WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Maylandia zebra AGTA00000000.2 (AGTA02) 303 136 4 36 27 88 7 5
Maylandia zebra AGTA00000000.3 (AGTA03) 304 94 14 45 49 79 6 17
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Maylandia zebra Vs41 trbv AGTA02003743.1 1111 FSFSVKIKQDPFLNSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELKTYSLGEKVWDTEAPFDKSKYSMSRPSLLRSSLQIHSVAAGDSAVYYCVSRR
Maylandia zebra Vs40 trbv AGTA02003742.1 1591 QASAVIFQQSPPQIVDKNQEIQINCKHDDSTRILMLWYQQRKENASMTLIGSGYYQQSQSFEGQFEKQFTLTRNSAVEGTLTIKNTDVSHSAVYFCAA
Maylandia zebra Vs43 trbv AGTA02003746.1 850 LTGGSDVSQTPLLWSTEGQSVTMNCSHTKGVAYRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEEKFPATKTNEQTGSLTVEKLVPGDSGVYFCSVS
Maylandia zebra Vs42 trbv AGTA02003745.1 196 LTDGSDVSQTPLLWKSEGQSATMTCNHTKNHDYSQMYWYQQLPGQKIKQIVFTAPKTQHTYESGFSEEKFPATKSSYETGSLTVEKLVPGDSGVYFCAVS
Maylandia zebra Vs45 trbv AGTA02003746.1 3069 VPKSGVHQTPAALIKAPGEEIQINCNHSNTKLDMIQWYKQSPGKNEMILLGYAQFTFTAVEDAFENIYKVTGEGSKLSTFHIPKLRESVDSAMYFCAASA
Maylandia zebra Vs44 trbv AGTA02003746.1 2347 PSLCTRVQQVPSSILGSIHGETRISCNHSESTYNVILWYQKPRGDSALKLIGYILYGNPTIEDGFQESFKISGDGSVKSQLEVEKLKAEDSGSYYCAAS
Maylandia zebra Vs47 trbv AGTA02003746.1 5802 SSSSDKVDQTPTNIHTKGEEAKIYCSHSIQSYNTILWYKQSEETLQLLGHLRFGTGTPETGVNVTIDGGAEKEENCTLTIKDLNVSSSGVYFCAAS
Maylandia zebra Vs46 trbv AGTA02003746.1 4650 SSFSDKVDQTPANIYTKGEDAKIYCSHSITNYNRILWYKQSKTQLQLLGFLFLGKGTIEPGVNVTMDGGANEKENCTLTIKDIELSSSGVYFCAAS
Maylandia zebra Vs49 trbv AGTA02003747.1 673 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYDTILWYKQSEETLQLLGYLRFGTGYPEPGVNVTIDGGANVKENCTLTITDLKVSSSGVYFCAAS
Maylandia zebra Vs48 trbv AGTA02003746.1 7123 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYEIILWYKQSEETLQLLGYLRFGTGYPEPGVNVTIDGGANVKENCTLTITDLKVSSSGVYFCAAS
Maylandia zebra Vs350 ighv AGTA02027382.1 3427 VKCEQLTQPASLTVRPGQRLTITCQVSYSVSSYWTHWIRQPAGKGLEWIGEERVGYTTYYKDSLKNKFSISTDSFSNTVTLTGQNVQPEDTAVYYCARE
Maylandia zebra Vs351 ighv AGTA02027382.1 1826 VWSEVKLEQSPSEVKGFGERVKMSCALSGYTLTENDIHWIRQRPGRALEWIGYMSTGYNSPSYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYFCARQ
Maylandia zebra Vs356 ighv AGTA02027384.1 1490 VKCEQLTQPASETVQPGQRLTITCQVSYSVSSWHTAWIRQPAGKGLEWIGMARTGSTTYYKDSLKSKFSISTYSSDNRVTLSGQNMQPEDTAVYYCARL
Maylandia zebra Vs211 trav AGTA02061012.1 7476 YKLEVFVPSEVAVSQGGDAILPCRSVTAGQSVKSARWRRNGEVLLELNGRTGEITYGDDFNRSRVSIPSDWDRRADLSVTIKGAQQQDGGVYYCDIEKAE
Maylandia zebra Vs354 ighv AGTA02027384.1 10825 VWSEIKLEQSASEVKRPGERVKMLCTLSGYSLTSYNIFWIRQRPGRALEWIGYMSTGNNSPGYVSSFQSRFIITEEDSSSRQYLEITSLTAEDSAVYFCARE
Maylandia zebra Vs355 ighv AGTA02027384.1 5491 VNGQTLTESEPVTKRPGESHRLTCTVSGFTLGSYAMAWVRQAPGRALEWIAYIGTSSSPIRYSQSVQGRFIISRDDSSSKIYLQMNSLKTEDTAVYYCARR
Maylandia zebra Vs482 ighv AGTA02058608.1 544 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYEMVWVRQARGKALEWIAHLTKPTGSTKYYSQSVRGRFTISRDNDKQQVYLEMNSLQTEDSSVYYCARR
Maylandia zebra Vs359 ighv AGTA02027388.1 1305 VFGQTLTESEPAVKQPGESHRLTCTASGFTFSSYWMAWVRQAPGKGLEWVSTVRNDGGNSYYAQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs515 ighv AGTA02058637.1 3110 TDGQTLTESESVVKRPGDSHRLTCTYSGFSSDIHAAWIRQAAGKGLEWIAFIWDDSSGSYYTESVRGRFTISRDNSRKQVYLQMNSLTPEDSAVYYCARE
Maylandia zebra Vs488 ighv AGTA02058610.1 758 TEGQTLTESEPVVKSPGDSHRLTCTYSGFSYDIAAAWIRQAAGKGLEWISWIESGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Maylandia zebra Vs473 ighv AGTA02058605.1 5176 VDGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIATEALGSGKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs489 ighv AGTA02058613.1 4250 VKCEQLTHPASVTVHPGDRLTITCQTSYSLSSARTFWIRQPAGKELECIGSVHVGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Maylandia zebra Vs189 trbv AGTA02055784.1 1157 VSLSDQVHQTPADMCKNPNETATLRCLHTISTYNRILWYKQSQGGQLQLLGYMWGSRPTLEANVSATLDGSADENKNCTLTIEKLQQDSNAVYFCAAS
Maylandia zebra Vs7 trbv AGTA02003724.1 5677 DGSDVTQNSTIWKKQDEDATINCKHTKNENYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTIKNLEPTDKGLYFCAVS
Maylandia zebra Vs8 trbv AGTA02003724.1 7669 RTYGSYINQASMLWKNQGEDATLNCSHVMTIEFYQMYWYRQLPGEPMKQMVYTIPNAEPDFEPDFRDEKFSVTKPDAHSGTLTVKNLVPGDQGLYFCAVS
Maylandia zebra Vs9 trbv AGTA02003725.1 854 DGSDVTQNSMIWKKQDEYATINCNHTKDYTYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTVKDLEPKDKGLYFCAVS
Maylandia zebra Vs185 igkv AGTA02055057.1 1334 SSGQIIVTQSPGAQSVVAGQSVSITCRTSTSVGDWLHWYLQKPGKAPKLLIYKATNRQSGVSDRFSGSGSGTDFTLSIRGVQAEDSGVYYCQQGSNL
Maylandia zebra Vs214 trdv AGTA02061280.1 4299 LTAGDSITPQRDKVTATEGESVTLTCKYQTSESDVWLNWYRHDSDLQAPQFILYKGARSQSGNDYIPDNRYDSETSSTSTNLSIAALTLADTALYYCALQ
Maylandia zebra Vs471 ighv AGTA02058605.1 11231 VDGQTLRESEPVIKRPGESHRLTCTASGFTFSSYRMVWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFIISRDDSSSKLFLQMNSLKTEDTAVYHCARC
Maylandia zebra Vs483 ighv AGTA02058609.1 6287 IKCQTLTQSEPVVKSPGESHRLTCTYSGFSGHSATVWIRQAAGKGLEWIAFIWGESSGSFYSQSVQGRFTISRDNSRQQVYLEMNSLTVEDSAVYYCARQ
Maylandia zebra Vs180 trav AGTA02051938.1 3548 AAQLSDVSQPESLKTVKIGDSATIKCFIKSASKKTVWYKVTTGRKLQLVVKTNSQYNVREFSDEFVNRSSVKFDMTNNHLTINKTSWEDVGTYFCGV
Maylandia zebra Vs455 ighv AGTA02058592.1 2916 VKCEQLTQPASLTVQPGQPLTITCHFSYSVSSYWAHMVRQPAGKGLEWIGEARAGQTTHYKDSLRNKFSISTDSSSNTVTLTGQNVQIEDTAVYYCARE
Maylandia zebra Vs352 ighv AGTA02027383.1 7240 VKCEQLTQPASLTVRPGQRLTITCHFSYSVSSYWTHWVRQPAGKGLEWIGEARAGYTTYYKDSLKNKFSISTDSSSNTVTLTGQNVQPEDTAVYYCARE
Maylandia zebra Vs243 ighv AGTA02069247.1 3251 VNCEQLTQSASVILQPGQRLTITCQVSYSLGSWTAWIRQPAGKGLEWIGMKYTGSSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE
Maylandia zebra Vs451 ighv AGTA02058589.1 8721 VRSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIQQRPGRALEWIGWMNTGRNSASYGNSFQSRFIMTEEDSSSRQYLEIKSLTAEDSAVYFCAR
Maylandia zebra Vs450 ighv AGTA02058587.1 3590 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYGMVWIRQAPGKGLEWIAYISSGSGSIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARR
Maylandia zebra Vs453 ighv AGTA02058590.1 1361 VDGQTLTESDPAVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKGLEWIARISSSGGSTWYSQSVQGRFIISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs353 ighv AGTA02027383.1 1143 VKCEQLTQPASETVQPGHRLTITCQVSYLLSTYWTAWIRQPAGKGLEWIGSECDGCTSQYKDSLKTKFSISKDSSSKTVTLTGQNLQPEDTAVYYCARD
Maylandia zebra Vs514 ighv AGTA02058637.1 4540 TEGQTLTESESVIKRPGDSHRLTCTYSGFGGDIHAAWIRQAAGKGLEWVAWIQSDSSNIYYSQLVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs477 ighv AGTA02058608.1 20626 TEGQTLTQSEPVIKQPGDSHRLTCTYSGFGGDIYAHWIRQTAGKGLEWIAWIRYDGGSTYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSSVYYCARE
Maylandia zebra Vs516 ighv AGTA02058637.1 435 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQKSGESLEWMGEGYTDSSKNKYVSSLRGRIEITKDNSNSMVHLRLSNLKPEDSAVYYCAK
Maylandia zebra Vs517 ighv AGTA02058638.1 1982 TEAQTLTESESVIKRPGESHRLTCTYSGFGWDIHAVWVRQAAGKGLEWVAWIQSDSSNIYYSQSFRGRFTISRDNSRKQLYLQMNSLTTEDSAVYYCAKE
Maylandia zebra Vs459 ighv AGTA02058594.1 7215 VDGQTLTESEPVTKRPGESHRLTCAASGFTFSSYPMVWVRQAPGKGLEWVAYIGTLGYPTYYSLSVQGRFIISRTYLRMNSLKTEDTAVYYCARE
Maylandia zebra Vs458 ighv AGTA02058594.1 9104 VDGQTLTESESVFTRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGLEWTAFIHTSSNSYATSYSQSVQGRFTISRDDSSSKLYLQMNSLNTQDTAVYYCARG
Maylandia zebra Vs512 ighv AGTA02058636.1 956 TEGQTLTESEPVVKRPGESHRLTCTYSGFSDNRHAAWIRQAAGKGPEWVATIWSDSSGSVYSQSVQGRFTISRDNSRKQVYLQMNSLATEDSAVYYCATE
Maylandia zebra Vs476 ighv AGTA02058606.1 2520 VKCEQLTQSGPLTLQPGQRLTISCQVTYSISTYWTAWIRQPAGKGLEWVGGSGVGHSTLYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARK
Maylandia zebra Vs343 ighv AGTA02027367.1 1387 VYSIDHIQPSLLVVQPGQALTITCRVSGYSLTDGGYGTGWIRQREDKPLEWIFYIWYSGGTYQDDALKNKFSISRDTSAQTLTITGQNLQPEDTAVYYCIC
Maylandia zebra Vs204 trav AGTA02058233.1 21 CKGEDKVIQEQGDVIAAEGDTVTLYCKYETTSAFPYLFWYKQDVNDYPKYVLRRDASGTENTQEFPKDRFDAELNKTSVSLKIQKLQLSDSAVYYCALR
Maylandia zebra Vs205 trdv AGTA02058235.1 73 LTAGDSITPQQPEVTKTEGESVTLTCSYETDASYPRLHWYRHDSDLQAPQFILWKGGKRETTQYIPDNRYHSTTTDKSTNLTIAALTLADTALYYCALE
Maylandia zebra Vs206 trdv AGTA02058236.1 47 LTAGDSITPQQPEVTETEGESVKLTCSYETSDDTPWLFWYRHDSDLQAPQFILWKGAKDNSGEYIPDDRYESETSPTTTNLTITALTLADTALYYCALQ
Maylandia zebra Vs207 trdv AGTA02058237.1 25 LTAGDSITPQQPEVTKTEGESVKLTCDYQTGYDTPWLYWYRHDSDLQAPQFILWKGAKRSTSEYIPNNRYGSQTSPTTTNLTIAALTLADTALYYCALQ
Maylandia zebra Vs201 trav AGTA02058215.1 2576 CKGEDKVIQEQGDVIAAEGDTVTLGCTFASQTTPTLFWYKQEVNAYPKYILRKFLSGATDKAPEFQEDRFDAEINQTSVPLKIQKLQLSDSAVYYCALQ
Maylandia zebra Vs202 trav AGTA02058223.1 58 VICEELTALDTQKSSLEGSTVTLSCRYSKPVVGTYYFFWYQQYPGKPPKFLISHSDKGQLTSDPVSRLSVKVNETLMTLQISSAAATDSAVYYCAVR
Maylandia zebra Vs203 trav AGTA02058224.1 1209 CKGEDKVIQEQGDVIAAEGDTVTLDCKYETSDSSPYLFWYKQEVNSYPNYMLHCLSTSTVKAEEFNNDRFDAKINKAEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra Vs34 trbv AGTA02003741.1 3802 VFLGLEVRQSSSDIIANVSSKVQIFCIHDKTDYYVMLWYQRPPGETAMKLIGYLYHKQVTMEDQYKSNFIISGDLTGSTAKNSSLIANAAQQGDSAVYYCAASK
Maylandia zebra Vs35 trbv AGTA02003741.1 7527 TVLSALVIQQSPLNLLIKPQQQEAKLDCYHGDNSYPYMFWYQHKSAAGGQQTMDLIGQLHYENPTLEKTFKSKFNITGHSKGKAQLEISNVNPADTAQYFCAAS
Maylandia zebra Vs36 trbv AGTA02003741.1 8779 CALSSLVIQQTPLNLLIKPERRQAQIECYHGESDYPYMYWYQHKSAAGGQRTMDLIGRLQYGAPTLEKTFKSKFNITGHATAKAQLEISNVNPADTAQYFCAAS
Maylandia zebra Vs30 trbv AGTA02003740.1 4971 HSQDVIQYPEISWRFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAVS
Maylandia zebra Vs31 trbv AGTA02003740.1 5739 VCLGFEVRQSPSEFITDVGSKVQIFCNHEKTDYTVMLWYQQPPGETAMKLIGFLNVNTPKFEDENNDNFEITGDLSAITAKNGSLIVKKAKGQEHSATYYCAASK
Maylandia zebra Vs32 trbv AGTA02003741.1 1256 LCLGVEVHQTPVEVFRTRGDEVQLVCSHGKTDYTFMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLSGSKPKNASMFIVDLKPEHSAVYYCAASY
Maylandia zebra Vs33 trbv AGTA02003741.1 2694 VSLGIEVRQSSSDIVAKASDKVQIFCSHDKTDYRMMFWYQQSPGDTAMKLIGFLNYVAVTLEEQYRDLFSITGNLGGDSAKNGSLTIQVKGREHSAVYYCAASK
Maylandia zebra Vs347 ighv AGTA02027377.1 2541 VYCIDLNQPDSRVVQPGQSMTITCRVSGYSVTDGYGTCWIRQREGKQMDWIFCIWSDGSSSKNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Maylandia zebra Vs38 trbv AGTA02003741.1 11153 VSESVLITQWPHYISNPSNGLAKMHCYQNDTDYQYLYWYKQPRGKSFQLIVATVAGTSQFEEGFKSGFQAEKNDKQWSLTITSIQEKDEAVYLCAAR
Maylandia zebra Vs39 trbv AGTA02003742.1 404 QASAVIFQQSPPQIVDKNQEVQINCKHDDSSLVIMFWYQQRKENTSMTLIGFGYYQQSQNYEGQFKEQFTLTRSSTVEGTLTIKKTDVSHSAVYFCAA
Maylandia zebra Vs571 ighv AGTA02070623.1 865 VNGQTLTESEPAVKQPGQSHRLTCTTSGLSFSSYYMTWIRQAPGKGLEWIASINTGGGSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs478 ighv AGTA02058608.1 11143 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFRCCSMHWNRQPAGKALEWLGRVHSSGSGTDYSSSLRGRIEITKDNSNSMTYLRLSNLKPEDSAMYYCAKE
Maylandia zebra Vs349 ighv AGTA02027380.1 1782 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTGYNIHWIQQRPGRALEWIGRMDTGKNSAIYGSTFQSRFVITEEDSSSRQYLEIKSLTAEDSAVYFCARQ
Maylandia zebra Vs190 trbv AGTA02055786.1 3099 VIWTNDVTQTPTLLLKTGDSAQMYCHHNLRGSYYHMYWFQQLPGESLRLIVHMLPYKAPDFGNFSQEKYSANKIVSESGAFTVKHLEPSDSGVYLCAVS
Maylandia zebra Vs191 trbv AGTA02055786.1 5898 CCVGIHQTPPALIKKPDDMVQLVCTHNLTEYRVMLWYQQPAGQTDMKCIGYINYRDVTVEETYKQNFEISGDLSTSDIKNVSLIIQLTGAQDSAVYYCAARF
Maylandia zebra Vs192 trbv AGTA02055786.1 7972 ASPNQNENVHQTPTDLLKNITDGDKLTCKHKVKSYDTIVWYHCPAGDTSLKLVGFTSYKEIQTVEKPYEGLFSVSGNGEVEAFLHLGKLRHPENSGHYFCAVSS
Maylandia zebra Vs193 trbv AGTA02055787.1 866 QANCVTFQQPQSRIVNVGERVEIQCSHDDDSLYVMLWYQQRDYGAMSLIGYSYDTNKPDYEPAFQNHTEILRETRVKGALSLPSVKLSHSAVYFCAAS
Maylandia zebra Vs194 trbv AGTA02055787.1 3373 FCCSVKIYQPPFTLSREGEKSATLQCEQDNDEYLYMFWYKHTDFRQMQLLTYSINKGIQTTEAPFNETKYFMSRPAVRNSSLHIKRVEPGDSAVYYCTSRL
Maylandia zebra Vs446 ighv AGTA02058586.1 4536 VDGQTLTQSEPVIKRPGDSHTLTCTGSGFTFSDYWMHWVRQAPGKGLEWVAGISESSGYIHYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARQ
Maylandia zebra Vs447 ighv AGTA02058586.1 2543 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFNSYDMVWIRQAPGKGLEWIAYISSGSGSIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs346 ighv AGTA02027377.1 5749 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDSSYGTCWVRQSDGKQMDWINCMWYDGSTANNNALKNKFSVSRDTSARTVTIRGQNLQPEDTAVYYCAR
Maylandia zebra Vs561 ighv AGTA02067672.1 1648 VDGQTLTESDPAVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKGLEWIARISSSGGSTWYSQSVQGRFIISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs522 ighv AGTA02058645.1 7388 QLWPCHQLTLRMPTVARVPRVADPCCRGTGFNFGGYGMHWIRQPAGKALEWLGVIWSDASKTVYASSVEGRIEITRDNSNSMVYLRLSSLKPEDSAVYYCA
Maylandia zebra Vs563 trav AGTA02068170.1 1417 VSCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEILTPPSSSRLSVGVRKEETKMTLQISSAAVSDSAVYYCAVR
Maylandia zebra Vs562 ighv AGTA02067673.1 2981 VKCEQLTQPASETVQPGHRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Maylandia zebra Vs565 trgv AGTA02068274.1 4796 EQLIQDDLTLTRRVGESVSFSCGGTEQCGDSYRYWYQKKEKETFRIILYSYKSGGNYRVSKPYNHPQQDDFIVENEENSCELKIEKVKRDHSATYYCSCVKYD
