQERNAPTFLFILRSSGIEKSGRLSSILDKKELLSTLNITATQTGDSAIYLCAVE
Otolemur garnettii V1018 trdv AAQR03187250.1 2608 SGMAEKVTQVQATVIMQEGEAATLDCIYEPRWSVYTLSWYKQPSSGEMVFLIHQDYSKPNEKWGRYSMNFEREKKSINLTISSLQLTDSAQYFCALRD
Otolemur garnettii V1019 trdv AAQR03187253.1 3409 SSLSQKVIQSQPAISKQEGETVELDCSYDTSVAYYVLFWYKQLPTWEIIFLILQDTELVTKAAQSRYSVDFQKAAKTIWLIISSSQPEDSATYFCGLRE
Otolemur garnettii V1020 trdv AAQR03187257.1 31503 SIVLHKVTQTPPATSMTEGEAVTMNCMYESNLTTYYLYWYKQLPSKKFIFLLRQSSSEVNASEDHYLVNFQKEAKSMNFSISVLRLEDAAKYFCAFKM
Otolemur garnettii V1021 trdv AAQR03187257.1 28713 SSVAQKVIQTPPATSMTEGEAVTMNCIYETNFTSYYIFWYKQLPGEEVIFLLRQSSSAVNASNDHYLVNFQKEVKSMNFSISVLSLEDAAKYFCA
Otolemur garnettii V1022 trav AAQR03187257.1 17101 LKGQQLKQTPQFQYIREGENFSTYCNASSFLDSVQWYKQRPGGSPVFLMLLTRPGETKEKRLTIQFGEKRKDSSLHITAVQTADVGTYFCAVAQCSS
Otolemur garnettii V1023 trav AAQR03187257.1 9103 TITDAKTTQPNSMDCTEGGAVNLPCNHSTIIATEYIFWYWQNPSKSLQYLVHGLQNTVTNDVASLIIAADRKSSTLVLPHVTLRNAGVYYCIV
Otolemur garnettii V1024 trav AAQR03187257.1 6589 GARAQSVTQPDIQVTVSEGTTLELKCNYSYTGIPSLFWYVQYPGQSLQLLLKDITGVTLVKGIKGFEAEFRKSETSFHLKKHSAHLSDSAEYFCAMS
Otolemur garnettii V1025 trav AAQR03187262.1 8158 VRGIQVDQSPPALSLHEGANSMLWCNFSSSVNNVQWFRQNPGGPLINLFYIPSGTKQKGRLTATKVAQERHSSLYISFAQMTDSAIYFCAVEA
Otolemur garnettii V1026 trav AAQR03187262.1 3034 KGKSDQQQVKQDPPSLVVQEGHTSVLKCTYENSAFDYFPWYRQFPGKGPAFLIAIRSVKREEEEGRFTVFFNKSAKHFSLHIRTSQPGDSGTYFCAA
Otolemur garnettii V1027 trav AAQR03187263.1 2800 VRGIQVEQSPPALSLREGANSTLWCNFSSTVSNLQWFRQNPGGPLINLFYIPSGTKQKGRLTATTVTQERHSSLHISSSQMTDSAIYFCAVEA
Otolemur garnettii V1028 trav AAQR03187265.1 10943 VSSKQEVMQTPAVLSVPEGDSLDLNCSFTDSAIYFIQWFRQDPGKGLTSLLLIQSNQRVERNGRLKASLDKSSRYSTLNVADSQPADSATYFCAV
Otolemur garnettii V1029 trav AAQR03187266.1 53024 RTCGNSVTQTEGEVTLSEGDLLTINCTYTTSGYPALFWYIQYPGEGLQLLLKAEKANDEGSNKGFGAKYRKETTSFHLQKASVQESDSAVYYCALR
Otolemur garnettii V1030 trav AAQR03187266.1 41071 VRSQQKEVEQNPEFLSVSEEAMASLNCTYSNSANQYFMWYRQYSGKGPELLVSIASAGEKSNGRFIAYLNRGSKYVSLLIRDFQPSDSATYLCAV
Otolemur garnettii V1031 trav AAQR03187266.1 37187 GTRAQSVTQPDVSLSVLEETTLELRCNFSTGFSLTLMWYVQYPNQGLQLLLKYVSGSTVVKGIQGFEAEFMTSESSFHLRKPAAQLNDSAQYFCAVN
Otolemur garnettii V1032 trav AAQR03187266.1 27396 RTNGDSVTQTEGWVTLPEGAALTLNCTYQSSYTVFLFWYVQFPNKAPELLLKSSSENQKMYSRGFHVNHDKSDGSFHLQKPSVELSDSAVYYCA
Otolemur garnettii V1033 trav AAQR03187266.1 19873 PSMAQKVTQTQPEISVVEKEDVTLDCVYETSDSTYYLFWYKQPPSQEMIFLIRQDSFKEQNETEGRYFLNFQKSTSSISLTITATQLMDSAMYFCALRE
