WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Macaca nemestrina JZLF00000000.1 (JZLF01) 286 65 49 65 40 55 7 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Macaca nemestrina V31 ighv JZLF01009222.1 1506 VLSQVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGNIDGNIAGTNYNPSLKSRVTISKDASKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V190 igkv JZLF01034229.1 14249 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYY
Macaca nemestrina V191 igkv JZLF01034230.1 28438 AKCDVQLTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTDVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Macaca nemestrina V192 igkv JZLF01034230.1 56775 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSRFPGVPDRFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQL
Macaca nemestrina V193 igkv JZLF01034230.1 74818 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSRSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Macaca nemestrina V194 igkv JZLF01034230.1 83587 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Macaca nemestrina V195 trav JZLF01034309.1 2258 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Macaca nemestrina V201 trav JZLF01035007.1 21785 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Macaca nemestrina V202 trav JZLF01035009.1 14452 MCLILVTTGQNIDQPTEMTAMEGVIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Macaca nemestrina V203 trav JZLF01035010.1 39463 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQCPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Macaca nemestrina V204 trav JZLF01035011.1 11071 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Macaca nemestrina V205 trav JZLF01035011.1 29822 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNTDLKQDQRLTVLLNKKDKHLSLCIADTQTEDSAIYFCAES
Macaca nemestrina V206 trav JZLF01035011.1 39737 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Macaca nemestrina V207 trav JZLF01035012.1 8565 GINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGLQLLLKAMKFNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Macaca nemestrina V208 trav JZLF01035012.1 21960 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Macaca nemestrina V209 trav JZLF01035012.1 37948 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVH
Macaca nemestrina V210 trav JZLF01035012.1 43387 GTRAQSVTQLDSQVSVSEGVSVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca nemestrina V211 trav JZLF01035012.1 65627 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASSYFPWYKQELGKGPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Macaca nemestrina V212 trav JZLF01035012.1 86738 VWSQQKVEQNSEPLNVPEGAIASLNCTYSDRGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Macaca nemestrina V213 trav JZLF01035012.1 94123 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFPPNLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFKAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Macaca nemestrina V214 trav JZLF01035012.1 99690 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Macaca nemestrina V215 trav JZLF01035012.1 113547 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFFWYKQESGKGPQSIMDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Macaca nemestrina V216 trav JZLF01035012.1 119437 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Macaca nemestrina V217 trav JZLF01035012.1 137829 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Macaca nemestrina V218 trav JZLF01035012.1 162458 VWSQQKEVEQNPGSLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTALADKSSKYISLFIRDSQPSDSATYFCAMS
Macaca nemestrina V219 trav JZLF01035012.1 175427 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Macaca nemestrina V220 trav JZLF01035012.1 189225 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPDLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Macaca nemestrina V221 trav JZLF01035012.1 200996 VNSQQGEEDPQALSIQEGENATMNCSYKTSITNLQWYRQDSGRSLVQLVLIRSNEREKNSGRLRVTLDTLKKSSSLLITASRAADTASYFCATD
Macaca nemestrina V222 trav JZLF01035013.1 4034 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSESQETDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Macaca nemestrina V223 trdv JZLF01035013.1 7253 SSMAQKATQAQTEISVVEKEDVTLDCVYETRENTYYLFWYKQPPSGELVFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVMDSAVYFCALNE
Macaca nemestrina V224 trav JZLF01035015.1 27715 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Macaca nemestrina V225 trav JZLF01035015.1 38011 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPSDSATYLCAM
Macaca nemestrina V226 trav JZLF01035019.1 928 VRGIQVEQSPPDLILQEGANSTLRCNFSATVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTKERYSLLHISSSQTTDSGIYFCAVESQCSP
Macaca nemestrina V227 trav JZLF01035032.1 6203 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGSEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCILRV
Macaca nemestrina V243 trgv JZLF01037824.1 37816 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Macaca nemestrina V244 trgv JZLF01037827.1 1290 GQKSSNLEGITKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKVPQRLLYYDVSNSRDVLESGLSPGKYYTHTRTRWSWILILRNLIENDSGVYYCANWD
Macaca nemestrina V245 trgv JZLF01037827.1 10814 SQKSSNLEGRTKSLTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDTTNSRVVLESGISPGKYDSYGSTRNNLRLRLRNIIENDSGVYYCANWD