Maylandia zebra Vs566 iglv AGTA02068366.1 1331 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDSAARWYKQIPGGVPQYVLRFRHDWSSPTYGSGFSSPKFTSTHQSTSDYRLIISNVEEGDSAVYYCQTW
Maylandia zebra Vs176 trgv AGTA02048843.1 73 LVTMAAQLIQNDLTSTKKAGEAASLKCTGFDQCDNNYMYWYMKKDRGSFTVIVRFDRIEKKTSKFTHHLKESFSAMSDKDDIVLLINKCSVEHSATYYCV
Maylandia zebra Vs177 igkv AGTA02049154.1 3183 SSGEKVLTQTPTAQSVVPGQAVSIRCKASSSVSGCLNWYLQKDGESPKLLIYSATNRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Maylandia zebra Vs358 ighv AGTA02027385.1 1114 VDGQTLTQSEPDLLKRPGESHRLTCTASEFTFRSSCMVWVKQATGKGPEWIAFIHTSSFRYSTYYSQSVQGRFTISRNDSSSKLYLQMDSLKTQDTAVYYCARE
Maylandia zebra Vs175 trgv AGTA02048841.1 62 EQLIQEQLSQTGRVGETVAISCKSTDQCDKKQIYWYQNTEKDPLKVILRIDLADGAVNSRYNHPQKQDFNALRKPGGCELVIKDIKPQHTATYYCVCWKG
Maylandia zebra Vs227 ighv AGTA02066247.1 398 VKCEQLTQPASMLVQPGQHLTITCQVSYSLSSYYTAWIRQPAGKALEWMSDDETVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARRR
Maylandia zebra Vs526 ighv AGTA02058652.1 622 VTGQSLESVPSSPVMKRPGETLSLSCKGSGSDFTCCGMSWIRQQPGKGLEWIGVGHRPSSNNRYANSLIGRIEVSRDDSNYIVYLSLSNLKPEDSAVYYCARD
Maylandia zebra Vs224 trav AGTA02065544.1 4403 WISMSVSQNVEVQPGEEVTLQCANISTSNTATFWFRLRNGAQPKCISVMFSNDKSLAYCEEFESGYFEMSSNISTIFLKIKNVAVSDSGLYFCGFYANAR
Maylandia zebra Vs179 igkv AGTA02051936.1 13143 HLSAVIQSATVKQETGVRFAAVGDNVTLRCFYESQVAMHFSWYRQFLGSQPKRLSTIYKYDKPSEVLHTLEKNPRFSVERKEGTNHLQISGVRLSDSATYYCGS
Maylandia zebra Vs27 trbv AGTA02003739.1 2790 SSLSDQVHQNPADMYKNLEETAEITCSHSIDTYNQILWYKQTKTGQMQFLGYMLGTSSSVEPGVTVTIGGNANKDQTCTLIIKDLFMNSSAVYFCAAR
Maylandia zebra Vs26 trbv AGTA02003739.1 787 VCLSVKVGQTPSEFITNVGSRVEIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFQAFTFDQDQYKDHFDFTGDLSGDTAKNGSLIVKVTQHEHSAVYYCAARY
Maylandia zebra Vs25 trbv AGTA02003738.1 830 SSLSDQVFQTPADMYKNQGQRAEINCVHKITNYDRIFWYKQTENSQLQLLGYMVGTSPFLEPGVTVTIHGNANKDKTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra Vs24 trbv AGTA02003736.1 7562 SSFSDRVHQDPADMYEIQGQTAEITCSHSIDSYNVILWYKQTENNQLQLLGHVYSTNPSVEPGVTVTIAGNANKDKTCTLTIKDLFMNSSAVYFCAAR
Maylandia zebra Vs23 trbv AGTA02003736.1 6252 VCLGVKVSQTPLEVFRRPGEKVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEESFKTHFNISGDLSGDDAKNASLFIVDLKAPEHSAVYYCAASF
Maylandia zebra Vs21 trbv AGTA02003736.1 3337 SSLSDRVHQNPADMYKEQGQTAQITCSHSIDSYNVILWYKQTNSQLQFLGYMLGTTQFPEPGVTVTMDGSADKDKTCTLTIKDFVMNNSAVYFCAAR
Maylandia zebra Vs20 trbv AGTA02003736.1 1591 VCLGIEVRQSPSEFITKVGSKVEIFCSHEKTDYRVILWYQQQPGDTAMKLTGHLYFKDDKYEEQYKDHFNITGDLSGNTAKNVSLIVKVAQKEHSAVYYCAARQ
Maylandia zebra Vs460 ighv AGTA02058595.1 10565 VNSETLTQPASMIVQPGEHLTITCQVSYSLGSYPTAWIRQPAGKGLEWIGRAGDGWTTYYKDSLKNKFSISFESSSKTVTLRGTNVQPEDTAVYYCARE
Maylandia zebra Vs29 trbv AGTA02003740.1 2983 SSLSDQVFQTPANMYKNQEQTAEINCVHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPEPGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Maylandia zebra Vs28 trbv AGTA02003740.1 1173 VCLGIEVRQFPSGVITDVGSKVEILCSHEKTDYRVMLWYQQPPGETAMKLIGFLQYQVVTFDEDQYKDHFDINGNLGGNTAKNGSLIVKVTQKEHSAVYYCAARE
Maylandia zebra Vs525 ighv AGTA02058650.1 2263 VTGQSMESIPSSPVVKKPGETFSLSCRGSGFTFTCCTMNWVRQQPGKALEWIGEGWSDSSSNSYASSLRGRIEVSRDDSNSLTYLRLSNLKPEDSAVYYCA
Maylandia zebra Vs220 trgv AGTA02064299.1 53 LVTMAAEQLIQDDLTLTRRVGESVSFSCGGTEQCSGSYRFWYQKKENETFKVILRIDTDNGRVYSGYGHPQKIDFSAKMNQNIFELKIKKVKRDHSATYYCYCWS
Maylandia zebra Vs472 ighv AGTA02058605.1 8096 HAQTLTQSEPVVKKPGESHRLTCTTSGLSFSSNWMAWIRQAPGKGLEWIATDTNGGSNYYSQSVQGRFTASRDNSREQLYLQMNSLKTEDSAVYYCA
Maylandia zebra Vs221 igkv AGTA02064555.1 2297 SSGEQVLTQTPGSQSVVPGQTVSVRCKSSSSVHSNLHWYLQKDGESPKLLIYYATNRQSGISDRFSGSGSGTDYTLTISRVQAEDAGVYYCQHY
Maylandia zebra Vs367 trbv AGTA02029101.1 4654 IVLTQTPAVHTVSPGQEVVLNCNIERYDANYVSWYKQVPGTVPQYVLRFHHSSSSPSFGTGFSSDRFNSKSSSDIDYQFIIKRAETGDSAVYYCQTWDDSAS
Maylandia zebra Vs366 iglv AGTA02029098.1 1966 VSGVTVVTQKPVLSVRKGETATMDCNLGTSTDGARWYKQIPGGVPQFVLNFYHGWSSPKYGSGFSSPKFTSTYQSRSDFRLIISSANEGDSAVYYCHTWDDSAK
Maylandia zebra Vs365 iglv AGTA02029097.1 2779 VSGVTVVTQKPPVLSVRKGQTATMDCNLGTVTNEPAWWYKQIPGGVPQYVVRFRHDWSSQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEEDSAVYYCKTW
Maylandia zebra Vs364 iglv AGTA02029090.1 2700 VSGVTVVTQKTVLSVSKGETATMDCNLGTVTNEPAWWYKQIPGGVPQYVVRFRHDWSSQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEEDSAVYYCKTW
Maylandia zebra Vs363 trbv AGTA02029090.1 9472 IVLTQTPAVHTVSPGQEVVLNCNIERYDGNYVRWYKHVPGEAPQYVLRFRHSDSSLEFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Maylandia zebra Vs362 trbv AGTA02029085.1 15058 IVLTQTPAVHTVSPGQEVVLNCNIERYDRNYINWYKQVPGGVPQYVLRFLHSSSSLSFGTGFSSDRFNSKSSSNIDYQFIIKRTETGDSAVYYCQTWDDSAS
Maylandia zebra Vs475 ighv AGTA02058606.1 8778 TEGQTLTESEPVVKRPGDSHRLTCTYSGFAGDIYADWIRQPPGKGLEWIAHIESSSNSYYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCVQE
Maylandia zebra Vs474 ighv AGTA02058605.1 3045 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSHWMHWIRQAPGKGLEWIAADTSSSTNYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs572 trav AGTA02070676.1 543 LIAVCRAQTVEVRPGEEVTLQCANISTHSSLTFWFRLVNRTMASCISVMFRADKSVAYCDGFQNGPFEMTSNSSTIFLKIKHPRVSDSGPYFCGF
Maylandia zebra Vs521 ighv AGTA02058644.1 1575 TEGQTLTESESVVKRPGDSHRLTCTYSGFGGDFHAAWIRQAAGKGPEWVAWIQSNSGNIWYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCAKE
Maylandia zebra Vs479 ighv AGTA02058608.1 7655 TEGQTLTQSEAVVKRPGDSHRLTCTYSGFSSDYATAWIRQAPGKGLEWIAWINYGGSSTYHSQSVRGRFTISRDNSIKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs449 ighv AGTA02058587.1 5448 VLTGVDGQTLTQSEPVVKKPGDSHTLTCTGSGFTFSDYWMHWVRQAPGKGPEWVAGISETSRYIHYSQSVQGWFTISRDNSKQQVYLQMNRLKTEDSAVYYCARQ
Maylandia zebra Vs260 igkv AGTA02003898.1 325 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDNDLSWYLQKPGQPPKLLFYKISRRQSGTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYTGPE
Maylandia zebra Vs520 ighv AGTA02058643.1 1325 VKCEQLIQPPSVIVQPGQRLTITCQVSYSMGSYYTAWIRQPAGKGLEWIGMKSIWYSYYKESLKSKFSIDLDTSSKTVTLNGENMQPEDTAVYYCAR
Maylandia zebra Vs304 igkv AGTA02020337.1 8548 NTQKTSNYTFVKEKVHPGDSVTLQCSVLSSSNRKTCPGGHNVFWFREANTSHPGIIYTAGNRHHECGKRSETEQSCVYRLSKNISSSDSGTYYCAV
Maylandia zebra Vs300 igkv AGTA02020327.1 2105 TAITDIIQVPQSGPLHPGNPVTLQCSVLSNPENSACPGNDSVFWFSTRSDNSHPNLIYADGNSDKCERSPEASSTQKCVYSFSKNVSSSDAGSYYCAV
Maylandia zebra Vs213 trav AGTA02061259.1 1323 CRAQKDNVLQAKGEETAAAGGTVTLHCLYNTSSLSNYYLYWYKQDGNNSPKFILSRDSGDQGNTADEFKERFSSTLDSSNRSAPLKIQKLQLSDSAVYYCALQ
Maylandia zebra Vs90 igkv AGTA02003896.1 163 CSGQVTVTQPPVVTSTPGSTVTLTCRTSQDVYRDFDDDDYVFWYQQKSGQTPKLLIRYAKKLQSGTPTRFSGSGSSSDFSMTISGVQTEDAAVYYCQS
