WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Aotus nancymaae JYKP00000000.1 (JYKP01) 140 25 15 22 35 34 4 5
Aotus nancymaae JYKP00000000.2 (JYKP02) 150 30 16 22 36 37 4 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Aotus nancymaae V19 ighv JYKP01009236.1 2754 AAGGVWGRFGTALVGGSLKLSCAASGFTFSSYSIGWVHQAPEKGLEWVSTIGTDGSTYYADSIKGQFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V20 ighv JYKP01009241.1 845 VQCEVQLVESGGGLLQSGGSMRLSCVASGFTFSSYGMDWVRQAPGKGLEWVSYISSSGGTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEGTTVYYCA
Aotus nancymaae V26 trav JYKP01012479.1 9477 MCLVIGTAGQNIDQPMEVTAMEGAIVQINCTYQTAGFNGLSWYQQRDGKAPTFLSYSVLDGLEERGHFSSFLNRSKGYSYLLVKELQMKDSASYLCAVR
Aotus nancymaae V27 trav JYKP01012481.1 9679 TWSLAKTTQPISMDSYEGQEVNISCRHDNIATSDYIFWYQQFPNQGPRFIIQGYKTNVANEVASLFIPADRKSSTLSLPRVALSDTAMYYCIVG
Aotus nancymaae V28 trav JYKP01012482.1 7220 MSSGEDVERSLFLSVREGDSVVINCTYTDSSSSYLYWYKQEPGASLQLLAYILSNTDTKQDQRLTVQLDKKNKHLSLSIAETQTGDSAIYFCAES
Aotus nancymaae V29 trav JYKP01012482.1 17527 DARAQSVSQPDYHVILSEGASLELRCNYSYSGIVYLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAEFMKSRSSFNLRKPSVQWSDTAEYFCAVS
Aotus nancymaae V30 trav JYKP01012482.1 28942 GINGDSVVQTEGEVLLNEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKAMKGNDKGRSNKDFEAIYRTETTSFHLEKGSVRESDSAMYFCALS
Aotus nancymaae V31 trav JYKP01012484.1 1936 GSGKNQVEQSPQSLVILEGKNCTLQCNYTVTSFNNLRWYKQDTGKGPATLIIMTFSENTKSNGRYTATLDANTKQSSLHITASQLSDSASYICVVS
Aotus nancymaae V32 trav JYKP01012485.1 1806 VNSLHIPEQSPLILTIQEGTHAILNCAYQERTLFNFHWFRQDPGKGLVSLALIQSSQKEQGDKHFKELLGKEKFYSVWNIPASHPGDSATYFCAL
Aotus nancymaae V33 trav JYKP01012486.1 2244 VWSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSVSQYFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLDRASQHVSLLIRDSQLSDSATYLCAV
Aotus nancymaae V34 trav JYKP01012488.1 2649 DARAQSVTQPDIHISISEGASLELRCNYSYGATAYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVS
Aotus nancymaae V35 trav JYKP01012489.1 14045 VNGENVEQRPSTLSVQVGDSSVISCTYSDSASNYFPWYKQELGKGPRLIIEIRSNVDKRKDGRMTVLLNKTAKHFSLHITDTQPGDSALYFCAAG
Aotus nancymaae V36 trav JYKP01012489.1 33244 VWSQQKVEQNSGPLNVPEGVIASLNCTYSDRGSQSFYWYRQYSGKSPELLMSIYSNGDEEDGRFTAQLNRASQHVSLLIRDSQLSDSATYLCAV
Aotus nancymaae V37 trav JYKP01012489.1 37599 GTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVSVYPFWYVRYPNQGLQFLLKYVSGPTLVKGIKGFEAEIKKSESSFHLRKSSAHVSDAAEYFCAVS
Aotus nancymaae V38 trav JYKP01012489.1 52224 VWSQQKDVEQNPGPLSVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLMFISSSDKKDGRFTAQLNKSSQYISLFIRDSQPSDSATYLCAM
Aotus nancymaae V39 trav JYKP01012490.1 3914 GTRAQSVTQLDSQVLVSEGAPVELRCNYSSSFSLSLFWYVQYPNQGLQLLLKYASGPTLVKGINGFEAEFKKSETSFHLRKPAAHISDAAEYLCAVN
Aotus nancymaae V40 trav JYKP01012490.1 15472 GTRAQRVTQPEKTLSVFEGDPVQLKCNYSYSGSPDLFWYVHYPKQRLQLLLRHISRESVKGFTADLNKGETSFHLEKQFAQEEDSAMYYCALS
Aotus nancymaae V41 trav JYKP01012490.1 23567 VNSQQGEEEPQTLSIQEGENATMNCSYKTSITSLQWYRQDSSRGLTQLILIRSNEREKYSGRLRVTLDTFTKSSSLFIAAAQAADTAAYFCATE
Aotus nancymaae V42 trav JYKP01012490.1 29021 RTYGDSVIQTEGPVTLPEGAALTLNCTYQSSYSTFLFWYVQYLNKEPQLLLKSSENQEMDSRGFRASHVKSDSSFHLEKPSVQLSDSAMYYCALR
Aotus nancymaae V43 trdv JYKP01012490.1 32228 SSMAQKVTQAQTEISVVEKEDVTLDCLYETSDTTYYLYWYKQPPTREMIFLIRQNSFNEQNEINGRYSWNFQRSTSSFNFTITASQVIDSAVYFCALSE
Aotus nancymaae V44 trav JYKP01012491.1 768 LSGEDQVTQSPEALRLQEGDSSSLNCSYSVGNFRGLLWYRQDPGKGPEFLFILYSAGEEKQKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Aotus nancymaae V45 trav JYKP01012492.1 7633 VSSKQEVMQIPAALSVPEGDGLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGYSTLYIAASQPGDSATYLCAV
Aotus nancymaae V46 trav JYKP01012495.1 260 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVTNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVIMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Aotus nancymaae V47 trdv JYKP01012497.1 7131 SSVAQKVTQAQLPISMPVGKAVTLNCLYETRQEFYYIFWYKQLPSRRIVFLIRQYSAERNVKRDRYSVNFRKARKSIDFTISALQLGDSATYLCALWE
Aotus nancymaae V48 trav JYKP01012497.1 15539 VSSILNVEQSPQSLRVQEGDSTNFTCSFPSSSFYALHWYRWETAKSPENLFVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGTQPEDSATYLCAI
Aotus nancymaae V49 trav JYKP01012497.1 22863 VNGQQIMQIPHFQHVQEGADFTIYCNFSTTLNNIQWYKQRPGGHPIFLIKLVKSGEVMKQKRLTFQFGEARKNSSLHITATQTTDAGTYFCA
Aotus nancymaae V50 trav JYKP01012497.1 33619 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQVHSQGPQYVIHGLKNNETNEMASLIIAEDRKSSTLILPHATLRDAAVYYCIVRV
Aotus nancymaae V51 trav JYKP01012497.1 40019 GTRAQSVTQLDGHITVSEGAPLMLRCNYSYSGTPYLFWYVQYPSQSLQLLLKDLTGATQVKGIKGFEAELSKSETSFHLRKPSAHVSDTAVYFCAVS
Aotus nancymaae V52 trav JYKP01012504.1 2376 IMGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIHWYRQLPSKGPEYVIHGLTSNVNNRMASLIIAEDKKSSTLILHRATLGDAAVYYCILR
Aotus nancymaae V53 trav JYKP01012505.1 1520 ISSQELEQSPQSLIIQEGKNLTINCRSSKTLYALHWYKQKYGEGLIFLMMLQKGGEEKNHEKITAKLDEKKQQSSLYITASQPSHTGIYLCGAD
Aotus nancymaae V54 trav JYKP01012505.1 12304 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFSTLLWYKQDTGEGPVLMITLYKGGELIRNGRLTAQFGITRKDSFLNISASVPGDVGTYFCAG
Aotus nancymaae V55 trav JYKP01012512.1 8298 FSIAQRVTQSESEMSVQVAETVTLNCTYDTSDSNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLRISDAQLGDTAMYFCAYR
Aotus nancymaae V56 trav JYKP01012513.1 3685 LRGELKVGQSPLFLSTQEGKNCTIYCNYSTTVSDRLHWYRQDPGKRLESLFVLLSNGAVIQKGQLTASLDTKARLSTLHITAPVHGLSATYFCAV
Aotus nancymaae V57 trav JYKP01012514.1 1222 GTNSNSVKQTDQVTISEAASVTMNCTYTSTGYPTLFWYVRYPNKPLQFLWEETTENSKNFGARNIKDKNSRIVKHSVQVSDSAMYYCLLRDTVLR
Aotus nancymaae V58 trdv JYKP01012523.1 13137 VSLDIILESDTKALTVLAGEAASFRCSVTGGDLKNHQVSWYKKSEDNSLILVFKLSNSSNYNLGNNFMGKTEALKNQFMLDIQKATTKDVGTYYCASD