Macaca nemestrina V246 trgv JZLF01037827.1 25593 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Macaca nemestrina V247 trgv JZLF01037829.1 10957 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACWD
Macaca nemestrina V248 trgv JZLF01037829.1 12964 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKSYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Macaca nemestrina V257 trdv JZLF01041443.1 170263 RGMLCDKVTQSSPDQMVASGSEVVLLCTYNSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSRGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Macaca nemestrina V284 iglv JZLF01046433.1 22786 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSSYVYWYQQRPGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSS
Macaca nemestrina V285 iglv JZLF01046434.1 20899 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Macaca nemestrina V286 iglv JZLF01046434.1 30320 SWAQSVLTQPPSVSADPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVNKRPSGVSDRFSGSQSGTSATLGISGLRPEDEADYYCSAWDSSLS
Macaca nemestrina V287 iglv JZLF01046434.1 35675 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGVGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSQSGTSASLTITGLQSEDEADYYCQSYDSSLS
Macaca nemestrina V288 iglv JZLF01046434.1 50860 SLSQPVLTQPSSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Macaca nemestrina V289 iglv JZLF01046436.1 368 SLSQPVLTQPTSLSASPGASARLTCTLSSGISVGSYKIHWYQQKPGSPPRYLLNYHTDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Macaca nemestrina V290 iglv JZLF01046436.1 5204 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNDVYWYQQLPGMAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDSSLSD
Macaca nemestrina V291 iglv JZLF01046436.1 18775 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWFQQKPGQAPRGLIYNTNSKHSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Macaca nemestrina V292 iglv JZLF01046436.1 23452 SLSQPMLTQPASLSASPGASASLTCTFSGGINVAGYYIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDALANTGILRISGLQSEDEADYYCAI
Macaca nemestrina V293 iglv JZLF01046436.1 28359 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDNSLSG
Macaca nemestrina V294 iglv JZLF01046436.1 37447 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPKTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLYYSGA
Macaca nemestrina V295 iglv JZLF01046436.1 45010 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYTDSNKHQGSRVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Macaca nemestrina V296 iglv JZLF01046436.1 49863 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVHWYQQLSGKAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLSG
Macaca nemestrina V297 iglv JZLF01046436.1 62614 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLLGGKAALILSGSQPEDEAEYYCWLYYSGA
Macaca nemestrina V298 iglv JZLF01046436.1 69714 SLSQPVLTQPTSLSASPGASARLSCTLSSGINVGSYSIFWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Macaca nemestrina V299 iglv JZLF01046436.1 79484 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRSYVSWYQQLPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSATLAITGLQTGDEADYYCEAWDSSLS
Macaca nemestrina V300 iglv JZLF01046436.1 83649 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGVGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLTITGLQSEDEADYYCLAWDNSLS
Macaca nemestrina V301 iglv JZLF01046436.1 88671 SWAQSVLTQPPSVSGDPGQKVTISCTGSSSNIGGYYVHWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDNSLS
Macaca nemestrina V302 iglv JZLF01046437.1 1979 SWAQSVLTQPPSVSGDPGQKVTISCTGSSSNIGGYYVHWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDNSLS
Macaca nemestrina V303 iglv JZLF01046439.1 10870 SLSQPVLTQPASLSASPGASASLTCTFSGGINVTGYHIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLLSEDEADYYCAI
Macaca nemestrina V304 iglv JZLF01046439.1 15418 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPETAPKLLIYYNDRRASGVSDRFSGTKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Macaca nemestrina V305 iglv JZLF01046441.1 3678 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTTSNYADWFQQKPNQVPRGLTGDNTYRNPNVPERFSGFLRGGKAVLAITGAQPEDEAFYYCALW
Macaca nemestrina V306 iglv JZLF01046447.1 15791 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQVPVLVIYKDSERPSGIPERFSGSSSGTTVTLTVSGAQAEDEADYYCYSGDGNS
Macaca nemestrina V307 iglv JZLF01046447.1 25452 SWAHSAPTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Macaca nemestrina V308 iglv JZLF01046447.1 37922 SAASYDLTQPPSVSVSPGQTARITCGGDNIGSEAVHWYQQKPPQAPVLVIYRDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDISSDH
Macaca nemestrina V309 iglv JZLF01046447.1 45382 SVVSSRLTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTVTAAQVEDEADYYCNSWDSSGTH
Macaca nemestrina V310 iglv JZLF01046447.1 61865 SAASYELTQPRSVSVSQGQTARITCGGDNIGSKDVHWYQQKPAQAPVLVIYDESERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca nemestrina V311 iglv JZLF01046449.1 1956 SWAQSALTQPPSVSKSLGQSVTISCTGTSTDIGGYNDVSWYQQHPGTDPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEANYYCSSYRSG
Macaca nemestrina V312 ighv JZLF01046719.1 59796 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATEYAASVKGRFTISRDDSKNTAYLQMSSLKTEDTAVYYCAR
Macaca nemestrina V313 ighv JZLF01046719.1 83896 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYGMHWVRQAPGKGLEWVSSISNTGKTVYYADSVKGRFTVSRDNAKNSLSLQMSSLRAEDTAVYYCAR
Macaca nemestrina V314 ighv JZLF01046720.1 1809 VQCEVQLVEPGGGLVQPGGSMRLSCAASGFTFSSYGMSWVRQAPGKGLEWISAINSGGGSTWYTDSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca nemestrina V315 ighv JZLF01046722.1 4080 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTSYMELSSLRSEDTAVYYCTR
Macaca nemestrina V316 ighv JZLF01046723.1 2461 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISNGGGSTWYADSVKGRFTISRENAKNTLYFQMDSLRAEDTAVYYCAR
Macaca nemestrina V317 ighv JZLF01046723.1 14094 VQCEVQLVESGGGLVLPGGSLRLSCAASGFAFSDDYMEWVRQAPGKGLEWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQMSSLKTEDTAVYYCTR
Macaca nemestrina V318 ighv JZLF01046723.1 23115 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSSISSASSYIYYANSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Macaca nemestrina V319 ighv JZLF01046723.1 30605 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPSRKALEWLAHIYWDDDKRYSTSLKSRLTISKDTSKKQVVLTMTNMDPMDTATYYCARR
Macaca nemestrina V320 ighv JZLF01046729.1 18755 AHSEVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGPVDAEGGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Macaca nemestrina V321 ighv JZLF01046730.1 3399 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMDWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISGDDSKNTAYLQMSSLKTEDTAVYYCTR
Macaca nemestrina V322 ighv JZLF01046730.1 8319 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGMGVGWIRQPPGKALDWLARIYWNDSKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca nemestrina V323 ighv JZLF01046731.1 2589 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFSIYAISWLRQAPGQGLEWMGVIIPLVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Macaca nemestrina V324 ighv JZLF01046733.1 9359 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIGGSSGSTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V325 ighv JZLF01046734.1 7732 VLSQVQLQESGPGLLKPSETLSLTCAVSGGSISGGYYYWSWIRQPPGKGLEWIGYIYGSSGSTYYNPSLKSRVTISRDASKNQFFLKLSSVTAADTAVYYCAR
Macaca nemestrina V326 ighv JZLF01046739.1 1986 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMQWVRQAPGQGLEWMGRINPKTGGTDYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCER
Macaca nemestrina V327 ighv JZLF01046743.1 2565 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSSISSASSYIYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Macaca nemestrina V328 ighv JZLF01046744.1 12954 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSRISWDGGTTYYADSVKGRFTISRDNAKNSLFLQMGRLRAEDTAVYYCTR
Macaca nemestrina V339 ighv JZLF01048909.1 11258 VQCEAQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMDSLRAEDMAVYYCAR
Macaca nemestrina V340 ighv JZLF01048909.1 22863 AHCEMQLVQSEAEVKKPGASVKISCKASGYTFTYRYLHWLRQTPGQGLEWMGWITPYNGNTNYAQKFQDRATITRDRSMSTAYMELSSLRSEDTAVYYCAR
Macaca nemestrina V341 ighv JZLF01048921.1 80 GQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYSINWVRQAPGQGLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELNSLRSEDTAVYYCAR
Macaca nemestrina V342 ighv JZLF01048944.1 3332 VQCEVQLVESGGGVVQPGGSLRLLCAASGFTFDDYAMGWVRQAPGKGLKWVSRISWNGGSTGYADSVKGRFTISRENAKNSLYLQMNRLRAEDTALYYCAR
Macaca nemestrina V369 ighv JZLF01054769.1 475 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQSPGKGLEWIGGIYGSGGSTEYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCA
Macaca nemestrina V370 ighv JZLF01054774.1 6508 AAGAVWGLGEEAWASVKVSCNFSGFIITSYSIHWARQAPGQGLKWMGWNNSSNGNRVYKQKFKGRLTMTRDTSRSSAYTELSSLRSEDTAVYYCA
Macaca nemestrina V374 igkv JZLF01054986.1 2780 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQGIEYP
Macaca nemestrina V377 ighv JZLF01055140.1 587 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLDWVGRIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLNTEDTAVYYCTR
Macaca nemestrina V400 trav JZLF01061009.1 5525 VNGQQIMQIPQYQHVQEGEDFTTYCNFSTTFNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Macaca nemestrina V406 trbv JZLF01063215.1 18646 VRSQTVHQWPATLVQPAGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDHISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Macaca nemestrina V409 igkv JZLF01063720.1 1196 TTGEIVLTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYSNW
Macaca nemestrina V414 igkv JZLF01064480.1 2615 ARCDIQMTQSPSSQSASVGDRVTITCQASQSLSNYLNWYQQKPGKIPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca nemestrina V415 igkv JZLF01064484.1 4918 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQG
Macaca nemestrina V416 igkv JZLF01064484.1 12764 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSGLAWYQQKPGKAPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDSAAYYCQQVYSNP
Macaca nemestrina V417 igkv JZLF01064485.1 6560 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLYWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca nemestrina V419 igkv JZLF01064650.1 140885 SGDIILNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLEQRLEPLISHVTTLAPGVPARYSSKRSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Macaca nemestrina V445 iglv JZLF01069468.1 1205 SLSQPMLTQPASLSASPGASASLTCTFSGGINVAGYHIFWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Macaca nemestrina V484 ighv JZLF01074667.1 2020 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYSMGWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCTR
Macaca nemestrina V505 trgv JZLF01080241.1 2398 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSSSRVVLESGISPGKYDNYGSTRRNLRLILRNLIENDSGVYYCANWD
Macaca nemestrina V529 trbv JZLF01084321.1 1039 HTEPAVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDKISDKSEMFDDQFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Macaca nemestrina V536 iglv JZLF01085458.1 17140 VDSQTVVTQEPSLSVSSGGTVTLTCGLSSGLVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQTDDESDYYCMLYMGSGI
Macaca nemestrina V541 igkv JZLF01086682.1 211 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSYP
Macaca nemestrina V547 iglv JZLF01088258.1 360 SWAQAALTQPPSMSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Macaca nemestrina V694 ighv JZLF01021535.1 3651 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYAQSVQNRISINPDTSKNQFSLQLNSVTPEDMAVYYCAR
Macaca nemestrina V695 ighv JZLF01021538.1 61345 WSARWWSSWGGAWSSLAGPLRLFLCRPLRFTFRLRLWHALARPGVQGRGCSGSQLLILVGVAHGTDSVKGRFTISRENAKNTMYLQMNSLRAEDTAVYYCAK
Macaca nemestrina V696 ighv JZLF01021539.1 483 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWARQAPGKGLEWVSAINTGGGSTWYTDSVKGRFTISRENAKNTLYLQMNSLRAEDTALYYCAK
Macaca nemestrina V697 ighv JZLF01021542.1 4248 VLSQVQLQESGPGLVKPSETLSLTCAVYGGSISSGGYGRGWIRQPPGKGLEWIGSIYGSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V698 ighv JZLF01021543.1 53447 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Macaca nemestrina V699 ighv JZLF01021543.1 39903 VQCEVQLVESGGGLVQPGGSLRLSCTGSGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGSTWYTDSVKGRFTISKENAKNTLYLQMNSLRAEDTAVYYCAK
Macaca nemestrina V700 ighv JZLF01021543.1 26665 VQCEMQLVESGGGLVQPGGSLRVSCAVSGFTFSDYYMYWFRQAPGKGPEWVGFIRNKAKGGTTEYAASVKGRFTISRDDSKNVTYLQMNSLKTEDTAVYYCTT
Macaca nemestrina V701 ighv JZLF01021543.1 13485 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWICQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTITNVDPVDTATYYCAWR
Macaca nemestrina V702 ighv JZLF01021544.1 10167 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAVSVKDRFTISTDDSKNTLYLQMNSLKTEDTALYYCT
Macaca nemestrina V703 ighv JZLF01021545.1 29867 VQGEVQLVESEGNFVQPGGSLRLSCAVSGFTFSSYDLDWIRHAPGKGLEWVSGISIAGSTYYANSVNSLFAISRENAKNTLYLQMNSLIAEDTAIYYCVSE
Macaca nemestrina V704 ighv JZLF01021545.1 18835 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Macaca nemestrina V705 ighv JZLF01021546.1 2049 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDSATYYCAK
Macaca nemestrina V706 ighv JZLF01021551.1 84410 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSNYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Macaca nemestrina V707 ighv JZLF01021551.1 67950 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYGMAWVRQATGKGLEWVSSISQPSGSNTYYLDPVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Macaca nemestrina V708 ighv JZLF01021551.1 58595 VQCEVQLVESGGGLVQPGGSLRLSCGFTFSVHFMSWVRQAPGKGPEWVGFIRNKANGGTAEYATSVKGRFTISRDDSKSIAYLQMSSLNTEDTAVYYCAR
Macaca nemestrina V709 ighv JZLF01021551.1 29839 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSGNSDLIWIRQAPGKGLEWVSYISSGGSIYYSDSVKGRFTISRDNAKNTLYLQMSSLRVEDTAVYYCAK
Macaca nemestrina V710 ighv JZLF01021551.1 20265 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNVWMNWVRQAPGKGLEWVARIKSKADGGTADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Macaca nemestrina V711 ighv JZLF01021552.1 92264 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMNWVRQAPGKGLEWISRISNAGGSTYYADSVKGRFTISRENAKNTLYLQMDSLRAEDTALYYCAR
Macaca nemestrina V712 ighv JZLF01021552.1 80938 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGRISGSGGSTSYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V713 ighv JZLF01021552.1 72609 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNNLRVEDMAVYYCVK
Macaca nemestrina V714 ighv JZLF01021552.1 22944 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTGSWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFQGHVTISADKSISTTYLQWSSLKASDTATYYCAK
Macaca nemestrina V715 ighv JZLF01021579.1 6657 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Macaca nemestrina V716 ighv JZLF01021579.1 3840 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARG
Macaca nemestrina V717 ighv JZLF01021580.1 38033 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWSWIRQPPGKGLEWIGYISGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCA
Macaca nemestrina V718 ighv JZLF01021580.1 24984 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYSMHWVRQAPGKGLEWISAISSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Macaca nemestrina V719 ighv JZLF01021580.1 12774 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYVMHWVRQAPGKGLEWVSVISESGGTIYYADSVKGQFTISRDNAKNSLSLQMNSLRAEDTAVYYCTR
Macaca nemestrina V720 ighv JZLF01021580.1 8810 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGHISSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V721 ighv JZLF01021581.1 698 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGRTEYAASVKGRFTISRGDSKSIASLQMSSLKTEDTAVYYCAR
Macaca nemestrina V722 ighv JZLF01021582.1 30491 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMNWVRQAPGQRLEWMGWINTNTGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTVVYYCA
Macaca nemestrina V723 ighv JZLF01021582.1 10166 AHSEVQLVQSGAEVKKPGASVKISCKASGYTFTDYYLHWVRQAPGKGLEWMGRIDPEDGEAIHAQKFQDRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Macaca nemestrina V724 ighv JZLF01021582.1 1964 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGPEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Macaca nemestrina V725 ighv JZLF01021583.1 3836 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSGYEMHWVRQAPGKGLESVSVIGGDSSYTHYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca nemestrina V726 ighv JZLF01021587.1 1211 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISSGSGSTTLYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Macaca nemestrina V727 ighv JZLF01021599.1 3597 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Macaca nemestrina V728 ighv JZLF01021600.1 31082 VQCVEQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Macaca nemestrina V729 ighv JZLF01021602.1 5062 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSYISSASGTIHYADSVKGRFTISRDNAKNSLSLQMSSLRAEDTAVYYCTR