Maylandia zebra Vs308 igkv AGTA02020342.1 7270 NTQKTSNYTFVKEKVHPGDSVTLQCLVLSSSNRKTCPGGHNVFWFREANTSHPGIIYTAGNRHHECEKRSETEQSCVYRLSKNISSSDSGTYYCAV
Maylandia zebra Vs12 trbv AGTA02003726.1 1125 ASDTKSLSQTPPSIIRRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFSDSAVYFCAAK
Maylandia zebra Vs13 trbv AGTA02003727.1 24 VSSTYNVLQTPPSIIKKVGQSVSNEIHCSHNVSIFEWILWYKQDKHRAPQFLGYLNLNFPYPEEDVKGKIIFNGNGKEYSNLTISNVSVTDSAVYFCAAS
Maylandia zebra Vs10 trbv AGTA02003725.1 1931 ASDTKRANQTPPSIIKRIGESVESEIKCSHSIPGYQVILWYKQDEKGVLQFLGYLNLEFPNIEDDVKGKISFDGDGQKYSNLAISNVSVTDSAVYFCAAS
Maylandia zebra Vs11 trbv AGTA02003725.1 2992 LTDGGEVKQTSILWKNQGDNVSIECSHTYGSSYYYMYWYRQLPGELMKQMVFTTQNSQPDFEPDFRDDKFSATKTDAHSGTLIVKNLVPGDQGLYFCAAS
Maylandia zebra Vs16 trbv AGTA02003731.1 315 VSSTYTVQQTPPSIIKKVGQSVSSEIHCSHSVSSFNRILWYKQDKHRALKFLGYLNVNSPIPEDDVKGKISFNGDGRKHSNLTISNVSVTDSAVYFCAA
Maylandia zebra Vs17 trbv AGTA02003732.1 594 VCLGIEVRQFPSGVITDVGSKVQIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFKAVTFEDQNNDNFSITGDLGGNTAKNGSLTVKVVQKEHSAVYYCAARE
Maylandia zebra Vs14 trbv AGTA02003727.1 1029 SIDAKDVTQTPMLWEQQGNNATMDCSHTKDASYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEAHDGTFTVKDLEPKDSGWYFCAVS
Maylandia zebra Vs15 trbv AGTA02003730.1 506 LSPSDRVHQEPADMYKTSEDIAKIQCLQSIDDNHNQILWYKQSNSQLQLLGYMVANRGLPETGFNVSIDGSANKDQTCTLTIKRLDFNSSAVYFCAAS
Maylandia zebra Vs228 ighv AGTA02066251.1 783 QTITESEPAVKRPGESHRLTCTTSGFNFGSSVWSWIRQAPGKGLEWIAYIDTASTPIYYSQSVRGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCAKG
Maylandia zebra Vs19 trbv AGTA02003735.1 268 SSLSDQVYQNPADMYKEQGQRADITCSHSIDNYDRILWYKQIKGHLQYLGYIVGNLGSPETGANVTIIGNANKDQTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra Vs546 trav AGTA02065597.1 3717 LHVFLPYKLVAPRDEGATLPCRSVTVGQAVKSVRWRRDGELVLELNPRSKQITYGDGYNESRVSIPSDWYQRGDLSLTVKRAQLRDDGVYYCYVE
Maylandia zebra Vs544 trgv AGTA02064712.1 5952 EQLIQDDLTLTRRVGQSVSFSCGGTEQCDNSGWLYWLQKKITFTQILNINKNTGEIQSAFKHPQIDDFSVENKVRSSELKLEEVKLNHSATYYCMCAKKA
Maylandia zebra Vs543 trgv AGTA02064709.1 5864 EQLIQDDLTLTRRVGESVSFSCGGINKCDYDPIFWYQKKEKETFRVILFIDKSSGYVYSGYDHPQKDDFSVVNTQNSCELKIEKVKLDHSATYYCSCWVSD
Maylandia zebra Vs470 ighv AGTA02058604.1 2857 VWSEIKLEQSPSEVKRPGERVKLSCIISGYTPTDYYLHWIRKRPGRALEWIGRMNTGSNSARYASSFQSRFIMTEEDSSSKQYLEINSLTAEDSAVYFCARE
Maylandia zebra Vs560 ighv AGTA02067670.1 4122 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALAWVASHYNSANIHYSQSVQGRFTISRDNSRQQLYLQMNSLRTDDSAVYYCA
Maylandia zebra Vs188 trbv AGTA02055783.1 24970 LSSKTVHQSPAQMFKVAGKQVLINCNHSNSDFYMIQWYKQSTRRNEMTLIGFARYDSQAVEGPFQALYNVSGDGRSASSLHFLAHGSAIYFCAASE
Maylandia zebra Vs468 ighv AGTA02058602.1 7162 VDGQTLTQSEPHLIKRPGASHRLTCTASGFTFTDYEMVWVRQAPGKGPEWIAFISISTHSYATSYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Maylandia zebra Vs448 ighv AGTA02058587.1 7742 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSHYWMAWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSKPQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs229 ighv AGTA02066252.1 324 VDGQTLTESEPAVKSPGESHRLTCTASGFTFSSSWMVWVRQAPGKGLEWIAFIYSDSSGSFYSQSVRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs186 igkv AGTA02055058.1 708 SAGQNVVVTQSASKSVQLGQTVNINCKVSTQVAQYSGSQYYLTWYHQKTGEAPKALIYRTSDRLSGISSRLSGSGAGNGLDFTLSISAVQADDAGVYYCQS
Maylandia zebra Vs464 ighv AGTA02058597.1 1065 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIARISNGGSSIYYSQPVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs465 ighv AGTA02058599.1 4041 VDGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIATEALGSGKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs466 ighv AGTA02058599.1 2367 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSQWMHWVRQAPGNGLEWIAADTSSSTNYYSQSVQGRFPVSRDNSREQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs294 trav AGTA02020308.1 52564 FIFLLSLNSDTVVPVKTVQLGEPATITCAIPKELSSRGVHWYKQSFGGTLKLIMTVFKSTEPTFGPEFTSLKFDIGDDFASLTILKADQDDEGIYHCA
Maylandia zebra Vs348 ighv AGTA02027378.1 3566 VKCEQLTQSTAVTVQPGQPLTITCQVSYSLSDAWTHWIRQPAGKPLEWISRDTAVKDSLNNKFSAELDSSSNTVTLNGQNLQPEDTAVYYCAREP
Maylandia zebra Vs461 ighv AGTA02058595.1 8905 VDGQILTESESVVKRPGESHRLTCTVSGFTFSSYGMSWVRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRDDSSSKVYLQMSSLKTEDTAVYYCARR
Maylandia zebra Vs462 ighv AGTA02058596.1 7602 VWCDIRLDQPPSEDKRPGETVKISCVTSGYTMTSYGINWIRQKPGKALEWMGWINTATTVASYASAFQNRFTFTQDVPSSTQYLEIKSLTAEDSAVYFCAR
Maylandia zebra Vs463 ighv AGTA02058596.1 3973 VKGQTLTESEPAVKQPGESHRLTCTTSGFTLSSNWIHWIRQAPGKGLEWIAADANSATNYYSQSVRGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs250 ighv AGTA02071690.1 364 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGGSTKHYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCTRD
Maylandia zebra Vs312 igkv AGTA02020356.1 2822 ITGVTQDSLSNPVHPGDPVTLQCSVLSNSENRTCTEDHSVYWYRTKPDESHPSLMYSQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra Vs310 igkv AGTA02020354.1 15891 ITGVTQDSLSNPVHPGDPVTLQCSVVSNSENRRCTEDHSVYWYRAKPDESHPSLIYIQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra Vs311 igkv AGTA02020354.1 7692 ITGVTQDSLSNPVHPGDPVTLQCSVLSNSENRRCTEDHSVYWYRTKPDESHPSLIYIQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra Vs336 ighv AGTA02027360.1 3194 VDSQTITQSEPVAIRPGESHRLTCTGSNIDFSSYCMAWVRQAPEKGLEWVASIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs491 ighv AGTA02058613.1 1119 VTGQSMESIPSSPVVKKPGDTLSLSCRGSGFSFGCCVMIWVREPAGKPLELIGSGFSTSSRNSYASSLRGRVEISRDDSNSMVYLRLSNLRPEDSAIYYCAKE
Maylandia zebra Vs490 ighv AGTA02058613.1 3051 LNGQALESIPSTSVLKKPQEAFSLSCRGSGFDFGQYGMHWIRQPAGKTLEWMGAIWYDASKTIYASSVQGRIEITRDNSNSMVHLSLSSLKPEDSAVYYCARK
Maylandia zebra Vs493 ighv AGTA02058614.1 640 VDGQTLTESEPVITRPGESHRLTCTASGFTFSSYDMHWVRQTPGKVLEWVAEVSAGSSKYYSQLVLGRFSISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs492 ighv AGTA02058614.1 1583 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAAFGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQLEESAVYYCARD
Maylandia zebra Vs495 ighv AGTA02058616.1 9600 VKCEQLTQPASVTVQPGHRLTITCQISYSLSSYWTGWIRQPAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARD
Maylandia zebra Vs494 ighv AGTA02058616.1 11767 VSVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGCFTISRDNSRKQVYLQMNSLTAEDSAVYYCAEQ
Maylandia zebra Vs497 ighv AGTA02058616.1 5493 VQCEQLTQKASETVQPGQRLTITCQVSYSVTGRWTAWIRQPAGKGLEWIGSRVGATLAYKDSLKNKFSISLDSSSNTVTLTGQNMQPEDTAVYYCARD