Aotus nancymaae V59 trdv JYKP01012526.1 4039 VMSAIQLVPEHQTVTVSLGDPATLRCSMKGEAITNYYINWYRKTQGNTMTFIYREKDIYGPGFKDGFQGEIDVEKDQAVLEILAASERDEGSYYCASD
Aotus nancymaae V88 trav JYKP01023875.1 932 VSAAKNEVQQSPQDLTVQEGEFITINCSYSVGITTLQWLQQHPGGGIFSLFTLSSEKKKNGRLIATINLQEKHSSLHITASQPRDSVIYICAV
Aotus nancymaae V92 ighv JYKP01025290.1 1525 VLSQVTLKESGPAQVKPTQTLTLTCTFSGFSLSTSGIGVSWIRQPPGKALEWLAAIYWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTHMDPVDTATYYCARS
Aotus nancymaae V93 ighv JYKP01025293.1 355 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFNNYWMTWVRQAPGKGLEWVGVINPDGGRTNYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTAVYYCTR
Aotus nancymaae V94 ighv JYKP01025293.1 6453 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSFGMDWVRQAPGKGLEWVSAIGTGGSTYYADSVKGRFTISRDNAKNTLFLQMNSLRAEDTAVYYCAKE
Aotus nancymaae V95 ighv JYKP01025294.1 1849 VLSQVQLQQRGPGLVKPSETLSLTCAVYGYSISSGDGWNWIRQPPGKRLEWIGRIYRGGSTYYNPSLKSRVTISADTSKNQFSMRLSSVTAADTAVYYCA
Aotus nancymaae V96 ighv JYKP01025294.1 7932 VQCEVQLVESGGGLAKPGGSLRLSCVASGFTFSSYGMDWVRQAPGKGLEWVSAIGTDGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V97 ighv JYKP01025296.1 5348 AHSQVQLVQSGPELKQPGASVRVSCKASGYTFSSYGINWVRQGPGQGLEWMGWINTYTGKPTYAQGFTGRFVFSMDTSVSTAYLQISNLKAEDTAVYYCAR
Aotus nancymaae V122 trbv JYKP01037848.1 325 HGDAEITQSPRHKVTETGRQVTLNCHQTWNHEYMYWYQQDLGHGLRLIHYSIAVDNTEKGEVFDGYVVSRSKLEDFSLTLESATHFQTSVYFCASSN
Aotus nancymaae V133 ighv JYKP01044696.1 1135 VHSQVQLVQSGAEMKNPGASVKVSCKASGYTFTSYFMYWVRQAPGQGLEWMGWINTNTGGTGYAQKFQGRVTITRDTSASTAYMELSSLRPEDTAVYYCT
Aotus nancymaae V157 ighv JYKP01062416.1 701 VQCEVHLVESGGGLVQPGGSLRLSCAASGFTFGNYWMYWIRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Aotus nancymaae V196 trgv JYKP01089937.1 463 SEISSNLEGRMRTVTGTTGSSAVITCDLPGENTRYIHWYLHQEGKAPQRLLYCDTYNSRVMLDSGISPGKMDSYAIMRRSWKLIVQNITENDSGVYYCATWD
Aotus nancymaae V197 trgv JYKP01089937.1 4711 SQISSKLEGRTKSVTGRTGSSAAITCDLPVENTRYIHWYLHQERKAPQRLLYYDTYQIKVVLDSGISPGKYDIYAITRRSWKLVLQNLIEDDSGVYYCATWD
Aotus nancymaae V198 trgv JYKP01089940.1 8937 HLEQPQISSTKTLSKTARLECVVYGAKISETSIYWYRERPGEAIQLLVYISSDGAVRMESGITSGKFEVDRVPETSTSTLTIHNVEKKDIATYYCAFWE
Aotus nancymaae V199 trgv JYKP01089942.1 360 GDNKMRISQDQLSSTRRVDRTVHVGCKLSGLPLENTAVHWYQQKEGEPLRRILYDSAKNYKQDRPNPRLEADIDDNIFYLIINNVAKLDEATYYCACWD
Aotus nancymaae V281 trav JYKP01137527.1 33672 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Aotus nancymaae V285 ighv JYKP01140168.1 1849 VLSQVQLQQRGPGLVKPSETLSLTCAVYGYSISSGDGWNWIRQPPGKRLEWIGRIYRGGSTYYNPSLKSRVTISADTSKNQFSMRLSSVTAADTAVYYCA
Aotus nancymaae V286 ighv JYKP01140168.1 7932 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAVIWYDGSTSYADAVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAK
Aotus nancymaae V287 ighv JYKP01140169.1 728 VHSQVQLVQSGAEVKKPGASVKVSCKASGYTFSSYAISWVRQAPGQGLEWMGVIIPILGRTGYAQKFQGRVTMTADTSASTAYMELSSLRPEDTAVYYCAR
Aotus nancymaae V288 ighv JYKP01140176.1 10297 VHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMSWVRQAPGKGLEWMGRIDPENGDTSYAQKFQGRVTMTADTSTNTAYMELSSLRPEDTAVYYCT
Aotus nancymaae V289 ighv JYKP01140176.1 15982 VQCEVQLVESGGGLAKPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLEWVSAISTDGSGTSYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V290 ighv JYKP01140186.1 1035 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPGRGLEWLGRTYYRSKWYYDYAASLPSQITINPDTSKNQFSLQLNSVTLEDTAVYYCAR
Aotus nancymaae V307 igkv JYKP01147902.1 10031 ARCDIQMTQSPTFLSASVGDRVTITCQASQSIGSALAWHQQKPGKATRSLIYGTSSLQPGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
Aotus nancymaae V308 igkv JYKP01147902.1 28427 SSGDVVMTQTPLSLPTTPGEPASISCRSSQSLLHSNGNTYLSWFLQKPGQSPRLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Aotus nancymaae V309 igkv JYKP01147902.1 43072 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMSYLQAP
Aotus nancymaae V310 igkv JYKP01147902.1 61008 ARCDIQMTQTPSSLPASVGDKVTITCRASQGISSWLAWYQQKPGKAPKLLIHKASNLETGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYNYIP
Aotus nancymaae V311 igkv JYKP01147904.1 2475 SSGDVVMTQTPLSLSITPREPVSISCRSSQSLVHSNGNTYSSWFLQKPGQSPRLLIYEASTWESGVPDRFSGSGTGTDYFTLKISRMEAEDVGVYYCMQG
Aotus nancymaae V312 igkv JYKP01147904.1 12559 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIEFP
Aotus nancymaae V313 igkv JYKP01147904.1 22122 TRCDVQMTQSPSSLSASVGDRVTITCHASQSISNWLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYDSSP
Aotus nancymaae V314 igkv JYKP01147904.1 48211 SSGDIVMTQTPLFLPVTPGEPASISCRSSQSLLHSNGNTYLSWFLQKPDQSPRRLIYKVSTRGPGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQS
Aotus nancymaae V315 igkv JYKP01147904.1 67638 SRGEIVLTQSPAFLSVTPREKVTITCRASQGVSNSLHWYQQKPDQAPKFLVKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSYNW
Aotus nancymaae V316 igkv JYKP01147906.1 13581 TTGQIVMTQSPATLSLSPGERASLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPDDFAVYYCQQRSSWP
Aotus nancymaae V317 igkv JYKP01147908.1 1647 IRCDIQMTQSPFFLSASIGDTVTISCQASKAISNDLAWYQQKLGKSPTLLIYEATNLYTRVPSRFSGSGSGTDYCLTISNLELEDFATYYCKQELSYP
Aotus nancymaae V318 igkv JYKP01147908.1 28727 SSGDIVMTQTPLSLPITLGEAASISCRSSQSLLHSNGNTYLNWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGAYYCMQALQHP
Aotus nancymaae V319 igkv JYKP01147909.1 10839 TRCDIQMTQSPLSLSASVGDRVTITCQASQGITNDLAWYQQKPGNASKLLIYEASSLQSEVPSRFSGSGSGRDFTLTISSLQPEDFVTYYCQ
Aotus nancymaae V320 igkv JYKP01147910.1 10375 SSGDIVMTQTPLSLPVTAGETASISCRSSQSLLYSDGNTYLNWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQALQHP
Aotus nancymaae V321 igkv JYKP01147911.1 16391 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISKYLAWYQQKPGKAPKPLIYYASSLQSGVPSRFSGSGSGADYTLTISSLQPEDFATYYCQQYNSFP