Macaca nemestrina V781 iglv JZLF01028779.1 1317 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDNSLSG
Macaca nemestrina V800 igkv JZLF01034230.1 109278 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFFGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAADYYCLQSKNSP
Macaca nemestrina V801 igkv JZLF01034230.1 91284 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWCQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTPTISSMEAEDAANYYCQQGHSI
Macaca nemestrina V819 iglv JZLF01039027.1 76037 SWAQSALTQPRSVSGSSGQSVTISCTGTSSDVGNYNIVSWYQQHPGTAPQLMIYQASGVPDRFSGSKSGNTASTTISGFQAEEEADYYCYSYATS
Macaca nemestrina V820 iglv JZLF01039030.1 18416 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPWYIMKVNSDGTQSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Macaca nemestrina V821 iglv JZLF01039032.1 31441 SWAQAALTQSPSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASS
Macaca nemestrina V822 iglv JZLF01039032.1 7484 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLMMYKVNMRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Macaca nemestrina V823 iglv JZLF01039033.1 5130 SAASYELTQPTSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Macaca nemestrina V824 iglv JZLF01039035.1 44224 SEASYELTQPPSVSVSPGQTARITCSGDALPDYYAHWYQQKSGQAPMLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGNH
Macaca nemestrina V825 iglv JZLF01039035.1 27201 SATSYELTQPPSVSAASGQTARITCGGDNIGSKYVQWYQQKPAQAPVQVIYDDSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Macaca nemestrina V826 iglv JZLF01039035.1 8199 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSSNH
Macaca nemestrina V827 iglv JZLF01039037.1 8450 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYEVGKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSR
Macaca nemestrina V828 iglv JZLF01039038.1 16743 SAASYDVTQPRSVSVSPRQTARITCGGDNIGSKVVNWYQQKPAQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Macaca nemestrina V829 iglv JZLF01039038.1 9105 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVVYGNNYRPSGIPERFSGSSSGNTASLTITGAQVEDEADYYCDS
Macaca nemestrina V830 iglv JZLF01039039.1 2042 SVASYELTQPPLVSVSPGQTARITCSGDVLKENYADWYQQKPGQAPVLLIYEDSKRPSGIPERFSGSTSGHTTTLTISSTLSEDEADYYCFSGNENN
Macaca nemestrina V840 trav JZLF01041444.1 202509 SGRADWLEPQETEVSGTEGKTVNLLCNYGTSSGSYFELYWFRQYPSQAPEYILYRAWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Macaca nemestrina V841 trav JZLF01041444.1 175240 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Macaca nemestrina V842 trav JZLF01041444.1 165752 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPIRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYRS
Macaca nemestrina V843 trav JZLF01041444.1 142188 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Macaca nemestrina V844 trav JZLF01041444.1 124852 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Macaca nemestrina V845 trdv JZLF01041444.1 39329 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSHDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Macaca nemestrina V846 trdv JZLF01041444.1 18409 VMSAVELVPEHQTVIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Macaca nemestrina V847 trav JZLF01041446.1 23967 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIYWYRQRPSQGPEYVIHGLTSNNNRMASLTITEDRKSSTLILHHATLRDAAVYYCILR
Macaca nemestrina V848 trav JZLF01041446.1 19315 VTSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Macaca nemestrina V849 trav JZLF01041446.1 6441 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Macaca nemestrina V850 trav JZLF01041446.1 1655 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPIFLFTLTSSGIEKKSGRLSSILDKKDLFSILNITATQTRDSAVYLCAVE
Macaca nemestrina V851 trav JZLF01041450.1 13882 VRSQQPVQSPQAVILQEGEDAIINCNSSKALYSVLWYRQKHGEAPIFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSRTYFCGAE
Macaca nemestrina V852 trav JZLF01041452.1 3493 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVRVVTGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Macaca nemestrina V853 trav JZLF01041453.1 5603 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Macaca nemestrina V854 trdv JZLF01041464.1 4084 LGFSVAQKVTQAQSSVSMPVEKAVTLNCQYETSSWSYDLFWYKQLPGKEMIFLIRQGSSEQNARNGRYSVNFKKEASFIALTISALQLEDSATYFCALWE
Macaca nemestrina V861 igkv JZLF01043950.1 1494 TTGEIVMTQSPATLSLSLGEKATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYYCLQSSNW
Macaca nemestrina V908 igkv JZLF01053956.1 880 TTGEIVLTQSPATLALSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLLIYGASSRASGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQESNWK
Macaca nemestrina V909 igkv JZLF01053959.1 25017 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYSSSP
Macaca nemestrina V910 igkv JZLF01053959.1 6721 ARCDIQMTQSPSSLSASVGDRVTITCQASQSISNWLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca nemestrina V911 igkv JZLF01053960.1 11268 ARCDIQMTQSPSSLSASVGDTVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQSEDFATYYCQQYSSRP
Macaca nemestrina V912 igkv JZLF01053960.1 6803 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQPPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Macaca nemestrina V913 igkv JZLF01053963.1 9215 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQSEDFATYYCLQYSSSP
Macaca nemestrina V914 igkv JZLF01053964.1 39570 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYDNLP
Macaca nemestrina V915 igkv JZLF01053964.1 20409 TTGEIVMTQSPATLSLSLGEKATLSCRASQSVSSSLAWYQQKPGQPPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYYCLQRSNW
Macaca nemestrina V916 igkv JZLF01053966.1 15604 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPKLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Macaca nemestrina V917 igkv JZLF01053967.1 20138 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYAATTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAAYYCLQHNSYP
Macaca nemestrina V918 igkv JZLF01053974.1 3242 ARCDIQMSQSPSSLSASVGDRVTITCRASQGISNALAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca nemestrina V919 igkv JZLF01053976.1 1341 TTGEIVMTQSPATLSLSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYYASNRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQQYNNW
Macaca nemestrina V963 trbv JZLF01063221.1 169493 HTEAGVTQFPSHRVIEKGQAVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFLRASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Macaca nemestrina V964 trbv JZLF01063221.1 163940 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFYYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Macaca nemestrina V965 trbv JZLF01063221.1 158127 SPGEEVTQTPKHLVKGERQKAKLYCAPIKGYSYFFWYQRVLKKEFKFLISFQNENVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAAYFCASSQ
Macaca nemestrina V966 trbv JZLF01063221.1 141877 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKEWFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Macaca nemestrina V967 trbv JZLF01063221.1 138691 TMDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQKGDIAEGYSVSRERKESFPLTVTSAQRNPTAFYLCASSI
Macaca nemestrina V968 trbv JZLF01063221.1 130875 GSGLAAVVSQYPSRVICKKGTSVKIECRCLDFQATTMFWYRQFQTQSLILMATSNEGSGVTYEQGIKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Macaca nemestrina V969 trbv JZLF01063221.1 120786 STDTKVTQRPRLLVKANKQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Macaca nemestrina V971 trbv JZLF01063221.1 111805 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTYVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Macaca nemestrina V972 trbv JZLF01063221.1 99668 SMDADVTQTPRNKIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVQDINKGEISNGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Macaca nemestrina V973 trbv JZLF01063221.1 91833 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRLRIEHFPLTLESASPSHTSQYLCASSE
Macaca nemestrina V974 trbv JZLF01063221.1 51790 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSVNVEMVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYLCASSL
Macaca nemestrina V975 trbv JZLF01063221.1 46435 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Macaca nemestrina V976 trbv JZLF01063221.1 26663 SVFSAVVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Macaca nemestrina V977 trbv JZLF01063222.1 2469 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Macaca nemestrina V978 trbv JZLF01063224.1 376 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKDPIDDSGMPKDRFSATMPDASFSTLKIQPSEPRDSAVYFCASSL
Macaca nemestrina V979 trbv JZLF01063225.1 88868 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDAQLDKSGLPNDRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca nemestrina V980 trbv JZLF01063225.1 80423 PVDTGVTQSPTHLIKTRGQQVTLRCCPISGHSNVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca nemestrina V981 trbv JZLF01063225.1 72997 PGNADVTQTPKFQVLKTGQSLTVQCAQYMNHDCMYWYRQDPGMGLKLIHYSVGAGITDKGEVPNGYNVSRLNTEDFPLRLESAALSQTSVYFCASSE
Macaca nemestrina V982 trbv JZLF01063225.1 60584 PVDAGVTQSPTHLIKMRGQQVTLRCSPISGHSSVSWYQQALGQGPQLIFEYYEKEERGRGNIPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca nemestrina V983 trbv JZLF01063225.1 53295 PVNAGVTQTPKFQVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESADPSQTSVYFCASSY
Macaca nemestrina V984 trbv JZLF01063225.1 48989 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKAQLDKSGLPNDRFSAERPEGSVSTLTIQRTEQQDSAVYLCASSL
Macaca nemestrina V985 trbv JZLF01063225.1 39829 PVDAGVVQSPTHLIKTRGQQVTLRCSPISGHNTVYWYQQALRQGPQLIFQYYRGEDRGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Macaca nemestrina V986 trbv JZLF01063225.1 29071 HADAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSFSTLMIQHTEQGDSAMYLCASSL
Macaca nemestrina V987 trbv JZLF01063225.1 22263 SVAAGVIQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYQKMQREKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASSL
Macaca nemestrina V988 trbv JZLF01063225.1 14812 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATHSQTSVYFCASSE
Macaca nemestrina V989 trbv JZLF01063225.1 3866 LTEAGVTQSPRYKITEKKQLVAFWCNPISGHNTLYWYRQNLGQGPELLVQYENEEAVDDSQLPKDRFSAERLKGIDSTLRIQPAELGDSAVYLCASSL
Macaca nemestrina V990 trbv JZLF01063226.1 30830 PVDAGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGSQFIFQYYEKEERERGNFPGRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Macaca nemestrina V991 trbv JZLF01063226.1 19278 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAARPEGSVSTLKIQRTEQRDSAVYLCASSL