Maylandia zebra Vs496 ighv AGTA02058616.1 6904 ACAQTLTESEPAIKRPGQSHTLTCTASGLTLSSNYMAWIRQPLGKGLEWIAWHDSGSGSRRFYSQSVQGRFTISRDDSRQLLLLQMNNLKTEDSAVYYCARE
Maylandia zebra Vs499 ighv AGTA02058618.1 3974 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSTKYYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Maylandia zebra Vs338 ighv AGTA02027362.1 1453 VYSIDLIQPESRMVQLGQSLTVTCQVSGYSLTDDSYVTGWIRQREGKAMDWISHQWGTSGLRQNDALKDKFSYSRDTSARTATITGQNMQTEDTAVYYCVRY
Maylandia zebra Vs339 ighv AGTA02027364.1 15713 VDGQTLTESEPVTKRPGESHRLTCAASGFTLSSYHMGWVRQAPGKGLEWIALIYTDSSGSFYSQSVQGRFTISRDNSKQQLYLQMNSLKPEDSAVYYCARN
Maylandia zebra Vs552 trav AGTA02066558.1 14777 WISVSLAQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASCISFMPTANSRATFCDGFQDTKFKMTSNTSVLFLEIKQLDSSDSGLYFCGE
Maylandia zebra Vs553 ighv AGTA02066750.1 3089 VNSQTITQSESVVKRPADSHRLTCTGSNIDFSSRWMAWIRQAPGKGLEWIAIIEYNSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTTVYYCARE
Maylandia zebra Vs454 ighv AGTA02058591.1 1172 VKCEQLTQPASETVQPGQRLTITCQVSYSVTGYYTAWIRKPAGKGLEWIGMAATGSTTYYKDSLKSKFSISTDSSSKTVTLTGQNLQPDDTAVYYCARN
Maylandia zebra Vs556 ighv AGTA02066758.1 1818 VVGQTLTQSESALKRPGESHRLTCTASGYNFGGYSLVWVRQASGKGLEWIAYIYYGGSTTSYSQSVQGRFTISKDNSRQQLYLQMNNLKTEDSTVYYCA
Maylandia zebra Vs557 igkv AGTA02067217.1 1079 SSGEQVLTQTPTAQSVVLGQTVSVRCKASSSVSSCLHWYLQKDGESPKLLIYLATSRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Maylandia zebra Vs558 igkv AGTA02067218.1 3524 SSAEIILTQTPTAQSVVPGQTVSIRCKASSSMGSYLHWYLQKPAESPKLLVSYATSRQSGIPDRFSGSQSGTDFTLTISGVQAEDAGVYYCGQSGYSFP
Maylandia zebra Vs559 ighv AGTA02067669.1 6844 VDGQILTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSSVYYCAR
Maylandia zebra Vs469 ighv AGTA02058604.1 6115 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIGWVRQAPGKGLEWIATDGGSSYKYYSQSVQGRFTVSRDDSRQQLYLQMNSLKTEDSAVYYCA
Maylandia zebra Vs456 ighv AGTA02058592.1 1348 VWSEVKLEQSPSEVKGFGERVKMSCTLSSYTLTENDIHWIRPGRALEWIGYMSTGYNSPSYASSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYLCARQ
Maylandia zebra Vs226 ighv AGTA02066239.1 1158 LDGQTLTESGPVVKRPGESHRLTCTASGFTFSSYSMDWIRQVPGKGLEWIAHIWGNGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs518 ighv AGTA02058641.1 1541 LNGQAMESIPSTPVLKNPHETLSLSCRGSGFNFGSYGMHWIRQPAGKGLEWFGTIWSDSSRTEYIASVQGRIEITKDNSNSMTYLRLSNLKPEDSAVYYCAR
Maylandia zebra Vs414 trav AGTA02051922.1 1953 WISVSLAQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASRISFMPTANSRATFCDGFQDTKFNMTSNTSVLFLEIKQLDPSDSGLYFCGE
Maylandia zebra Vs417 trav AGTA02051932.1 1620 WISVSGSGFQTVEVQPGEEVTLQCTNISKHQTQADWFKVVNQTKPTCVSSMFESRGSASFCDGFQNGKFIMSSNITFVFLQIKQVNLSDVGLYFCGF
Maylandia zebra Vs519 ighv AGTA02058642.1 515 VTGQSMESIPSSPVVKQPGETLSLSCRGSGFTFTCCGMSWIRQQPGKGLEWIGVGHRPSSSNSYASSLRGRVEIRRDDSNSMVHLKLSNLKPEDSAVYYCA
Maylandia zebra Vs129 trav AGTA02020357.1 646 LIQSTEAAHQIPLIEVEVGKNVTLQCPVTEKDGKFVHWFKQSPGYMIQTVATGSYTKQTLSEEFNNGRFSVSEGQTLYFLSMRNVQKEDEATYFCQYGSAY
Maylandia zebra Vs128 trav AGTA02020313.1 4354 VIQTTEVPQLISLTVVDLGDNVTFGCEVSEKKLKSLHWYKQSLGHLPQSVASVILDKITLSDAFKDSRFTLNKDIFTIRNVSKEDEATYFCQTR
Maylandia zebra Vs330 ighv AGTA02027355.1 3239 VDSQTITQSESVVKRPADSHRLTCTGSNIEFSSYWMGWIRQAPGKGLEWVAIIGYDSGGIFYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Maylandia zebra Vs452 ighv AGTA02058589.1 2362 VKCEQLTQPASETVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKALEWMSQDTDVKDSLKNKFSVELDSSSDTVTLKGQNLQPEDTAVYYCARQ
Maylandia zebra Vs127 trav AGTA02020308.1 73289 VTQTSEVPQLISLTVVDLGDNVTFGCEVSEKELKSLHWYKQSLGHLPQSVASVILDKITSTDAFKDSRFTLNKEIFTIRNVSKEDEATYFCQMR
Maylandia zebra Vs78 trbv AGTA02003752.1 2993 QVSAVTFQQSTPQIVAEKSEVQIDCSHNDGNLPVMLWYQHIKENQSMTLIGYGYQNTRQTFEGQFEEQFKLTRGSATTGTLTIPSAELSHSAVYFCAA
Maylandia zebra Vs79 trbv AGTA02003752.1 3561 QASSVTFQPSHPRIVNEKSNVEITCSHDKNDFYLMLWYQQKENGLMSLIGYSYFGNVPVKEEQFDNRFEITRENIQTGALSISSVIVSDSAMYFCAA
Maylandia zebra Vs480 ighv AGTA02058608.1 4061 IDGQTLTESEPVVKRPGESHTLTCTASGFTFRDYQMAWVRQAPGKGLEWIALLSSPSGSSKYYSQSVQGRFTISRDNDKQQVYLQMSSLATADSAVYYCAR
Maylandia zebra Vs481 ighv AGTA02058608.1 2148 VYSIDLIQSDSIVAQPGQSVTITCQVSGYSLTDRSYATGWIRQSEGKTLEWILHRWGNGDMAQNNALKNKLLHHTYSSTSSVTLTGVNLQPEDTAVYYCVRS
Maylandia zebra Vs486 ighv AGTA02058610.1 5145 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISGSSSSIYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs332 ighv AGTA02027356.1 7188 ARCQSLTSSEPVVSRPEQSVTLSCRVQGLSLAYLHWIRQKPGKGLEWIGRIDGGTGTIFAQSLQGQFSITKDTSQNRVNLVVNSLKQEDSAVYYCAKE
Maylandia zebra Vs484 ighv AGTA02058609.1 3437 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISGSSSSIYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs485 ighv AGTA02058609.1 642 VVGQTLIESEPAVKRPGEFHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFIHTYSTHIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARR
Maylandia zebra Vs70 trbv AGTA02003750.1 19188 SSLHNQVQQNPAEIYYRAEETAKISCSHSFQYYDKILWYKQSRNDQMQFLGYMNVNDGYPETDANVEISGSAIQGSTCTLTIKGLIVNSSAVYFCAA
Maylandia zebra Vs71 trbv AGTA02003750.1 19947 SSYSDKVYQTPADIYTNGEDAKISCSHNISSYNQILWYKQSKKQLELLGYMVLTGGNPEAGVNVVMEGSASQGKNCTLTIKETKLNSSGVYFCAAS
Maylandia zebra Vs72 trbv AGTA02003750.1 21317 GSSHTDKVQQTPAESFYTSEETVAKIKCVHHIQDYTRIFWYKQSKNNELQLLGYMNVDKEYPETGVNVTMTGRSTKGETCTLTIKGLNPNSSAVYFCVA
Maylandia zebra Vs73 trbv AGTA02003750.1 23283 SSLNSQIYQTPAQLYISKETEEVKINCSHSIQGYDRILWYRQMNNRHLQFLGYMYGTVDNPEKGLDVKLKGDANKNKTCTLTIEKLGPNSSAVYFCA
Maylandia zebra Vs74 trbv AGTA02003750.1 24179 HCQDVTQYPKISWSYVSSSAEMNCSHNKGFTYIQTYWYIQRPGKTMTFILSKLLGGKIEYGDISEAKYLASKKNFDIGTLTVKHLQFNDSGVYFCAVG
Maylandia zebra Vs573 ighv AGTA02071771.1 766 IYGQTLTESEPVVKRPGDSHRLTCTASGFTFSSFWMGWIRQAPGKGLEWVATIRYDSGEIYHSQSVRGRLTISRDNSRQQLYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs76 trbv AGTA02003751.1 1524 ISLGVQVRQSPSAAIRNAGDDVQLICTHEKTDYRVMLWYQQSPGDTALKLIGYVDYSTIKYEGDFEKYCNITGDLSGNTAKRGSLFIAGLKESEHSAVYYCAARY
Maylandia zebra Vs77 trbv AGTA02003751.1 2208 FSLGVQIHQSPSVIKKADANVEILCKHEKSDYRVMLWYQKRRGETALKLVGYGYAKFNNDSVEEPFRKHFKLSGDLEGEKKHSLLTIINLKPLEHTATYFCAARE
Maylandia zebra Vs467 ighv AGTA02058602.1 10421 VNGQTLTESEPVVKRPGESHRLTCTASGFTFTDYEMVWVRQATGKGPEWIAFISTSTHSYATSYSQSVQGRFTISRDDSSSKVYLQMDSLKTEDTAVYYCARG
Maylandia zebra Vs510 ighv AGTA02058633.1 1916 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGSWTAWIRQPAGKGLEWIGVKGTGSSYYEDSLKSKFSIDLDTSRKTVTLNGQNMQPEDSAVYYCARD