Aotus nancymaae V322 igkv JYKP01147912.1 26502 STGQIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQVPRLLIYGASNRAAGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNWS
Aotus nancymaae V323 igkv JYKP01147914.1 8546 SSGNIVMTQSSLSLPVTPGEPASISCRSSQSLLHSNGNTYLWWHLQKPGQSPQPLIYEVSNRFSGVPDRFSGSGSETDFTLKISRAEAEDVGVYYCMQS
Aotus nancymaae V324 igkv JYKP01147914.1 22217 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISKWLAWYQQKPGTVPKLLIYDASKLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Aotus nancymaae V325 igkv JYKP01147914.1 35125 TTGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNWP
Aotus nancymaae V435 trbv JYKP01206965.1 1126 PMDTGVTQTPKHLVTGMTNEKSLECEQHLGHNAMYWYKQKAKRPPELMFVYNYKEISVNESVPIRFSPECPDSSHLHLHLHALQPEDSALYLCTSSQ
Aotus nancymaae V469 ighv JYKP01231749.1 2121 VHSQVQLVQFGAEMKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQVLEWMGWINTNTGGTSYAQKFQGIVTMTRNTSTSTAYMELSSLRSEDMAVYYCMR
Aotus nancymaae V480 trbv JYKP01242517.1 68939 HTEPEVIQTPSHQVTRMGQEVILRCVPIPNHLNFFWYRQILGKKFEFLVYFYNDNISDKSEIFDDRFSVKRPDGSNFTLKIQSTKPEDSAMYFCASSQ
Aotus nancymaae V481 trbv JYKP01242517.1 77311 PSDSAVSQTPKYLVTQIGKEESLKCEQNLGHNAMYWYKQDSKKLLKIMFSYNNKALILNETVPNRFSPESPDKARLNLHIESLELGDSAVYFCASSQ
Aotus nancymaae V482 trbv JYKP01242518.1 73 SMDTGVTQTPKHLVMGMTNEKSLECEQHLGHNAMYWYKQKAKRPPELMFVYNYKEIYVNESVPIRFSPECPDSSHLHLHLHALQPEDSALYLCASSQ
Aotus nancymaae V483 trbv JYKP01242518.1 9418 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHNSVYWYQQAPGQDPQFLFEYYNEIERQKGNFPARFSGRQFSNYSSEMDVSGLELGDSALYLCASNL
Aotus nancymaae V484 trbv JYKP01242521.1 5544 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHNRVYWYQQAPGQDPQFLFQYYNEIQKQKGNFPARFSGRQFSNYSSEMNVSALELGDSALYLCASSL
Aotus nancymaae V485 trbv JYKP01242521.1 13625 PHTQDTFMPVSYTHLDVYKRQTLQCAQDMNHDGMYWYRQDPGMGLRLIHYSVAEGTTAKGEVSDGYNVSRSNTEDFPLRLEAAAPSQTSVYFCASSD
Aotus nancymaae V486 trbv JYKP01242522.1 6234 PVQAEVTQSPTHLIQTRGQQVTLSCSPISGHNSVSWYQQAPGQGPQFIFEYVNELKRSEGNFPGRFSGYQFSDYHSEMNISTLELGDSALYLCASSL
Aotus nancymaae V487 trbv JYKP01242522.1 8945 PVDSGVTQTPKHLLTAIGQRVALRCSPRSGDLSVYWYQQSLDQSLQFLIQYYNGNEREKGNIPERFSGQQFPNMSSELNLSSLELGDSALYFCASSV
Aotus nancymaae V488 trbv JYKP01242522.1 13050 NGDAEITQSPRYKVTETGRQVTLKCHQTWNHKYMYWYRQDLGHGLRLIYYSYGVPDVNKGEVPDGYVVSRSNPEDFPLTLESALSSQTSVYFCASSD
Aotus nancymaae V489 trbv JYKP01242522.1 25012 QTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLKLLSYFRSRTLVDDSEMPQDRFSAEMPNASFSTLRIQPTEPRDSALYLCA
Aotus nancymaae V490 trbv JYKP01242526.1 6616 LTEAGVSQSPRYKITEKRQAVGFWCNPVSGHAGLYWYQQTPGQGPKLLIQYQNEDVVDDSQLPKDRFSAERLKGVESTLKIQPAELGDSAMYLCASSL
Aotus nancymaae V491 trbv JYKP01242526.1 19970 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHYYMYWYRQDPGMGLRLIHYSVDKGTTDKGEVPEGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSD
Aotus nancymaae V492 trbv JYKP01242529.1 34 PVEAGVTQRPTHLIKTRGQQVTLRCSPISGHNSVSWYQQALGQGPQFILGYFEEEERNRGNFPNRFSGHQFGNYSSELNVSALELGDSALYLCASSL
Aotus nancymaae V493 trbv JYKP01242529.1 3444 HTGAGVSQSPRYKVTKRGQDISFKCDPISGHEMLYWYRQTLEQSPEFLTYFQYEVQQDKSGLPSDQFSAERAEGSFSTLKIQRTEQRDSAMYLCASSS
Aotus nancymaae V494 trbv JYKP01242531.1 2674 HAGAGVSQDPRHKVTKTGQNVTFGCDPISGHNRLYWYRQTLGQSPEFLTYFQNEAQLDKSGLPSDRFFAERTGGSFSTLKIQRTKQGDSAMYLCASSL
Aotus nancymaae V495 trbv JYKP01242531.1 9228 SVAAGVIQHPRHLIQEKRKTATLICHPIPGHDTVYWYQQGPGQGLQFLISYYEKMQRDKGSIPDRFAAQQFSDYHSELNMSSLELGDSALYLCASSL
Aotus nancymaae V496 trbv JYKP01242531.1 17555 HMDGRIIQSPTHKVTETGTPVTLICHQTENHRYMYWYRQDLGHGLRLIHYSYGVKDISKGEVPDGYSVSRSNTEDFPLTLESATGSQTSVYFCASSD
Aotus nancymaae V497 trbv JYKP01242534.1 3534 LTEAGVAQSPRYKITEKRQAVGFWCNPVSGHAGLYWYQQTPGQGPKLLIQYQNEDVVDDSQLPKDRFSAERLKGVESTLKIQPAELGDSAVYLCASSL
Aotus nancymaae V498 trbv JYKP01242534.1 7832 HTDAGVIQSPQHEVTEMGQEVTLRCEPISGHTQLFWYRQTMMRGLELLIYFNNKALIDDSGMPKDRFLAQMPNALFSTLKIQPSEPGDSAVYFCASSL
Aotus nancymaae V499 trbv JYKP01242537.1 11643 HGDAMVIQNPRYQVIQLGKPVTLSCSQDLNHDVMYWYQQKPSQPPKLLLYYYDKDLNNEADTPDNFQARRPNTSFCFLDIRSSGLGDAATYLCASSR
Aotus nancymaae V500 trbv JYKP01242538.1 2908 SPGEEVIQTQRHLVKGKGQKAILYCVPITGHGSVFWYQQVLKKELKFLISFQNENVFDETGIPKKRFSACPQNSSRSLEIQATEPQDSAVYFCASSQ
Aotus nancymaae V501 trbv JYKP01242540.1 10454 LSNAGVTQNPRHLVRRRGQEARLRCSPVEGHNHVYWYQQLLGEGPKFMIYLQKESIIDESGMPKERFSAEFPREGPSVLRIQQAERGDSAAYFCASSI
Aotus nancymaae V502 trbv JYKP01242540.1 13354 IVDGGITQSPKYLFRKEGQAVTLGCEQNLNHDAMYWYRQDPGQGLRLIYYSRIVDDFQEGDIAEGHSVSREKKESFPLTLTSAQWNQTAFYLCASSI
Aotus nancymaae V503 trbv JYKP01242541.1 1624 GSGLGDVVSQQPSRVICKTGTSVKIECRALDFQATTMFWYHQSQKQGLMLMATSNEGSKATYEQGFSEDNFPISHPNPTFSSLTVASARPEDSSFYLCSGR
Aotus nancymaae V504 trbv JYKP01242541.1 10676 SLDTKVTQRPRYVVTVKEQKAKIDCVPIKGHSYVYWYRKKLEEELKFLVYLQNEEIIQKSEVINERFSAQCPKNSPCALEIQSTESGDAGLYFCASSK
Aotus nancymaae V505 trbv JYKP01242541.1 20992 SFHAKVIQTPGYLVKRKGQKTEMDCTPEKGHTFVYWYQQNQNKELMFLISFQNEQILEETEMYKKRFLSQCPRNSPCSLAILSSDPGDRALYLCASSQ
Aotus nancymaae V506 trbv JYKP01242541.1 31786 SMDAGVTQTPRNRITKIGKKIMLECSQTRDDYQMYWYRQDPGLGLRLIYYSLGVRDINKGEISDGYSVSRQEQPKFSLSLESATPNHTALYFCATSY
Aotus nancymaae V507 trbv JYKP01242546.1 539 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSNNVDLVDKGDVPKGYNVSRKEKRNFPLILESPSPNQTSLYLCASSL
Aotus nancymaae V508 trbv JYKP01242546.1 5478 LVEVKVTQNTRYLVKRMGEKVFLECAQDMDHERMFWYRQDPGLGLRLIYFSYDITNDEKGDVPDGYSVSREKKEQFSLILGSASTNQTSVYLCASSL
Aotus nancymaae V509 trbv JYKP01242547.1 14740 SVFGAVVTQKPSRGICQRGTSMTIECEVDSQVNLMSWYRQLPGQSITLIATANQGFEATYEKGFAKDKFPISNPNPTFSTLNVSNVSPEDSSIYFCSAE
Aotus nancymaae V533 trdv JYKP01012529.1 18681 RGMLCDDVIQSSPDQTVASGSEVVLLCTYNVRYSNPDLFWYRIRPDHSFQFLLYEDGAGYQAAGFAQGRFSGRYIPTKKTFDLVISPVRTEDSATYYCAF