Otolemur garnettii V1034 trav AAQR03187266.1 10431 RSNGDSVTQTEGTVTLSEGGPMILNCTYQTTYSGSFLFWYVQYHNKALQVLLKSSTDNEKKENQGFWANLVKSNSSFHLQKSSLQVSDSAVYYCALS
Otolemur garnettii V1035 trdv AAQR03187266.1 2457 FSLSGKVTQSPAAISMLEEKAVTLDCVYEATSFSYYLFWYKQLPNGEIILLILQESFNEQNATDGRYSLNFQKTTSSISLTIAALQPGDSAMYFCALRE
Otolemur garnettii V1036 trav AAQR03187267.1 27162 SGIAQKVTQAQPATLVQEKEPVTLGCTYDTSDSRYSLYWYRQPSSGEMILIIRQDSYSQKNETDGRYSLNFQKASKSINLVISAAQLKDSATYFCALIE
Otolemur garnettii V1037 trav AAQR03187267.1 13286 VRSQQKEVEQNPEFLSVSSESMASLKCTYSNSANLYFMWYRQHSGKGLELLVSIYSGNENNTNGRFIVKHNKASKHVSLLIRDSRPSDSATYLCAVN
Otolemur garnettii V1038 trav AAQR03187267.1 6989 SGIAQKVTQVPPAMLVQEREAVTLGCTYDISDYSYHLFWYKKSTNGEMIFIIRQDSFSQKNETEGRYSLNFQKASKAINLIISASEFKDSAIYFCALRS
Otolemur garnettii V1039 trav AAQR03187268.1 22563 DARAQSVTQPDPYISVSEGDSLELRCNYSYSGTPYLFWYVQYPGQGFQFLLRYYSGDPVVQGIKGFEAEIKKSESSFNLRKQSVHWSDTAKYFCAVS
Otolemur garnettii V1040 trav AAQR03187268.1 8695 GVRGLQVEQSLSAQSPQEGTSHTLRCNFSATATQVQWFLQNPGGSLISLFYLASGTKQKGRLNSTFNAKERYSTLHITTTQLEDSGTYFCAAE
Otolemur garnettii V1041 trav AAQR03187269.1 15698 SGIAQKVTQVQPAMLVQEKEAVTLECTYDTSDPSYNLFWYKQPSSGEMIFIIRQDSYSQKNETEGRYSLNFQKASKVINLVISASQLGDSATYFCALSG
Otolemur garnettii V1042 trav AAQR03187269.1 6599 RTHGDSVTQREGEVTLSEGDLLIINCTYVASRYPALLWYVQYPGEGLQLLLKAMKANDEGSNKGFEAKYLKETTSFHLKKASVQVSDSAVYYCALQ
Otolemur garnettii V1043 trav AAQR03187270.1 23590 VSRGENVEQSPSTLRVREGDSSVINCTYSDSASSYFPWYKQELGKGPQLFIDIRSNVNRKNKTQRIAVLLNKVAKHLSLHIESAQPGDSAVYFCAA
Otolemur garnettii V1044 trdv AAQR03187270.1 19953 SGIAQEVTQIQSTILVQEKEAVTLGCTYDTSQSSYSLFWYKQPSSAEMILIIRQDSYSQKNETKGRYSLNFQKANKLINFVISASQLGDSAIYFCALR
Otolemur garnettii V1045 trav AAQR03187270.1 12887 RTHGDSVTQREGEVTLSEGDLLTINCTYTASVYPTLFWYIQYPGEGPQLLLKAAKANDKGVNKGFEAKYHKETTSFHLQKASVQESDSAVYYCALS
Otolemur garnettii V1046 trav AAQR03187270.1 3296 VRSQQKEVEQNPEFLPVSEKAMASFNCTYSNSANQYFVWYRQYSGKGPEMLVSIYSGNEKNTNGRFTVHLNKASKHVSLLIKDSQPSDSATYLCAV
Otolemur garnettii V1047 trdv AAQR03187274.1 4434 SGIAQKVTQIQSTISVQEKEAVTLGCTYDTGDTNYNLFWYKQPSSGEMILIIRQGSYSQKNETEGRYSLNFQKASKSITLAISASQLGDSAMYFCALSG
Otolemur garnettii V1048 trav AAQR03187275.1 2695 DARAQTVTQTDATITVSEGHSLELGCKYSYSTTPTLFWYVQYPGQGLQFLLRYYSGNTRVQGIKGFEAEFRKSESSFNLSKHSVHWSDTAMYFCATS
Otolemur garnettii V1049 trav AAQR03187279.1 867 VSGKNQVEQSLQFLFIVEGENCTLQCNYTVTPFNNLRWYKQDAGRGPFSLVFMTFSKNKQSQGRYTGTLDTSNMQSSLHITASRLSDSASYICVVS