Maylandia zebra Vs511 ighv AGTA02058635.1 1342 VTPQSMESIPSSPVVKKPGETLSLSCRGSGFTFSCCTMHWIRQKPGETLEWIGIGYSSSSSNRYVSSLSGRIEISRDDSNSMVHLSLSNLKPEDSAVYYCAK
Maylandia zebra Vs85 trbv AGTA02003753.1 1290 LTVVVLQSEDQTSDPGRTLMLECKMGSGFSMSGYTMLWYRQNHHGAPIEFLVKEYDKPVGRLESFLDASKNLFSLQITELHINDSSTYYCAA
Maylandia zebra Vs86 trbv AGTA02003753.1 2543 FSRGVKIDQPQFIFSYEGTANVTLDCKQDDSDYYYMYWYRQSSSGKLELVTYSLSKDSWNIEAPFKNSQYTMSRPSLLESTLKIHLVGAGDTALYYCASSI
Maylandia zebra Vs81 trbv AGTA02003752.1 6207 FSRGVKIDQLQIIFSREGTKNVTLDCKQDDSQYYYMYWYRQSSSGKLELVTFSPGQNSWNIEAPFEKIKYTMSRPSVLESTLQIHPVEPEDTALYYCASRI
Maylandia zebra Vs80 trbv AGTA02003752.1 5042 LTVVVLQSEDQMSDPGRTVTLECKMGSGFSMSSYTMLWYRQNHHGAPVDYLLNEYDKTVGRLKSFLEASKNNFSLQITELHMNDSSTYYCAA
Maylandia zebra Vs83 trbv AGTA02003752.1 8931 LTVVVLQSGDQISDPGRKVLLECKMGPGFSMGSYTMFWYRQNHHRAPIEFLMREYEKPVGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Maylandia zebra Vs82 trbv AGTA02003752.1 7775 QASSVIFQPSHPRIVTETANVKIACSHDDNGLNLMLWYQQKENGLMSFIGYSYIGSVAVIEEQFENHFEITRENIQTGALSISSVIVSDSAVYFCAA
Maylandia zebra Vs513 ighv AGTA02058637.1 6890 TEGQTLTESESVIKRPGDSHRLTCTYSGFSGDIRTAWIRQAAGKGLEWVAWILHDSNEIYYSQLVRGRFTISRDNSRKQVYLQMNSLTAEDSAVYYCAKE
Maylandia zebra Vs89 igkv AGTA02003893.1 5982 CSGQVTVTQPPVLTSTPGNTVTLTCRTSQAVGGCSYGQCMFWYQQKSGQITKLLIRHVSIRHSGTPTRFSGSGSSSDFSMTISGVQAEDAAVYYCQS
Maylandia zebra Vs88 igkv AGTA02003892.1 162 CSGQVTVTQPPVLTFTPGSTVTLTCRTNPAVGGCGAGQCMFWYQQKSGQTPKLLIRHVSISHSGTPSRFSGSGSRSDFSMTISGVQAEDAAVYYCKSVHSGPV
Maylandia zebra Vs235 igkv AGTA02066995.1 607 SRGQITVTQPGAVSSAVGGSVSIKCTTSQDVNNNNYMFWYQQKDGGIPKLLITYVSTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra Vs234 ighv AGTA02066260.1 1295 QSITESEPAVKRPGELHRLTCTTSGFSFRGSVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARR
Maylandia zebra Vs237 igkv AGTA02067681.1 196 SSAEIVLTQTPKAQSVAPGQTVSVRCKASSGMGSYLHWYLQKPSEAPKLLVYYATNRQSGVSDRFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Maylandia zebra Vs236 igkv AGTA02067676.1 736 SSGDVILTQTPEVQSVVPGQTVSVRCKASSSMGSYLHWYLQKPSEAPKLLVYHATNRHSGVSDRFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Maylandia zebra Vs231 ighv AGTA02066253.1 3148 LHGQTLTESGPVVKRPGESHRLTCTASGFTFSSYEMGWIRQVPGKGLEWIAEIWESGNRAFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs230 ighv AGTA02066252.1 10020 SDTIWTSGQKAWRIHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAHIRSGGTTYYSQSAQGHFIISRDNNRQQLYLQMNNLKTEDSAVYYCARY
Maylandia zebra Vs233 ighv AGTA02066255.1 317 VYSIDLIQPDSRIVQPGQSLTFTCRVSGYSVTSYGTAWVRQREGNPLEWINIIWSGGSTDKNDALKNKFSISRDTSAQTVTITGRNLQPEDTAVYYCAR
Maylandia zebra Vs232 ighv AGTA02066253.1 4780 VYIIDFIQPDSLVVQPGRSLTITCQVTGYSLTDNNYATGWVRQREEKPMDWIFHQWGENVYKNDALKNKFSFSRDTSAETVTITGQNVQPEDTAVYYCVSLR
Maylandia zebra Vs334 ighv AGTA02027356.1 3176 VCSQTLTESEPVVKRPGESHKLTCTYAGISDSSDMSWIRQAEGKGLEWVAYISGPSGSTKRYSTSVQNRFTISRDNNVDQVYLHMSSLTTEDSAVYYCART
Maylandia zebra Vs335 ighv AGTA02027356.1 2192 VCSQTLTESEPVVKRPEDSHKLTCTYAGISDDNADISWIRQTEGKGLEWVAHISAPSGSTKVYSTSVQNRFTISRDNNVDQVYLQMNRLIAEDSAVYYCARK
Maylandia zebra Vs130 trav AGTA02020358.1 2904 LIQSTEAAHQIPLIEVEVGKNVTLQCPVTEKDGKFVHWFKQSPGYMIQTVATGSYTKQTLSEEFNNGRFSVSEGQTLYFLSMRNVQKEDEATYFCQYGSAY
Maylandia zebra Vs337 ighv AGTA02027362.1 4704 VWSDVKLQQSSSELKRPGEIVKMSCIVSGYTMTSGYFSWIRHRAGKALEWIGTMNSGSNSASYSSSFQSRFLMTEDVPSSTQYLEIKSLTAEDSAVYFCARQ
Maylandia zebra Vs239 igkv AGTA02067683.1 3258 SSAEIVLTQTPTAQSVVPGQTVSIRCKASSSVSYDLQWYLQKSGESPKLLIYNADSRYSGVSERFSGSQSGTDFTLTISGVQAEDAGVYYCQQDYSRP
Maylandia zebra Vs238 igkv AGTA02067683.1 217 SSAEIVLTQTPKAQSVVPGQTVSIRCKSSTSIGDDINWYLQKSGKAPKLLIADTTYRQSGVPDRFRATAVQTDFTLIISGVQTEDAGVYYCQQHNSFP
Maylandia zebra Vs225 ighv AGTA02066235.1 505 KTIKESEPAVKRHGESHRLTCTISGFNFGSSVWSWIRQAPGKGLEWIDYIDIPSTPIFYSQSVQGRFTISRDDSSSKVYLQINNLKAEDTAVYYCAR
Maylandia zebra Vs333 ighv AGTA02027356.1 5423 VYSIDLLQPDSSIVQPGQTLTITCQVSGYSLTDNSYATGWVRQRERRPMDWIFHQWGGGDFYKNDALENKFSYSRDTSARTVTITGQNLQMEDTAVYYCVRR
Maylandia zebra Vs69 trbv AGTA02003750.1 17364 GSSLSDQVDQDPADIYTRGEDAKIYCSHSIPSYNQILWYKQLETQLQFLGYMYLNNDNPETGVNVMMNGSARTGEKCTLTIKDIKPSSSGVYFCAAS
Maylandia zebra Vs68 trbv AGTA02003750.1 16038 SSSSDQVDQTPADIYTKGEDVKVYCSHSIQSYDEILWYKQSKKQLQYLGYMNIDKGYPETGVNLMIEGNANKGENCTLTIKDIKVSSSGVYFCAAR
Maylandia zebra Vs63 trbv AGTA02003750.1 7848 GSSLSDQVDQTPADIYTKGEDVEIHCSHSISSYETILWYKQTEKKLQLLGYMLNDRGYPETGVNVMMDGDARQHKNCILTIKDIKVSSSGVYFCAAR
Maylandia zebra Vs61 trbv AGTA02003750.1 3236 GSSLSDQVHQTPANIYTKEEDVKIDCSHSIQSYDLILWYKQSKKQLLLLGYMYLGKSFLETGVNVTIDGGAEKNENCTLTIKDIKLSSSGVYFCAAR
Maylandia zebra Vs60 trbv AGTA02003750.1 1814 GSSDSDQVDQTPANIYTNGEEAKIHCSHSISSYNQILWYKQSEKQLLLLGYMYYDKSYPEPGVNVTIDGDARQHKNCTLTIKEFELSSSGVYFCAAS
Maylandia zebra Vs67 trbv AGTA02003750.1 14604 SSLSDQVSQDPADIYTKGEDAKIYCSHSIPSYNRVLWYKQSEKQLQYLGYMLTDKGYPETGVNVEMDGNADQGKKCTLTIKEIKLNSSGVYFCAAR
Maylandia zebra Vs66 trbv AGTA02003750.1 13002 SSLRDQVHQSPANIYTKGEEAKIYCWHSNPSYDTILWYKKSEKQLHLLGYTYYDNSYPEPGVNITMDGDARQHKNCTLTIKYVKLSSSGVYFCAAR
Maylandia zebra Vs65 trbv AGTA02003750.1 11389 GSSLSDQVDQTPADIYTKGEEAKIHCSHSNPNFYTILWYKQSEKQLQLLGYTNYDKSYPEPGVNMTMDGDARQHKNCTLTIKYLKLSSSGVYFCAAR
Maylandia zebra Vs436 igkv AGTA02051957.1 6658 SQIFSSEHQESRFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIISHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVQYS
Maylandia zebra Vs434 igkv AGTA02051957.1 16143 RETGLKNPALVHQSPSETIQPGGSVTLNCTVHTGTCDEEHSVYWFKETEASRPGLIYTYGGKNDYCRTKTNPQADACVYNLPMKDLNMSHAGTYYCAVDSC
Maylandia zebra Vs433 trav AGTA02051957.1 23368 LSIKALVQQSASETIQPGGSVTLNCTVHTGTCDGERSIYWFRKTEESQQTGLIYTHGGGNDQCERKTKTQTNTCVYTLPMNGLNLSHAGTYYCAVASC
Maylandia zebra Vs432 igkv AGTA02051956.1 2657 LNIKALVQQSASETIQPGGSVTLNCTVHTGTCDEDHSVYWFKDSGDFYPGLLYTHGGRNDQCEKNEQTYNCTYNLPVKSINVSHAGTYYCAVASC
Maylandia zebra Vs431 igkv AGTA02051954.1 2796 SDLNIKAVVQQSASETIQPGSSVTLNCTVHTGTCDGEHSIYWFKDSEESHPGLIYTHGGRNDQCERKANKRTHTCVSNLTMESLNVSHAGIYYCAVASC
Maylandia zebra Vs357 ighv AGTA02027385.1 2544 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSYLMGWVRQAPGKGLEWVATIDVTSKYYAQSVQGRFTISRDNNRQQVYLDMNTLKTEDSAVYYCA
Maylandia zebra Vs241 ighv AGTA02068969.1 2111 TEGQTLTESESVIKQPGQSHRLTCTYSGFSGDDHYVWIRQAAGKGLEWIAYINPGSSYIYYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs534 trav AGTA02061301.1 628 LGSMNSIKQERAEEAVAERGNINLTCTYDGLINNIQWYRQYQRSRPEFLLYITEGGSVHRAVSGFSAHIDKTEKRADLEISSAAVSDSAVYYCALQ