Aotus nancymaae V591 trav JYKP01049974.1 1024 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVTNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVIMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Aotus nancymaae V747 igkv JYKP01147915.1 7235 TRAETALTQSPALVSVTPGDKVTISCKASQDIDNDIYWYQQKPGEAPIFIIQEATTLVSGILPRFSGSGYGTDFTLTINNIEPEDAAYYFCQQDVNFP
Aotus nancymaae V748 igkv JYKP01147916.1 4540 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYNNKNYLAWYQQKPGQGPKLLISWASSRPAEIPDRFSGSGSGTDFTLTISSLQAEDVGLYYCQQYYSAP
Aotus nancymaae V750 trbv JYKP01149054.1 328 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDLMYWYRQDPGMGLRLIHYSAGEGTTDKGEVSEGYKVSRSNTEDFPLRLEAAAPSQTSVYFCASSY
Aotus nancymaae V764 trav JYKP01163800.1 2449 GSGKNQVEQSPQSLVILEGKNCTFQCNYTVTSFNNLRWYKQDTGKGPATLIIMTFSENTKSNGRYTATLDANTKQSSLHITASQLSDSASYICVVS
Aotus nancymaae V798 iglv JYKP01185725.1 20326 SMASYELTQPHSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQAPVLVIYQNNKRPSGIPERFSGSNSGNTATLTISGTQAVDEADYYCQVWDSSSDH
Aotus nancymaae V799 iglv JYKP01185726.1 9550 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYYIHWYQQRPGRSPQYIMGVNSDGSHSKGDGIPDRFSGSSSGADRFLTISSLQSEDEAEYHCGE
Aotus nancymaae V800 iglv JYKP01185727.1 16412 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKCVYWYQQKSGQAPVLVIYDNSDRPSGIPERFSGSNSGNTATMTISGVEAGDEADYYCQVWDSSSDH
Aotus nancymaae V801 iglv JYKP01185727.1 8446 SVVSSAVTQDTAVSVALGQTARITCQGDGIGTYSASWYQQKPGQAPVLVIYGNNKRPSGIPGRFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V802 iglv JYKP01185730.1 17595 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V803 iglv JYKP01185730.1 7633 SWAQSALTQPRSESGSPGQSVTISCTGTSSDVGSYNSVSWYQQHPGTAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Aotus nancymaae V804 iglv JYKP01185730.1 1292 SEASYELTQPPSVSVSPGQTARITCSGDALPNKYASWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V805 iglv JYKP01185731.1 620 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKCVYWYQQKSGQAPVLVIYGDSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Aotus nancymaae V806 iglv JYKP01185735.1 16918 SLSQPVLTQPPSTSASLEASVTLTCTLSSGYNNYAVDWYQQRPEKGPRFVMRVGTGGIVGSKGDGIPDRFSVSGSGLNWCLTIKNIQEEDESDYYCGS
Aotus nancymaae V807 iglv JYKP01185735.1 5967 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGGNYVHWYQQLPGKAPTLLIYGSSNRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCEAWDDSLSA
Aotus nancymaae V808 iglv JYKP01185737.1 15861 SVVQAGLTQPSSVSKDLRQTATLTCTGNSNNVGNQGAAWLQQHQGHAPKLLSHRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Aotus nancymaae V809 iglv JYKP01185737.1 10283 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSYVHWYQQVPGNAITTVIYEDKQRPSGVPDRFSGSIDSSSNSASLTISGLEPEDEADYYCQSYDDSSN
Aotus nancymaae V810 iglv JYKP01185742.1 1396 SLSQPVLTQPSFLSGSPGASARLTCTLRSDISVGGKGIFWYQQKSESAPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Aotus nancymaae V811 iglv JYKP01185754.1 1160 SWAQSVLTQSPSVSGNPGQRVTISCSGSSSNIGGNYVNWYQQLPGKAPKLLIYDNSDRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCSVWDDRLK
Aotus nancymaae V812 iglv JYKP01185757.1 1888 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSHYASWYQQTPGQAQRLLIYSTTGRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMSSGI
Aotus nancymaae V819 trav JYKP01190096.1 831 GLRAQSVAQPEDRITVAEGNPLTVKCTYSVSGTPYLFWYVQYPNQGLQFLLKYITGNNLVKGSYGFEAEFNKSQSSFHLKKPSALVSDSALYFCAVR
Aotus nancymaae V826 igkv JYKP01194228.1 17631 NGDIILTQTPASLSASQGETVSISCQASEDVHGEISWIRIKLGQRFEPLISHVTTLAPGVPARYSGRGSGTSYVFSISVLQPGDSGEYYCMHDYGWP
Aotus nancymaae V844 ighv JYKP01204804.1 2109 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYMSWVRQAPGQGLEWMGRIYPGSGNTNYAQKFQGRVTMTRDTSASTAYMELSSLTSEDTAVYYCAR
Aotus nancymaae V845 ighv JYKP01204807.1 7868 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMYWIRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRENAKNTLYLQMNSLRADDTAVYYCAK
Aotus nancymaae V846 ighv JYKP01204814.1 5253 VQCEVQLVESGGGSVQLGGSLRLSCAASGFTLSSYDMHWVRQAPGKGLEWVSALGTSGVAYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKE
Aotus nancymaae V847 ighv JYKP01204815.1 2283 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRQAPGKGLEWVSYIRYDGGSTSYADAVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAT
Aotus nancymaae V848 ighv JYKP01204818.1 11515 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYISWVRQAPGQGLEWMGGINTNTGGTGYAQKFQGRVTITRDTSASTAYMELSSLRPEDTAVYYCA
Aotus nancymaae V849 ighv JYKP01204818.1 8255 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMSWVRQAPGKGLEWMGGIDPENGDTSYAQKFQGRVTMTADTSTNTAYMQLSSLRPEDTAVYYCAR
Aotus nancymaae V850 ighv JYKP01204818.1 1177 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWIRQAPGKRLEWVGQINPNGGSTYLTDSLKGRFTISRDNAKNALYLQMRSLKTEDTAVYYCAR
Aotus nancymaae V860 ighv JYKP01209393.1 2998 AAGGVRGRLGAAWGSLRLSCAASRFTFSDYYVSWVRQAPGKGLEWVSTIPNGGSTYLTDSLKGRFTISRDNAKNALYLQMSSLKTEDTAVYYCAR
Aotus nancymaae V892 trbv JYKP01242551.1 21597 ARSQTIHQWPATLVQPVGSPLSLECTVKGTSNPYLYWYRQSADRGLQLLFYSISVGQIDSEVPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Aotus nancymaae V146 igkv JYKP02042675.1 228436 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYNNKNYLAWYQQKPGQGPKLLISWASSRPAEIPDRFSGSGSGTDFTLTISSLQAEDVGLYYCQQYYSAP
Aotus nancymaae V147 igkv JYKP02042675.1 271459 TRAETALTQSPALVSVTPGDKVTISCKASQDIDNDIYWYQQKPGEAPIFIIQEATTLVSGILPRFSGSGYGTDFTLTINNIEPEDAAYYFCQQDVNFP
Aotus nancymaae V174 iglv JYKP02049756.1 3114 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSHYASWYQQTPGQAQRLLIYSTTGRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMSSGI
Aotus nancymaae V175 iglv JYKP02049757.1 35460 SWAQSVLTQPPSVSGNPGQRVTISCSGSSSNIGGNYVNWYQQLPGKAPKLLIYDNSDRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCSAWDDSLK
Aotus nancymaae V176 iglv JYKP02049766.1 139 SLSQPVLTQPSFLSGSPGASARLTCTLRSDISVGGKGIFWYQQKSESAPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Aotus nancymaae V177 iglv JYKP02049769.1 17131 SVVQAGLTQPSSVSKDLRQTATLTCTGNSNNVGNQGAAWLQQHQGHAPKLLSHRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Aotus nancymaae V178 iglv JYKP02049769.1 22709 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSYVHWYQQVPGNAITTVIYEDKQRPSGVPDRFSGSIDSSSNSASLTISGLEPEDEADYYCQSYDDSSN
Aotus nancymaae V179 iglv JYKP02049769.1 34841 SLSQPCVTQPSFLSGSPGASARLTCTLRSDISVGGKGIFWYQQKSESAPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Aotus nancymaae V180 iglv JYKP02049769.1 39648 SLSQPVLTQPPSTSASLEASVTLTCTLSSGYNNYAVDWYQQRPEKGPRFVMRVGTGGIVGSKGDGIPDRFSVSGSGLNWCLTIKNIQEEDESDYYCGS
Aotus nancymaae V181 iglv JYKP02049769.1 50599 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGGNYVHWYQQLPGKAPTLLIYGSSNRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCEAWDDSLSA
Aotus nancymaae V182 iglv JYKP02049770.1 80989 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKCVYWYQQKSGQAPVLVIYGDSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Aotus nancymaae V183 iglv JYKP02049770.1 88127 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V184 iglv JYKP02049770.1 98089 SWAQSALTQPRSESGSPGQSVTISCTGTSSDVGSYNSVSWYQQHPGTAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Aotus nancymaae V185 iglv JYKP02049770.1 104430 SEASYELTQPPSVSVSPGQTARITCSGDALPNKYASWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V186 iglv JYKP02049772.1 11891 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKYTYWYQQKSGQAPVLVIYDNSDRPSGIPERFSGSNSGNTATMTISGVEAGDEADYYCQVWDSSSDH
Aotus nancymaae V187 iglv JYKP02049772.1 19857 SVVSSAVTQDTAVSVALGQTARITCQGDGIGTYSASWYQQKPGQAPVLVIYGNNKRPSGIPGRFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGTH
Aotus nancymaae V188 iglv JYKP02049772.1 37666 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYYIHWYQQRPGRSPQYIMGVNSDGSHSKGDGIPDRFSGSSSGADRFLTISSLQSEDEAEYHCGE
Aotus nancymaae V189 iglv JYKP02049772.1 64513 SMASYELTQPHSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQAPVLVIYQNNKRPSGIPERFSGSNSGNTATLTISGTQAVDEADYYCQVWDSSSDH
Aotus nancymaae V221 trav JYKP02057900.1 1125 GLRAQSVAQPEDRITVAEGNPLTVKCTYSVSGTPYLFWYVQYPNQGLQFLLKYITGNNLVKGSYGFEAEFNKSQSSFHLKKPSALVSDSALYFCAVR
Aotus nancymaae V222 trav JYKP02057903.1 1348 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVIMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Aotus nancymaae V226 trav JYKP02058101.1 9510 MCLVIGTAGQNIDQPMEVTAMEGAIVQINCTYQTAGFNGLSWYQQRDGKAPTFLSYSVLDGLEERGHFSSFLNRSKGYSYLLVKELQMKDSASYLCAVR
Aotus nancymaae V227 trav JYKP02058101.1 98148 TWSLAKTTQPISMDSYEGQEVNISCRHDNIATSDYIFWYQQFPNQGPRFIIQGYKTNVANEVASLFIPADRKSSTLSLPRVALSDTAMYYCIVG
Aotus nancymaae V228 trav JYKP02058101.1 106469 MSSGEDVERSLFLSVREGDSVVINCTYTDSSSSYLYWYKQEPGASLQLLAYILSNTDTKQDQRLTVQLDKKNKHLSLSIAETQTGDSAIYFCAES
Aotus nancymaae V229 trav JYKP02058101.1 116776 DARAQSVSQPDYHVILSEGASLELRCNYSYSGIVYLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAEFMKSRSSFNLRKPSVQWSDTAEYFCAVS
Aotus nancymaae V230 trav JYKP02058101.1 128191 GINGDSVVQTEGEVLLNEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKAMKGNDKGRSNKDFEAIYRTETTSFHLEKGSVRESDSAMYFCALS
Aotus nancymaae V231 trav JYKP02058102.1 7554 GSGKNQVEQSPQSLVILEGKNCTLQCNYTVTSFNNLRWYKQDTGKGPATLIIMTFSENTKSNGRYTATLDANTKQSSLHITASQLSDSASYICVVS
Aotus nancymaae V232 trav JYKP02058102.1 11166 VNSLHIPEQSPLILTIQEGTHAILNCAYQERTLFNFHWFRQDPGKGLVSLALIQSSQKEQGDKHFKELLGKEKFYSVWNIPASHPGDSATYFCAL
Aotus nancymaae V233 trav JYKP02058102.1 19597 VWSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSVSQYFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLDRASQHVSLLIRDSQLSDSATYLCAV
Aotus nancymaae V234 trav JYKP02058103.1 6518 DARAQSVTQPDIHISISEGASLELRCNYSYGATAYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVS
Aotus nancymaae V235 trav JYKP02058103.1 22685 VNGENVEQRPSTLSVQVGDSSVISCTYSDSASNYFPWYKQELGKGPRLIIEIRSNVDKRKDGRMTVLLNKTAKHFSLHITDTQPGDSALYFCAAG
Aotus nancymaae V236 trav JYKP02058103.1 41886 VWSQQKVEQNSGPLNVPEGVIASLNCTYSDRGSQSFYWYRQYSGKSPELLMSIYSNGDEEDGRFTAQLNRASQHVSLLIRDSQLSDSATYLCAV
Aotus nancymaae V237 trav JYKP02058103.1 46241 GTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVSVYPFWYVRYPNQGLQFLLKYVSGPTLVKGIKGFEAEIKKSESSFHLKKSSAHVSDAAEYFCAVS
Aotus nancymaae V238 trav JYKP02058103.1 60866 VWSQQKDVEQNPGPLSVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLMFISSSDKKDGRFTAQLNKSSQYISLFIRDSQPSDSATYLCAM
Aotus nancymaae V239 trav JYKP02058103.1 69400 GTRAQSVTQLDSQVLVSEGAPVELRCNYSSSFSLSLFWYVQYPNQGLQLLLKYASGPTLVKGINGFEAEFKKSETSFHLRKPAAHISDAAEYLCAVN
Aotus nancymaae V240 trav JYKP02058103.1 80958 GTRAQRVTQPEKTLSVFEGDPVQLKCNYSYSGSPDLFWYVHYPKQRLQLLLRHISRESVKGFTADLNKGETSFHLEKQFAQEEDSAMYYCALS
Aotus nancymaae V241 trav JYKP02058103.1 89053 VNSQQGEEEPQTLSIQEGENATMNCSYKTSITSLQWYRQDSSRGLTQLILIRSNEREKYSGRLRVTLDTFTKSSSLFIAAAQAADTAAYFCATE
Aotus nancymaae V242 trav JYKP02058103.1 94507 RTYGDSVIQTEGPVTLPEGAALTLNCTYQSSYSTFLFWYVQYLNKEPQLLLKSSENQEMDSRGFRASHVKSDSSFHLEKPSVQLSDSAMYYCALR
Aotus nancymaae V243 trdv JYKP02058103.1 97714 SSMAQKVTQAQTEISVVEKEDVTLDCLYETSDTTYYLYWYKQPPTREMIFLIRQNSFNEQNEINGRYSWNFQRSTSSFNFTITASQVIDSAVYFCALSE
Aotus nancymaae V244 trav JYKP02058103.1 128283 LSGEDQVTQSPEALRLQEGDSSSLNCSYSVGNFRGLLWYRQDPGKGPEFLFILYSAGEEKQKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Aotus nancymaae V245 trav JYKP02058103.1 138834 VSSKQEVMQIPAALSVPEGDGLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGYSTLYIAASQPGDSATYLCAV
Aotus nancymaae V246 trav JYKP02058103.1 153969 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVTNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Aotus nancymaae V247 trdv JYKP02058103.1 172619 SSVAQKVTQAQLPISMPVGKAVTLNCLYETRQEFYYIFWYKQLPSRRIVFLIRQYSAERNVKRDRYSVNFRKARKSIDFTISALQLGDSATYLCALWE
Aotus nancymaae V248 trav JYKP02058103.1 181027 VSSILNVEQSPQSLRVQEGDSTNFTCSFPSSSFYALHWYRWETAKSPENLFVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGTQPEDSATYLCAI
Aotus nancymaae V249 trav JYKP02058103.1 188351 VNGQQIMQIPHFQHVQEGADFTIYCNFSTTLNNIQWYKQRPGGHPIFLIKLVKSGEVMKQKRLTFQFGEARKNSSLHITATQTTDAGTYFCA
Aotus nancymaae V250 trav JYKP02058103.1 199107 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQVHSQGPQYVIHGLKNNETNEMASLIIAEDRKSSTLILPHATLRDAAVYYCIVRV
Aotus nancymaae V251 trav JYKP02058103.1 205507 GTRAQSVTQLDGHITVSEGAPLMLRCNYSYSGTPYLFWYVQYPSQSLQLLLKDLTGATQVKGIKGFEAELSKSETSFHLRKPSAHVSDTAVYFCAVS
Aotus nancymaae V252 trav JYKP02058105.1 37973 IMGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIHWYRQLPSKGPEYVIHGLTSNVNNRMASLIIAEDKKSSTLILHRATLGDAAVYYCILR
Aotus nancymaae V253 trav JYKP02058105.1 42863 ISSQELEQSPQSLIIQEGKNLTINCRSSKTLYALHWYKQKYGEGLIFLMMLQKGGEEKNHEKITAKLDEKKQQSSLYITASQPSHTGIYLCGAD
Aotus nancymaae V254 trav JYKP02058105.1 53647 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFSTLLWYKQDTGEGPVLMITLYKGGELIRNGRLTAQFGITRKDSFLNISASVPGDVGTYFCAG
Aotus nancymaae V255 trav JYKP02058105.1 85450 SSMAQTVTQSQPEMSVQVAETVTLNCTYDTSDSNYYLFWYKQPPSRQMILIIRQEAFKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTATYFCAFM
Aotus nancymaae V256 trav JYKP02058106.1 8298 FSIAQRVTQSESEMSVQVAETVTLNCTYDTSDSNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLRISDAQLGDTAMYFCAYR
Aotus nancymaae V257 trav JYKP02058106.1 28205 LRGELKVGQSPLFLSTQEGKNCTIYCNYSTTVSDRLHWYRQDPGKRLESLFVLLSNGAVIQKGQLTASLDTKARLSTLHITAPVHGLSATYFCAV
Aotus nancymaae V258 trav JYKP02058106.1 39232 GTNSNSVKQTDQVTISEAASVTMNCTYTSTGYPTLFWYVRYPNKPLQFLWEETTENSKNFGARNIKDKNSRIVKHSVQVSDSAMYYCLLRDTVLR
Aotus nancymaae V259 trdv JYKP02058108.1 28697 VSLDIILESDTKALTVLAGEAASFRCSVTGGDLKNHQVSWYKKSEDNSLILVFKLSNSSNYNLGNNFMGKTEALKNQFMLDIQKATTKDVGTYYCASD
Aotus nancymaae V260 trdv JYKP02058108.1 50271 VMSAIQLVPEHQTVTVSLGDPATLRCSMKGEAITNYYINWYRKTQGNTMTFIYREKDIYGPGFKDGFQGEIDVEKDQAVLEILAASERDEGSYYCASD
Aotus nancymaae V316 ighv JYKP02072367.1 2754 AAGGVWGRFGTALVGGSLKLSCAASGFTFSSYSIGWVHQAPEKGLEWVSTIGTDGSTYYADSIKGQFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V317 ighv JYKP02072368.1 14714 VQCEVQLVESGGGLLQSGGSMRLSCVASGFTFSSYGMDWVRQAPGKGLEWVSYISSSGGTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEGTTVYYCA
Aotus nancymaae V339 trbv JYKP02076334.1 10155 ARSQTIHQWPATLVQPVGSPLSLECTVKGTSNPYLYWYRQSADRGLQLLFYSISVGQIDSEVPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Aotus nancymaae V367 trav JYKP02081073.1 8314 VSAAKNEVQQSPQDLTVQEGEFITINCSYSVGISTLQWLQQHPGGGIVSLFTLSSEKKKNGRLIATINLQEKHSSLHITASQPRDSAIYICAV
Aotus nancymaae V429 ighv JYKP02099938.1 6757 VHSQVQLVQFGAEMKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQVLEWMGWINTNTGGTSYAQKFQGIVTMTRNTSTSTAYMELSSLRSGDMAVYYCMR
Aotus nancymaae V442 ighv JYKP02103864.1 1525 VLSQVTLKESGPAQVKPTQTLTLTCTFSGFSLSTSGIGVSWIRQPPGKALEWLAAIYWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTHMDPVDTATYYCARS
Aotus nancymaae V443 ighv JYKP02103865.1 355 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFNNYWMTWVRQAPGKGLEWVGVINPDGGRTNYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTAVYYCTR
Aotus nancymaae V444 ighv JYKP02103865.1 6453 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSFGMDWVRQAPGKGLEWVSAIGTGGSTYYADSVKGRFTISRDNAKNTLFLQMNSLRAEDTAVYYCAKE
Aotus nancymaae V445 ighv JYKP02103866.1 2173 VLSQVQLQQRGPGLVKPSETLSLTCAVYGYSISSGDGWNWIRQPPGKRLEWIGRIYRGGSTYYNPSLKSRVTISADTSKNQFSMRLSSVTAADTAVYYCA
Aotus nancymaae V446 ighv JYKP02103866.1 8256 VQCEVQLVESGGGLAKPGGSLRLSCVASGFTFSSYGMDWVRQAPGKGLEWVSAIGTDGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V447 ighv JYKP02103868.1 5348 AHSQVQLVQSGPELKQPGASVRVSCKASGYTFSSYGINWVRQGPGQGLEWMGWINTYTGKPTYAQGFTGRFVFSMDTSVSTAYLQISNLKAEDTAVYYCAR
Aotus nancymaae V454 ighv JYKP02105926.1 1135 VHSQVQLVQSGAEMKNPGASVKVSCKASGYTFTSYFMYWVRQAPGQGLEWMGWINTNTGGTGYAQKFQGRVTITRDTSASTAYMELSSLRPEDTAVYYCT
Aotus nancymaae V484 ighv JYKP02001031.1 34304 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMYWIRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRENAKNTLYLQMNSLRADDTAVYYCAK
Aotus nancymaae V485 ighv JYKP02001031.1 26720 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNALYLQMSSLKTEDTAVYYCAR
Aotus nancymaae V486 ighv JYKP02001031.1 11157 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSYISYDGGSTSYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAK
Aotus nancymaae V487 ighv JYKP02001031.1 2109 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYMSWVRQAPGQGLEWMGRIYPGSGNTNYAQKFQGRVTMTRDTSASTAYMELSSLTSEDTAVYYCAR
Aotus nancymaae V488 ighv JYKP02001038.1 5253 VQCEVQLVESGGGSVQLGGSLRLSCAASGFTLSSYDMHWVRQAPGKGLEWVSALGTSGVAYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKE
Aotus nancymaae V489 ighv JYKP02001039.1 2279 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRQAPGKGLEWVSYIRYDGGSTSYADAVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAT
Aotus nancymaae V490 ighv JYKP02001041.1 11561 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYISWVRQAPGQGLEWMGWINTNTGGTGYAQKFQGRVTITRDTSASTAYMELSSLRPEDTAVYYCA
Aotus nancymaae V491 ighv JYKP02001041.1 8301 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMSWVRQAPGKGLEWMGGIDPENGDTSYAQKFQGRVTMTADTSTNTAYMQLSSLRPEDTAVYYCAR
Aotus nancymaae V492 ighv JYKP02001041.1 1223 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWIRQAPGKRLEWVGQINPNGGSTYLTDSLKGRFTISRDNAKNALYLQMRSLKTEDTAVYYCAR