Otolemur garnettii V1054 ighv AAQR03188824.1 8196 VQCEVQLVESGGGLVQPGGSLRLTCTISGFTLSSYDISWVRQASGKGLEWVSLISYSGSTYYPDSVKGRFTISKDNGKNAVYLQMDSLRTEDTAIYYCAR
Otolemur garnettii V1055 ighv AAQR03188829.1 7944 VQCEVKLVESGGGLVQPGGSLELSCEASGFTFTDYYMSWVRQAPGKGLEWVSYINYDGGSTNYADSVKGRFTISRDNGKNTLHLRMNSLRPEDTAVYFCAR
Otolemur garnettii V1056 ighv AAQR03188830.1 794 VQCEVQLVESGGGLVQPGASLRLSCKASGFTFGDYWMDWVRQAPGKGLEWVSRISSSGGSTYYPDSVKGRFTISRDNGKNTLYLQMNNLRSEDTALYYCAR
Otolemur garnettii V1059 iglv AAQR03190464.1 1878 SLSQLALTQPPSASASPGASVKLTCTLDSGHSSYTIAWHQQQPGKAPRYLMYVSSNGNHNKGDGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWGSDIN
Otolemur garnettii V1060 iglv AAQR03190469.1 1918 SWAQSRLTQEAPVSGSVGEKVTLSCTGNSNNVGSYAVGWYQQISRGAPKTVMLGTSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSAWDYSLSA
Otolemur garnettii V1063 ighv AAQR03192481.1 318 VQCEEKLVESGGGLVQPVGALRLTCVVSGFSLSSYDISWVRQASGKGLEWVSYISSGGSTYYPDSVKGRFTISKDNGKNTVYLQMDRLRTEDTAKYYCAR
Otolemur garnettii V1065 trav AAQR03192496.1 5363 RTCGDSVTQKEGEVTLSEEDFLTINCTYTATGYPALFWYIQYPGEGPQLLLKAAKADDKGINKGFEARYHKEATSFHLKKASVQVSDSAVYYCALS
Otolemur garnettii V1066 trav AAQR03192700.1 5181 SSMAQTVTQTQPEMSVQEGESVTLPCTYSASYTYYDLYWYKQLPSGQMVFVIHQGSEQQNARQNRFSVNFQKAAKSISLTISDSQLEDTAVYFCALRE
Otolemur garnettii V1067 trav AAQR03192939.1 5968 VRGIQVDQSPPALSLHEGANSMLWCNFSSSVNNVQWFRQNPGGPLINLFYIPSGTKQKGRLTATKVAQERHSSLYISFAQMTDSAIYFCAVEA
Otolemur garnettii V1068 trav AAQR03192939.1 844 KGKSDQQQVKQDPPSLVVQEGHTSVLKCTYENSAFDYFPWYRQFPGKGPAFLIAIRSVKREEEEGRFTVFFNKSAKHFSLHIRTSQPGDSGTYFCAA
Otolemur garnettii V1069 trav AAQR03193400.1 2800 VRGIQVEQSPPALSLREGANSTLWCNFSSTVSNLQWFRQNPGGPLINLFYIPSGTKQKGRLTATTVTQERHSSLHISSSQMTDSAIYFCAVEA
Otolemur garnettii V1071 trav AAQR03194373.1 2858 VRGIQVEQSPPALSLREGANSTLWCNFSSSVNNVQWFRQNPGGPLINLFFIPTGTKQKGRLTATTVVQKRQSSLHISSSQITDSAIYFCAVEA
Otolemur garnettii V1073 iglv AAQR03195255.1 1452 SVASSELTQEPAMSVALGQTARITCQGDLLRSYYSAWHQQKPGQAPVQVMYHNDKRSSGIPDRFSGSYSGNTVTLTISGAQAEDEADYYCLVWDSENKK
Otolemur garnettii V1074 igkv AAQR03195625.1 1853 SSGDIVMTQTPLSLAVTPGEPASISCKASKSLLHSNRYTYLYWFLQKPGRSPQHLIYGGSNLDSGVPDRFSGSRSGTDFTLKISRVQPEDAGVYYCMQALEF
Otolemur garnettii V1079 iglv AAQR03196961.1 1317 SLSQLALTQPPSASASPGASVKLSCTLDSGHSSYAVAWHQQQPGKAPRYLMWLYSDGSSNKGTGIPDRFSGSSSGADRYLTISNVQAEDEADYYCGSGDSSG
Otolemur garnettii V1080 trav AAQR03197642.1 829 VRSQQKEVEQNPEFLSVSEEAMASLNCTYSNSNNEYFMWYRQYSGKGPEFLVFIYSTGEKTEGRFTARLNKASKYVSLLIRDSQPSDSATYLCAV