Maylandia zebra Vs535 trdv AGTA02061303.1 3004 LTAGDSITPQQPEVTETEGQSVKLTCSYETSASDVWLYWYRHHSDLQAPQFILWRGARSQSDRQYIPDNRYGSQTSPTITNLTIAALTLADTALYYCALQ
Maylandia zebra Vs244 trav AGTA02069561.1 109 LIAACRAQTVEVRPGEEVTLQCANISTHSSLTFWFRLVNRTMASCISVMFRADKSVAYCDGFQNGPFEMTSNSSTIFLKIKHPRVSDSGPYFCGF
Maylandia zebra Vs245 igkv AGTA02069903.1 387 LNIKALVQQSASETIQPGGSVTLNCTVHTGTCDEDHSVYWFKDSGDFYPGLLYTHGGRNDQCEKNEQTYNCTYNLPVKSINVSHAGTYYCAVASC
Maylandia zebra Vs246 ighv AGTA02070044.1 1021 TESQTLTESESVIKRPGEPHRLTCTYSGFSSDIHVGWIRQAAGKGLEWIVFIWSNNSGSFYCESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs248 trav AGTA02070339.1 572 WISMSVSQTVEVQPGEEVTLQCTNISSYSGVTFWFRLINRTNASCIAVMFERTKSVSYCDGLQSESFEMSSNISTVFLKIKQVAVSDSGLYFCGF
Maylandia zebra Vs249 ighv AGTA02071459.1 241 VYSIDLIQPDSRMVQPGLSLTITCQVSGYSLTDDSYATGWIRQREGKAMDWIFHQWGAGGLRQNDALKDKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRY
Maylandia zebra Vs538 trav AGTA02063240.1 6745 LHVFLPYKVVALRGEDATLPCHSVTVGQAVKSVRWRRDGELVLELNPRSKQITYGDGYDERPVSIPSDWNQRGDLSLTVKRAQLRDDGVYYCDVEKTE
Maylandia zebra Vs539 trav AGTA02063256.1 5342 KLELTDLQVFLPSEVVVDEGEDAALPCRSITAGQRVKSAQWRRDGEVVLELNPPQVTEGNGFESRVSISSDWYQRADLSLTIKRVHLRDRGVYFCDVDKTE
Maylandia zebra Vs56 trbv AGTA02003748.1 794 SSFSDQVHQTPPDIYTKEDEARIYCSHSISGYYQILWYKQSEEQLQFLGYMSYDKGNPEPGVNVTMDGGANEKENCTLTIKDLKVSSSGIYFCAA
Maylandia zebra Vs57 trbv AGTA02003748.1 2059 ASSFSDQVDQTPANIYTKGEEAKIHCSHSVQSFYQILWYQQSNKELQYLGYMYLGKSSVETGVNVTIDGGANKGENCTLTIKDLKLSSSGVYFCAAS
Maylandia zebra Vs54 trbv AGTA02003747.1 9089 GSSVQVDQTPTNIYTTGGDAKIYCSHSIPTYNQILWYKQSEKTLQLLGYLRFGTVTPETGVNVTIDGGANEKENCTLTLKDLKVSSSGVYFCAAS
Maylandia zebra Vs55 trbv AGTA02003747.1 10396 GSSFSDQVHQTPPNIYTKEDAKIYCSHSISGYYTILWYKQSEKQLQFLGYMLNDKGNPETGVNVTMDGDARQHKNCTLTIKDVKVSSSGVYFCAAR
Maylandia zebra Vs52 trbv AGTA02003747.1 6244 GSSVHQTPADIYTKGEDVKINCSQSIQNYDTILWYKQSAKLLQFLGYMYLNNYNPEPGVNVSMDGNADKGKNGTLIIKELKLSSSGVYFCAAY
Maylandia zebra Vs53 trbv AGTA02003747.1 7908 GSSSSDKVDQTPANIHTKEKEVKIHCSHSIQNYDTILWYKQSEKQLRLLGYLRYGTSTPETGVNVTIDGSAEKEENCTLTLKDLKVSSSGVYFCAAS
Maylandia zebra Vs50 trbv AGTA02003747.1 2100 SSVSHQVDQTPANIYTTGEEAKINCSHSIQSYNTILWYKQSEETLQLLGFLFLGKGTIEPGVNVTIDGGANVKENCTLTIKDIELSSSGVYFCAAS
Maylandia zebra Vs51 trbv AGTA02003747.1 5114 SSVSDQVNQTPFNVYAEEEEVKMHCSHSIQSYDTILWYKQSEKQLQLLGYMRYDKGYPEAGVNVTMDGDARQHKNCILTIKYLKVSSSGVYFCAAY
Maylandia zebra Vs341 ighv AGTA02027364.1 2407 WTITESEPAVKGPGESHRLTCTTSGFSFSSEVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVQGRFTISRDDSSSKVYLHMNNLKTEDTAVYYCARR
Maylandia zebra Vs340 ighv AGTA02027364.1 12185 LNCQTLTQSGPVDKRPGESHKLTCTTSGFTFSTYSMDWIRQAPGKGLEWIADITSGGTTYYSQSAQGHFIISRDNNRQQVYLQMNNLKTEDSAVYYCARY
Maylandia zebra Vs223 trgv AGTA02064717.1 3902 LVTMAAEQLIQDDLTLTRRVGENVSFSCGGTEQCGAYILWYQKKDREPLRFIFDINKNNGDIDRSYSSHPQLDDFSSVNINKGWMLEIKQVKSDHSATYYCYCRY
Maylandia zebra Vs342 ighv AGTA02027366.1 3298 VYSIDHIQPSSLVVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYSGDPYQNYALNNKFSISRDTSAQTVTITGQHLQPEDTAVYYCARY
Maylandia zebra Vs345 ighv AGTA02027375.1 3998 VDGQTLTESESVIKRPGESHTLTCTASGFTFSSYWMAWVRQAPGKGLEWIASNYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra Vs344 ighv AGTA02027374.1 826 VYGIDLIQPDSVIVQPGQSLTITCRVSGYSLTSSSYATSWIRQRDGKQMDWIFTMWYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCAR
Maylandia zebra Vs58 trbv AGTA02003749.1 951 GSSSSDKVDQTPANIHTKEKEVKIYCSHRIQDYNQILWYKQSKKELQLLGYLRYGTSTPETGVNVKIDGGAEKEENCTLMIKDLKVSSSGVYFCAAS
Maylandia zebra Vs59 trbv AGTA02003749.1 2311 GSSFSDQVHQTPSNIYTKEDAKIYCSHSISGYNRILWYKQSEEQLQFLGYMLNDKGNPEPGVNLTMDGGANQNENCTLTIKDVKVSSSGIYFCAA
Maylandia zebra Vs420 trav AGTA02051937.1 15804 AAQLSDVSQPESLKTVKIGDSATIKCFIKSASKKTVWYKVTTGRKLQLVVKTNSQYNVREFSDEFVNRSSVKFDMTNNHLTINKTSWEDVGTYFCGV
Maylandia zebra Vs421 trav AGTA02051938.1 8952 AAQLSDVSQPESLKTVKIGDSATIKCFIKSASKKTVWYKVTTGRKLQLVVKTNSQYNVREFSDEFVNRSSVKFDMTNNHLTINKTSWEDVGTYFCGV
Maylandia zebra Vs422 igkv AGTA02051942.1 24299 SGSNIPTLVQQSASETIQPGGSVTLNCTVHTGTCDEEHSVYWFRDSEDSFPRIIYTHGGRNDQCERKPNTQTHTCVYNLPMKSLPHAGTYYCAVASC
Maylandia zebra Vs423 igkv AGTA02051946.1 1873 SNIPTLVQQSASETIQPGGSVTLNCTVHTGTCDEEHSVYWFRDSEESFPRIIYTHGGRNDQCERKANTQTHTCVYNLPMKSLNTAHAGTYYCAIASC
Maylandia zebra Vs424 igkv AGTA02051947.1 7851 SELDIPTLVQQSASETIQPGGSVTLNCTVHTGTCDEEHSVYWFRDSEESFPRIIYTHGGRNDQCERKLNTQTHTCVYNLPMKSLNTAHAGTYYCAVASC
Maylandia zebra Vs425 igkv AGTA02051947.1 2670 SGSNIPTLVQQSVSETIQPGGSVTLNCTVHTGTCDEEHSVYWFRDSEASFPRIIYTHGGRNDQCDRKPNTQTHTCVYNLPMQSLNTTHAGTYYCAVASC
Maylandia zebra Vs426 igkv AGTA02051948.1 462 SDLNIKAVVQQSASETIQPGSSVTLNCTVYTGTCDGEHSVYWFKDSEESHPGLIYTHGGRNDQCGRKANRRTHTCVSNLTITSLNVSHAGIYYCAFDSC
Maylandia zebra Vs427 igkv AGTA02051952.1 6096 LNVQALVHQSASETIQPGGSVSLHCMVHTMLSCDGEHSVYWFKDSEDSQPGLIYTHGVRNDQCGRKGKKRTHTCVYNLRMESLNVSHAGIYYCAVVSC
Maylandia zebra Vs428 igkv AGTA02051954.1 16190 SQMFSSVHQESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGQKPKIISHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVYYL
Maylandia zebra Vs429 igkv AGTA02051954.1 15838 SGVNIKAVVQQSASETIQPGGSVTLNCTVHTGTCDGEHSVYWFKDSGESHPGLIYTHLGRNDQCDNKPSTQTHTCVYSLPMSNLSVSHAGTYYCAVTSC
Maylandia zebra Vs502 ighv AGTA02058619.1 1290 TEGQTLTESGPVVKRPGDSHRLTCTYSGFSGNIYAVWIRQAAGKGLEWIARISDDSNYISYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Maylandia zebra Vs501 ighv AGTA02058618.1 380 VQCEQLTQPAYVTKQPGQRLSISCQVSYSVGGYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNGQNMQPEDTAVYYCAREP
Maylandia zebra Vs500 ighv AGTA02058618.1 2392 VDGQTLTESEPAVKKPGESHRLTCTTSGFTFSSYAMDWVRQAPGKGLEWIAFIHTGSSEIYYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARD
Maylandia zebra Vs507 ighv AGTA02058626.1 1190 TESQTLTESESVVKRPGDSHRLTCTYSGFGGDIHAAWIRQAAGKGQEWIAWIYYDGSDSHYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Maylandia zebra Vs506 ighv AGTA02058624.1 327 TEGQTLTESESVVKRPGDSHTLTCTYSGLGGDIAAAWVRQAAGKRLEWIALIYGDSITFNSQSFRGRFSISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Maylandia zebra Vs505 ighv AGTA02058624.1 1559 NISLGTEGQTLTESEPVVKRPGDSHRLTCTYSGFSGDIYAVWIRQAAGKGLEWIAYVSSGSSSIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs504 ighv AGTA02058620.1 2154 VDGQTLTESEPAVKRPGDSHRLTCTASGFSFSSFEMNWVRQAPGKGLEWVAYINSGGSTKHYSQSVQGRFTISRDNSREQLYLQMNSLRTEDSAVYYCVRE
Maylandia zebra Vs509 ighv AGTA02058631.1 1010 VKCAQLTQPASVIVQPGQRLTITCQVSYSLSGTWTAWIRQPAGKGLEWIGMKYTGDSHYKDSLKSKFSIQLDTSSKTVTLNGQNMQPEDTAVYYCARE