Aotus nancymaae V564 trbv JYKP02026376.1 1374 HGDAEITQSPRHKVTETGRQVTLNCHQTWNHEYMYWYQQDLGHGLRLIHYSIAVDNTEKGEVFDGYVVSRSKLEDFSLTLESATHSQTSVYFCASSN
Aotus nancymaae V568 ighv JYKP02028287.1 3001 AAGGVRGRLGAAWGSLRLSCAASRFTFSDYYVSWVRQAPGKGLEWVGQINPNGGSTYLTDSLKGRFTISRDNAKNALYLQMSSLKTEDTAVYYCAR
Aotus nancymaae V580 trav JYKP02030468.1 33270 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Aotus nancymaae V612 ighv JYKP02038603.1 1035 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGNYWMYWIRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Aotus nancymaae V632 igkv JYKP02042675.1 568245 SSGDVVMTQTPLSLSITPREPVSISCRSSQSLVHSNGNTYSSWFLQKPGQSPRLLIYEASTWESGVPDRFSGSGTGTDYFTLKISRMEAEDVGVYYCMQG
Aotus nancymaae V633 igkv JYKP02042675.1 558161 SSGDIVMTQTPLSLPITPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIEFP
Aotus nancymaae V634 igkv JYKP02042675.1 548598 TRCDVQMTQSPSSLSASVGDRVTITCHASQSISNWLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYDSSP
Aotus nancymaae V635 igkv JYKP02042675.1 522509 SSGDIVMTQTPLFLPVTPGEPASISCRSSQSLLHSNGNTYLSWFLQKPDQSPRRLIYKVSTRGPGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQS
Aotus nancymaae V636 igkv JYKP02042675.1 503082 SRGEIVLTQSPAFLSVTPREKVTITCRASQGVSNSLHWYQQKPDQAPKFLVKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSYNW
Aotus nancymaae V637 igkv JYKP02042675.1 473622 TTGQIVMTQSPATLSLSPGERASLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPDDFAVYYCQQRSSWP
Aotus nancymaae V638 igkv JYKP02042675.1 455406 IRCDIQMTQSPFFLSASIGDTVTISCQASKAISNDLAWYQQKLGKSPTLLIYEATNLYTRVPSRFSGSGSGTDYCLTISNLELEDFATYYCKQELSYP
Aotus nancymaae V639 igkv JYKP02042675.1 428326 SSGDIVMTQTPLSLPITLGEAASISCRSSQSLLHSNGNTYLNWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGAYYCMQALQHP
Aotus nancymaae V640 igkv JYKP02042675.1 414258 TRCDIQMTQSPLSLSASVGDRVTITCQASQGITNDLAWYQQKPGNASKLLIYEASSLQSEVPSRFSGSGSGRDFTLTISSLQPEDFVTYYCQ
Aotus nancymaae V641 igkv JYKP02042675.1 388383 SSGDIVMTQTPLSLPVTAGETASISCRSSQSLLYSDGNTYLNWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQALQHP
Aotus nancymaae V642 igkv JYKP02042675.1 368046 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISKYLAWYQQKPGKAPKPLIYYASSLQSGVPSRFSGSGSGADYTLTISSLQPEDFATYYCQQYNSFP
Aotus nancymaae V643 igkv JYKP02042675.1 339426 STGQIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQVPRLLIYGASNRAAGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNWS
Aotus nancymaae V644 igkv JYKP02042675.1 319398 SSGNIVMTQSSLSLPVTPGEPASISCRSSQSLLHSNGNTYLWWHLQKPGQSPQPLIYEVSNRFSGVPDRFSGSGSETDFTLKISRAEAEDVGVYYCMQS
Aotus nancymaae V645 igkv JYKP02042675.1 305731 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISKWLAWYQQKPGTVPKLLIYDASKLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Aotus nancymaae V646 igkv JYKP02042675.1 292815 TTGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNWP
Aotus nancymaae V647 igkv JYKP02042676.1 100559 ARCDIQMTQSPTFLSASVGDRVTITCQASQSIGSALAWHQQKPGKATRSLIYGTSSLQPGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
Aotus nancymaae V648 igkv JYKP02042676.1 82163 SSGDVVMTQTPLSLPTTPGEPASISCRSSQSLLHSNGNTYLSWFLQKPGQSPRLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Aotus nancymaae V649 igkv JYKP02042676.1 67518 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMSYLQAP
Aotus nancymaae V650 igkv JYKP02042676.1 49582 ARCDIQMTQTPSSLPASVGDKVTITCRASQGISSWLAWYQQKPGKAPKLLIHKASNLETGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYNYIP
Aotus nancymaae V682 igkv JYKP02050714.1 50545 NGDIILTQTPASLSASQGETVSISCQASEDVHGEISWIRIKLGQRFEPLISHVTTLAPGVPARYSGRGSGTSYVFSISVLQPGDSGEYYCMHDYGWP
Aotus nancymaae V714 trdv JYKP02058109.1 26455 RGMLCDDVIQSSPDQTVASGSEVVLLCTYNVRYSNPDLFWYRIRPDHSFQFLLYEDGAGYQAAGFAQGRFSGRYIPTKKTFDLVISPVRTEDSATYYCAF
Aotus nancymaae V725 ighv JYKP02059758.1 2184 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPGRGLEWLGRTYYRSKWYYDYAASLPSQITINPDTSKNQFSLQLNSVTLEDTAVYYCAR
Aotus nancymaae V726 ighv JYKP02059764.1 36538 VQCEVQLVESVGGLVQPGGSLRLSCVASGFTFSNYWMNWVRQAPGKGLEWVSYIRYDAGSTYYADAVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAT
Aotus nancymaae V727 ighv JYKP02059764.1 30895 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVGVIRNKANSYTTEYAASVKGRFTISRDDSKNALYLQMSSLKTEDTAVYYCAR
Aotus nancymaae V728 ighv JYKP02059764.1 20204 VHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMSWVRQAPGKGLEWMGRIDPENGDTSYAQKFQGRVTMTADTSTNTAYMELSSLRPEDTAVYYCT
Aotus nancymaae V729 ighv JYKP02059764.1 14519 VQCEVQLVESGGGLAKPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLEWVSAISTDGSGTSYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Aotus nancymaae V730 ighv JYKP02059764.1 7549 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVGVIRNKANSYTTEYAASVKGRFTISRDDSKNALYLQMSSLKTEDTAVYYCAR
Aotus nancymaae V731 ighv JYKP02059767.1 10754 VHSQVQLVQSGAEVKKPGASVKVSCKASGFTFSSYAISWVRQAPGQGLEWMGVIIPILGRTGYAQKFQGRVTMTADTSASTAYMELSSLRPEDTAVYYCAR
Aotus nancymaae V732 ighv JYKP02059768.1 15896 VLSQVQLQQRGPGLVKPSETLSLTCAVYGYSISSGDGWNWIRQPPGKRLEWIGRIYRGGSTYYNPSLKSRVTISADTSKNQFSMRLSSVTAADTAVYYCA
Aotus nancymaae V733 ighv JYKP02059768.1 9813 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAVIWYDGSTSYADAVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAK
Aotus nancymaae V810 trbv JYKP02076335.1 47248 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSNNVDLVDKGDVPKGYNVSRKEKRNFPLILESPSPNQTSLYLCASSL
Aotus nancymaae V811 trbv JYKP02076335.1 42309 LVEVKVTQNTRYLVKRMGEKVFLECAQDMDHERMFWYRQDPGLGLRLIYFSYDITNDEKGDVPDGYSVSREKKEQFSLILGSASTNQTSVYLCASSL
Aotus nancymaae V812 trbv JYKP02076335.1 22555 SVFGAVVTQKPSRGICQRGTSMTIECEVDSQVNLMSWYRQLPGQSITLIATANQGFEATYEKGFAKDKFPISNPNPTFSTLNVSNVSPEDSSIYFCSAE