Macaca nemestrina V992 trbv JZLF01063226.1 13897 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGQGPQLIFEYDRKEERVRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Macaca nemestrina V993 trbv JZLF01063226.1 7859 PGNAAVTQTPKFQVLKTGQSMTLQCAQDMNHECMSWYRQDPGMGLRLIHYSAAPGITDKGEVPNGYNVSRSNTEDFLLRLELAASSQTSVYFCGSSY
Macaca nemestrina V994 trbv JZLF01063227.1 10520 PTGARVSQSPRYKVTKRGQDVALRCDPISGHATLYWYQQALGQGPEILTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca nemestrina V995 trbv JZLF01063228.1 1276 LVNVGVTQTPKFQVLKTGQSMTVQCAQDMNHDFMFWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNASRLNTEDFPLRLESAAPSQTSVYICASSY
Macaca nemestrina V996 trbv JZLF01063229.1 1769 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVYWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEVGDSALYLCASSL
Macaca nemestrina V997 trbv JZLF01063230.1 120359 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHNALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Macaca nemestrina V998 trbv JZLF01063230.1 97813 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTGAVDESGLRSDRVSATWPEGSVSTLKIQHTEQGDSAMYFCASSL
Macaca nemestrina V999 trbv JZLF01063230.1 92773 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQAPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDLALYLCASSL
Macaca nemestrina V1000 trbv JZLF01063230.1 90090 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFADLHSELNLSSLELGDSALYFCASSE
Macaca nemestrina V1001 trbv JZLF01063230.1 81976 RRDAEIIQSPRHKITETGRKVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Macaca nemestrina V1002 trbv JZLF01063230.1 70606 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQNKGVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Macaca nemestrina V1003 trbv JZLF01063230.1 57978 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFLLTLESATRSQTSVYFCASSE
Macaca nemestrina V1004 trbv JZLF01063230.1 48827 LTEAGVAQSPRYKVIEKSQAVTFWCDPISGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTFKIQPAELGDSAVYLCASSL
Macaca nemestrina V1005 trbv JZLF01063230.1 31648 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMCWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCGSSY
Macaca nemestrina V1006 trbv JZLF01063230.1 19540 PVQAGVTQSPTHLIKTRGQQVTLRCSPISGHTNVYWYQQALGQGPQFILWYDEEEERDRGTFPHRFSGHQFPNYSSELNVNALEVEDSALYLCASSL
Macaca nemestrina V1007 trbv JZLF01063232.1 929 PVNAGVTQTPKFQVLKTGQSMTLKCAQDMNHDRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPNGYNASRLKKKDFLLRLESAAPSQTSMYFCASSE
Macaca nemestrina V1008 trbv JZLF01063233.1 26184 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSATQDTTDPGEVPDGYSVSRLNKTEFLLRLESAAPSQTSVYFCASSE
Macaca nemestrina V1009 trbv JZLF01063233.1 11554 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca nemestrina V1010 trbv JZLF01063233.1 8114 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFVPECPDSSHLYLHLHALQPEDSALYLCASSQ
Macaca nemestrina V1011 trbv JZLF01063234.1 26450 HTEPEVTQTPSHQVTRMGQEVILQCVPIPNHLYFYWYRQILGQKVEFLVYFYNGEISEKSEIFDDQFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Macaca nemestrina V1012 trbv JZLF01063234.1 15645 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPEIMFIYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Macaca nemestrina V1013 trbv JZLF01063234.1 4694 PVEAGVTQTPRSLIKMRGQQATLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRQKGNFPNRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Macaca nemestrina V1014 trbv JZLF01063236.1 19803 SLDTAVSQTPKYLVTQTGKNEYLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKKLFINETVSNRFSPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Macaca nemestrina V1015 trbv JZLF01063236.1 15164 PIDSGITQTPKHLVMGMTNKKSLKCEQHMGHRAVYWYKQKAKKPPEIMFMYNYEKLSINESVPSRFSPECSQSSLFYLHLHALQPEDSVLYLCASSQ
Macaca nemestrina V1016 trbv JZLF01063236.1 6941 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVSFYNGKISEQSEIFEDQFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Macaca nemestrina V1021 ighv JZLF01063832.1 453 AHSQEQLVQSGAEVKKPGASVKVSCKASGYIFTSYIISWLRQAPGQGFEWMGGINPSDGSTSYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCAA
Macaca nemestrina V1025 ighv JZLF01064510.1 14072 AQSQVQLVQSGAEVKKPGSSVKVSCKASGYTLTSSAMQWVRQAPGQGLEWIGAIIIGNGNTNYAQKFQGRVTITRDTSTSTGYMELSSLRSEDSAVYYCAA
Macaca nemestrina V1026 igkv JZLF01064620.1 1445 TTGEIVMTQSPATLSLSPGERATLSCRASQSVGSTLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTEFTLTISSLDPEDVGVYYCQKYNDWP
Macaca nemestrina V1027 igkv JZLF01064623.1 4954 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKRLIYDASSLQSGVPSRFSGSGSGTVFTLTISSLQPEDFAAYYCLQY
Macaca nemestrina V1028 igkv JZLF01064625.1 24556 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGIPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Macaca nemestrina V1029 igkv JZLF01064625.1 17927 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSAP
Macaca nemestrina V1030 igkv JZLF01064625.1 936 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNALAWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQGYSTP
Macaca nemestrina V1031 igkv JZLF01064626.1 1328 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQPFKNYL
Macaca nemestrina V1032 igkv JZLF01064630.1 11569 ARCDIQMTQSPSSLYASVGDKVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYNSNP
Macaca nemestrina V1033 igkv JZLF01064631.1 51176 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Macaca nemestrina V1034 igkv JZLF01064631.1 34902 VRGDIQMTQSPSSLSASVGDTVTITCRASQSFSSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDIASYYCQQYYSYP
Macaca nemestrina V1035 igkv JZLF01064631.1 19320 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Macaca nemestrina V1036 igkv JZLF01064632.1 53265 TTGQVILTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Macaca nemestrina V1037 igkv JZLF01064632.1 47474 VRCDIQMTQAPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Macaca nemestrina V1038 igkv JZLF01064633.1 9803 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLVKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Macaca nemestrina V1039 igkv JZLF01064634.1 12132 STGDVAMTRSPLSLPVTPGQPASISCRSSQSLLHSNGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMEG
Macaca nemestrina V1040 igkv JZLF01064635.1 39304 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYFDWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCVQAIAFP
Macaca nemestrina V1041 igkv JZLF01064635.1 15091 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNGYNYLNWYLQKPGQSPQLLIYYGSNRASRVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca nemestrina V1042 igkv JZLF01064635.1 6804 TRCAIQMTQSPSSLSASVGDRVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEEVATYYCQKCDSAP
Macaca nemestrina V1043 igkv JZLF01064636.1 579 SSGDVVMTQSPLSLPITPGQPASISCRSSQSLVHSNGNTYLSWYQQKPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCGQS
Macaca nemestrina V1044 igkv JZLF01064637.1 26079 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNYLSWYQQKSAEAPKRLIYYASSLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNFP
Macaca nemestrina V1045 igkv JZLF01064637.1 20622 FSADVVMTQSPLSLPVTPGQPASMTCRSSQSLLHSNGNTYLSWFLQKPGQPPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Macaca nemestrina V1046 igkv JZLF01064640.1 3315 SSGDIVMTQTPLSLPVTAGEPASISCRSSQSLLHSNGNTYLYWYLQRPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Macaca nemestrina V1047 igkv JZLF01064642.1 16702 ARCDIQMTQSPSSLSASVGDRVTITCRASENVNNYLHWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTDYTFTISSLQSEDVATYYCQHSYGTP
Macaca nemestrina V1048 igkv JZLF01064642.1 1365 SSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHTDGRTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Macaca nemestrina V1049 igkv JZLF01064645.1 37252 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKVPKLLIYDASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQHGYGI
Macaca nemestrina V1050 igkv JZLF01064645.1 2053 SSGDIVMTQTPLSLPITPGEPASISCRSSQSFLDSDDGYTYLDWYLQKPGQPPQPLIYFVSSQASGVPDRFSGSGSGSDFTLKISGVEADDVGVYYCMQCIEFI
Macaca nemestrina V1051 igkv JZLF01064646.1 15966 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLYSCGYTYLYWYLQKPGQSPQLLIHEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Macaca nemestrina V1052 igkv JZLF01064646.1 6105 ARCDIQMTQSPSSLSASVGDRVTITCRASQGITNDLAWYQQKPGETPKLLIYAASGLQSGIPSRFSGSGSGTDFTLTISSLQSEDFATYYCQHYYSTP
Macaca nemestrina V1053 igkv JZLF01064648.1 93922 YSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEFP
Macaca nemestrina V1054 igkv JZLF01064648.1 63139 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQPLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALEFP
Macaca nemestrina V1055 igkv JZLF01064648.1 40558 SSGDIVMIQTPLSLPVTLGEPASISCRSSQSLVYSDGKTYLDWYLQKPGQSPQLLMYLVSKRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Macaca nemestrina V1056 igkv JZLF01064648.1 32449 ARCDIQMTQSLSSLSASVGDRVTITCRASQGINNELAWYQQKPGKVPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYNTP
Macaca nemestrina V1057 igkv JZLF01064648.1 24257 SSGNIVMTQTPLSLPVTPGEPASISCRSSQSLLDSYGYTHLHWYLQKPGQSPQLLIYLVSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTP
Macaca nemestrina V1058 igkv JZLF01064648.1 12970 ARCDIQMTQSPSSQSASVGDRVTITCQASQSLSNYLNWYQQKPGKIPKLLIYRASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGYSYP
Macaca nemestrina V1059 igkv JZLF01064650.1 91686 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFDSDYANTYLDWYLQKPGQSPQLLIYMLSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEYP
Macaca nemestrina V1060 igkv JZLF01064650.1 34860 ARCDIQMTQSPSSLSASVGDRVTVTCRASQGINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYTTP
Macaca nemestrina V1061 igkv JZLF01064650.1 16534 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLQHSNGYTYLYWYLQKPGQSPQLLMYFASYQASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQD
Macaca nemestrina V1084 igkv JZLF01068751.1 2428 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQSTKDP
Macaca nemestrina V1091 ighv JZLF01071769.1 11076 VQCEVQLAESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAPEEGLEWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Macaca nemestrina V1152 iglv JZLF01085340.1 49948 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSRYVQWYQQRPGSAPTTVIYRDNERPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADGSYN
Macaca nemestrina V1153 iglv JZLF01085340.1 8882 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGNPPRYLLSLYQNSLHDLGSGVPRRVSGLMEDWSNKGLLLISDLQPEDEADYYCMI
Macaca nemestrina V1154 iglv JZLF01085343.1 5090 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSEYVQWYQQRPGSAPTTVIYRDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADDSYN
Macaca nemestrina V1155 iglv JZLF01085345.1 2795 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Macaca nemestrina V1156 iglv JZLF01085358.1 31970 QSVLTQLPSVSGGPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGVCLDCSSLVIVIDPQESLTDFSGSKSGNLASLTITGLWPEDEADYHCQS