Aotus nancymaae V813 trbv JYKP02076338.1 108634 ARTRCPESHLFQTPRHKVTEMGQEVIMRCQPILGHNTVFWYRQTVMQGLELLTYFRNQPSLDDSGMPEDRLSAEMPTASLSSLKIQPSEPRDSAVYLCASGL
Aotus nancymaae V814 trbv JYKP02076338.1 96958 HGDAMVIQNPRYQVIQLGKPVTLSCSQDLNHDVMYWYQQKPSQPPKLLLYYYDKDLNNEADTPDNFQARRPNTSFCFLDIRSSGLGDAATYLCASSR
Aotus nancymaae V815 trbv JYKP02076338.1 91562 SPGEEVIQTQRHLVKGKGQKAILYCVPITGHGSVFWYQQVLKKELKFLISFQNENVFDETGIPKKRFSACPQNSSRSLEIQATEPQDSAVYFCASSQ
Aotus nancymaae V816 trbv JYKP02076338.1 74452 LSNAGVTQNPRHLVRRRGQEARLRCSPVEGHNHVYWYQQLLGEGPKFMIYLQKESIIDESGMPKERFSAEFPREGPSVLRIQQAERGDSAAYFCASSI
Aotus nancymaae V817 trbv JYKP02076338.1 71552 IVDGGITQSPKYLFRKEGQAVTLGCEQNLNHDAMYWYRQDPGQGLRLIYYSRIVDDFQEGDIAEGHSVSREKKESFPLTLTSAQWNQTAFYLCASSI
Aotus nancymaae V818 trbv JYKP02076338.1 69001 GSGLGDVVSQQPSRVICKTGTSVKIECRALDFQATTMFWYHQSQKQGLMLMATSNEGSKATYEQGFSEDNFPISHPNPTFSSLTVASARPEDSSFYLCSGR
Aotus nancymaae V819 trbv JYKP02076338.1 59949 SLDTKVTQRPRYVVTVKEQKAKIDCVPIKGHSYVYWYRKKLEEELKFLVYLQNEEIIQKSEVINERFSAQCPKNSPCALEIQSTESGDAGLYFCASSK
Aotus nancymaae V820 trbv JYKP02076338.1 49625 SFHAKVIQTPGYLVKRKGQKTEMDCTPEKGHTFVYWYQQNQNKELMFLISFQNEQILEETEMYKKRFLSQCPRNSPCSLAILSSDPGDRALYLCASSQ
Aotus nancymaae V821 trbv JYKP02076338.1 38831 SMDAGVTQTPRNRITKIGKKIMLECSQTRDDYQMYWYRQDPGLGLRLIYYSLGVRDINKGEISDGYSVSRQEQPKFSLSLESATPNHTALYFCATSY
Aotus nancymaae V822 trbv JYKP02076339.1 8226 LTEAGVAQSPRYKITEKRQAVGFWCNPVSGHAGLYWYQQTPGQGPKLLIQYQNEDVVDDSQLPKDRFSAERLKGVESTLKIQPAELGDSAVYLCASSL
Aotus nancymaae V823 trbv JYKP02076339.1 3928 HTDAGVIQSPQHEVTEMGQEVTLRCEPISGHTQLFWYRQTMMRGLELLIYFNNKALIDDSGMPKDRFLAQMPNALFSTLKIQPSEPGDSAVYFCASSL
Aotus nancymaae V824 trbv JYKP02076340.1 15775 HAGAGVSQDPRHKVTKTGQNVTFGCDPISGHNRLYWYRQTLGQSPEFLTYFQNEAQLDKSGLPSDRFFAERTGGSFSTLKIQRTKQGDSAMYLCASSL
Aotus nancymaae V825 trbv JYKP02076340.1 9221 SVAAGVIQHPRHLIQEKRKTATLICHPIPGHDTVYWYQQGPGQGLQFLISYYEKMQRDKGSIPDRFAAQQFSDYHSELNMSSLELGDSALYLCASSL
Aotus nancymaae V826 trbv JYKP02076340.1 894 HMDGRIIQSPTHKVTETGTPVTLICHQTENHRYMYWYRQDLGHGLRLIHYSYGVKDISKGEVPDGYSVSRSNTEDFPLTLESATGSQTSVYFCASSD
Aotus nancymaae V827 trbv JYKP02076341.1 47835 LTEAGVSQSPRYKITEKRQAVGFWCNPVSGHAGLYWYQQIPGQGPKLLIQYQNEAVVDDSQLPKDRFSAERLKGVESTLKIQPAELGDSAMYLCASSL
Aotus nancymaae V828 trbv JYKP02076341.1 34482 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHYYMYWYRQDPGMGLRLIHYSVDKGTTDKGEVPEGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSD
Aotus nancymaae V829 trbv JYKP02076341.1 28564 HTGAGVSQSPRYKVTKRGQDIAFRCDPISGHVMLYWYRQTLEQSPEFLTYFQYEVQQDKSGLPSDQFSAERAEGSFSTLKIQRTEQRDSAMYLCASSS
Aotus nancymaae V830 trbv JYKP02076341.1 20447 PVEAGVTQRPTHLIKTRGQQVTLRCSPISGHNSVSWYQQALGQGPQFILGYFEEEERNRGNFPNRFSGHQFGNYSSELNVSALELGDSALYLCASSL
Aotus nancymaae V831 trbv JYKP02076341.1 17037 HTGAGVSQSPRYKVTKRGQDISFKCDPISGHEMLYWYRQTLEQSPEFLTYFQYEVQQDKSGLPSDQFSAERAEGSFSTLKIQRTEQRDSAMYLCASSS
Aotus nancymaae V832 trbv JYKP02076341.1 8926 PVEAGVTQRPTHLIKTRGQQVTLRCSPISGHNSVSWYQQALGQGPQFILGYFEEEERNRGNFPNRFSGHQFRNYSSELNVSALVLGDSALYLCASL
Aotus nancymaae V833 trbv JYKP02076343.1 34180 PVQAEVTQSPTHLIQTRGQQVTLSCSPISGHNSVSWYQQAPGQGPQFIFEYVNELKRSEGNFPGRFSGYQFSDYHSEMNISTLELGDSALYLCASSL
Aotus nancymaae V834 trbv JYKP02076343.1 31469 PVDSGVTQTPKHLLTAIGQRVALRCSPRSGDLSVYWYQQSLDQSLQFLIQYYNGNEREKGNIPERFSGQQFPNMSSELNLSSLELGDSALYFCASSV
Aotus nancymaae V835 trbv JYKP02076343.1 27364 NGDAEITQSPRYKVTETGRQVTLKCHQTWNHKYMYWYRQDLGHGLRLIYYSYGVPDVNKGEVPDGYVVSRSNPEDFPLTLESALSSQTSVYFCASSD
Aotus nancymaae V836 trbv JYKP02076343.1 15402 QTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLKLLSYFRSRTLVDDSEMPQDRFSAEMPNASFSTLRIQPTEPRDSALYLCA
Aotus nancymaae V837 trbv JYKP02076344.1 9860 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHNRVYWYQQAPGQDPQFLFQYYNEIQNDKGNFPARFSGRQFSNYSSEMNVSALELGDSALYLCASSL
Aotus nancymaae V838 trbv JYKP02076344.1 1779 PHTQDTFMPVSYTHLDVYKRQTLQCAQDMNHDGMYWYRQDPGMGLRLIHYSVAEGTTAKGEVSDGYNVSRSNTEDFPLRLEAAAPSQTSVYFCASSD
Aotus nancymaae V839 trbv JYKP02076345.1 41013 PMDTGITQTPKYPVTAKGSKRTLKCEQHLGRDSMYWYRQKAEKSLEFMFYCNYKAFIEIQTVPNHFTPEWPDSSCLYLHVVTVQLEDSAVYLCTSSQ
Aotus nancymaae V840 trbv JYKP02076345.1 39519 HTEPEVIQTPSHQVTRMGQEVILRCVPIPNHLNFFWYRQILGKKFEFLVYFYNDNISDKSEIFDDRFSVKRPDGSNFTLKIQSTKPEDSAMYFCASSQ
Aotus nancymaae V841 trbv JYKP02076345.1 31147 PSDSAVSQTPKYLVTQIGKEESLKCEQNLGHNAMYWYKQDSKKLLKIMFSYNNKALILNETVPNRFSPESPDKARLNLHIESLELGDSAVYFCASSQ
Aotus nancymaae V842 trbv JYKP02076345.1 27150 SMDTGVTQTPKHLVMGMTNEKSLECEQHLGHNAMYWYKQKAKRPPELMFVYNYKEIYVNESVPIRFSPECPDSSHLHLHLHALQPEDSALYLCASSQ
Aotus nancymaae V843 trbv JYKP02076345.1 17805 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHNSVYWYQQAPGQDPQFLFEYYNEIERQKGNFPARFSGRQFSNYSSEMDVSGLELGDSALYLCASNL
Aotus nancymaae V914 trbv JYKP02100115.1 834 PMDTGVTQTPKHLVTGMTNEKSLECEQHLGHNAMYWYKQKAKRPPELMFVYNYKEISVNESVPIRFSPECPDSSHLHLHLHALQPEDSALYLCTSSQ
Aotus nancymaae V942 trgv JYKP02111452.1 23804 GDNKMRISQDQLSSTRRVDRTVHVGCKLSGLPLENTAVHWYQQKEGEPLRRILYDSAKNYKQDRPNPRLEADIDDNIFYLIINNVAKLDEATYYCACWD
Aotus nancymaae V943 trgv JYKP02111453.1 1693 HLEQPQISSTKTLSKTARLECVVYGAKISETSIYWYRERPGEAIQLLVYISSDGAVRMESGITSGKFEVDRVPETSTSTLTIHNVEKKDIATYYCAFWE
Aotus nancymaae V944 trgv JYKP02111455.1 5287 SEISSNLEGRMRTVTGTTGSSAVITCDLPGENTRYIHWYLHQEGKAPQRLLYCDTYNSRVMLDSGISPGKMDSYAIMRRSWKLIVQNITENDSGVYYCATWD
Aotus nancymaae V945 trgv JYKP02111455.1 1039 SQISSKLEGRTKSVTGRTGSSAAITCDLPVENTRYIHWYLHQERKAPQRLLYYDTYQIKVVLDSGISPGKYDIYAITRRSWKLVLQNLIEDDSGVYYCATWD
Aotus nancymaae V946 trav JYKP02111497.1 2449 GSGKNQVEQSPQSLVILEGKNCTFQCNYTVTSFNNLRWYKQDTGKGPATLIIMTFSENTKSNGRYTATLDANTKQSSLHITASQLSDSASYICVVS