Maylandia zebra Vs508 ighv AGTA02058630.1 3576 TEGQTLTESESVIKRPGDSHRLICTYSGFSSDIYAAWVRQAAGKRPEWIAYIEDDSSYIHYSQSVRGRFTISRDNSRKQVYLQMNSLATEDSAVYYCARE
Maylandia zebra Vs487 ighv AGTA02058610.1 2350 VVGQTLIESEPAVKRPGEFHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFIHTYSTHIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARR
Maylandia zebra Vs498 ighv AGTA02058616.1 3549 IDGQTLTQSEPVVKKPGESHRLTCTTSGLSFSSWWMAGIRQAPGKGLEWIATEANGGSNYYCQSVRGRFTASRDNSREQLFLQMNNLKTEDSAVYYCARD
Maylandia zebra Vs457 ighv AGTA02058593.1 652 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGPEWISFIETSTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Maylandia zebra Vs37 trbv AGTA02003741.1 10411 CALSSLVIQQTPLNLLIKPEQQQAQIECYHGESGYTYMYWYQHKSAAGGQRTMALIGRLEYGAPTLEKTFKSKFNITGHATAKAQLEISNVNPADTAQYFCAAS
Maylandia zebra Vs22 trbv AGTA02003736.1 5072 VCLGVEVRQTPSEFITNVGSKVEIFCSHEKTDYRMMLWYQQPPGETAMKLIGYLYYKDDKYEEQYKDHFNITGDLSVNTVKKGYLIVQVAQQEHSAAYYCAASK
Maylandia zebra Vs524 ighv AGTA02058649.1 2847 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKGLEWVAYIEDDSSNIYYSQSVRGRFTISRDNNRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra Vs18 trbv AGTA02003733.1 821 QSQDAFQQPEIRWSYVNKAAHMNCSHNKDKGHLQMYWYIQRPGETMRLIVYTVFGGKPDYGGAPEIKYSASRKTIENGALTVNDLQQNDTGVYFCT
Maylandia zebra Vs555 ighv AGTA02066757.1 6923 VDGQTLTESEPAVKRPEESHRLTCTTSGFNFGDYWMHWIRQTPGKGLEWIAGISYWAGSTINYSQSVRGRFTISRDNNKRQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra Vs554 ighv AGTA02066750.1 1143 VYSIDLIQPDSRSVQPGQSFSITCQVSGYSMADSSYGTGWIRQHEGKAMDWISHQWGGGTLRQNGDLKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Maylandia zebra Vs331 ighv AGTA02027355.1 558 VYSIDLIQPESRSVQPGQSLTITCQVSGYSITDSSYATGWIRQREGKAMDWISHQWGGGTLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRR
Maylandia zebra Vs84 trbv AGTA02003752.1 10164 FSRGVKIDQPQFISSSKGSAFVTLKCEQDDRQHYYMYWYKQSSSGKLELVAYSTGQDNSFIEAPFEKMKYTMSRRSVLNSTLQLHLVEPEDTALYYCASSK
Maylandia zebra Vs62 trbv AGTA02003750.1 5767 GSPANDQVDQTPANIYTKGEDAKIHCSHSIQSYYQILWYKQSKKQLQLLGYMNYDRSNPEPGVNVTMDGGAEKDQNCTLTIKDIKASSSGVYFCAAS
Maylandia zebra Vs430 igkv AGTA02051954.1 8401 SGLNIKALVQQSASETIQPGGSVTLNCAVHTGTCDEDHSVYWFKDSGDFYPGLLYTHGGRNDQCEKNKQTYNCTYNLPMESINVSHAGTYYCAVASC
Maylandia zebra Vs523 ighv AGTA02058647.1 1386 TEGQTLTESESVIKRPGESHRLTCTYSGFSSDIHAAWVRQAAGKGLEWIAFIQSDSSYIFYSQSFRGRFTISRDNSRKQLYLQMNSLTTEDSAVYYCAKE
Maylandia zebra Vs503 ighv AGTA02058620.1 4439 TEGQTLTESESVIKRPGDSHRLTCTYSGFSSNHWNAWIRQAAGKGLEWISAISDSSTYIYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra V15 trav AGTA03000277.1 799291 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETTRTGPTLFWYKQEVNGYPQYMLHCLSTSTFKAEEFNVDRFDSKIIETSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V14 iglv AGTA03000130.1 1534032 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVINTVYWYKQIPGGVPQFVLYFYHSDSSPSYGSGFSSPKFTSTHQSTKDYRLIIKNVEERDSAVYYCKTWDSSAV
Maylandia zebra V13 iglv AGTA03000130.1 1528137 VSGVTVMTQKPPVLSVRKGETATMDCNLGTVTGSAAYWYKQIPGGVPQYVLRFYHGWSSPNYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCKTWDSSAAV
Maylandia zebra V11 iglv AGTA03000130.1 1521784 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNAAAWHKQIPGGSPQYVLRMYHGWSSPDYGSGFSSPKFTSTHQSTTDYRLIIKSVQEGDSAVYYCQTWDSSADSGV
Maylandia zebra V10 igkv AGTA03000130.1 1510351 VSAVTVLTQKPPVLSARKGETATMDCNLGTVTDAARWYKQIPGGVPQYVLYFYYSNSGPTYGSGFSAPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCQTWDGSVREYV
Maylandia zebra V9 iglv AGTA03000130.1 1508986 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTNKVAAWHKQISGGAPQFVLRMYHGWSSPTYGSGFSSPKFTSTHQSRSDYRLIIKNVEEGDSAVYYCQTWDSSASSGV
Maylandia zebra V8 iglv AGTA03000130.1 1464842 VSGVTVVTQKPPVLSVRKGQTATMDCNLGTVTNEPAWWYKQIPGGVPQYVVRFRHDWSSQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEEDSAVYYCKTW
Maylandia zebra V7 iglv AGTA03000130.1 1462515 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTNTVYWYKQIPGGVPQFVLYFYHSSSSPSYGSGFSAPKFTSTHQSTKDYRLIINNVEEGDSAVYYCKTWDSNNAV
Maylandia zebra V6 iglv AGTA03000130.1 1445397 VSGVTVVTQKPVLSVRKGETATMDCNLGTSTDGARWYKQIPGGVPQFVLNFYHGWSSPKYGSGFSSPKFTSTYQSRSDFRLIISSANEGDSAVYYCHTWDDSAK
Maylandia zebra V5 iglv AGTA03000130.1 1436813 VSGVTVVTQKPVVSVRKGETATMDCNLGTVTNSAARWYKQIPGGVPQFVLYFYHSNSSPRYGSGFSSPKFTSTHQSRSDYRLIISNVEEGDSAVYYCQTWDGSVNEHV
Maylandia zebra V4 trbv AGTA03000130.1 1425296 IVLTQTPAVHTVSPGQEVVLNCNIERYDANYVSWYKQVPGTVPQYVLRFHHSSSSPSFGTGFSSDRFNSKSSSDIDYQFIIKRAETGDSAVYYCQTWDDSAS
Maylandia zebra V3 iglv AGTA03000130.1 1423646 VSGVTVVTQKPILSVRKGQTATIDCNLGTVTDSDAQWYKQTPGGVPQFVLYFYHGSSSPTYGSGFSAPKFTSTYQSTSDYRLIINNVEEGDSAVYYCQTWDSSVNEYA
Maylandia zebra V2 iglv AGTA03000130.1 1418037 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDSYVCWYKQIPGGVPQYVLDFHHSDSSPTYGSGFSAPKFTSTHQSTTDYRLIINNVEQGDSAVYYCKTYDGSVDEFV
Maylandia zebra V1 iglv AGTA03000130.1 1418037 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDSYVCWYKQIPGGVPQYVLDFHHSDSSPTYGSGFSAPKFTSTHQSTTDYRLIINNVEQGDSAVYYCKTYDGSVDEFV
Maylandia zebra V0 igkv AGTA03000054.1 1133422 CSGQVTVTQPPVLTFTPGSTVTLTCRTNPAVGGCGAGQCMFWYQQKSGQTPKLLIRHVSISHSGTPSRFSGSGSRSDFSMTISGVQAEDAAVYYCKSVHSGPV
Maylandia zebra V53 ighv AGTA03000364.1 374427 LKCEQLNQPASVIVQPGQSLTITCQVSYSGYWTAWIRQPAGKGLEWIGMALGSSTEYKDSLKSKFSISTDSSSKTVTLTGQNLQPDDTAVYYCARY
Maylandia zebra V52 trav AGTA03000364.1 372449 VWSEVKLEQSPSEVKGFGERVKMSCTLSSYTLTENDIHWIRPGRALEWIGYMSTGYNSPSYASSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYLCARQSTMM
Maylandia zebra V51 ighv AGTA03000364.1 369243 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGPEWISFIETSTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Maylandia zebra V50 ighv AGTA03000364.1 342041 VDGQILTESESVVKRPGESHRLTCTVSGFTFSSYGMSWVRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRDDSSSKVYLQMSSLKTEDTAVYYCARR
Maylandia zebra V49 ighv AGTA03000364.1 340382 VNSETLTQPASMIVQPGEHLTITCQVSYSLGSYPTAWIRQPAGKGLEWIGRAGDGWTTYYKDSLKNKFSISFESSSKTVTLRGTNVQPEDTAVYYCARE
Maylandia zebra V48 ighv AGTA03000364.1 333087 VKGQTLTESEPAVKQPGESHRLTCTTSGFTLSSNWIHWIRQAPGKGLEWIAADANSATNYYSQSVRGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra V47 ighv AGTA03000364.1 326692 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIARISNGGSSIYYSQPVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V46 ighv AGTA03000364.1 283179 VDGQTLTQSEPHLIKRPGASHRLTCTASGFTFTDYEMVWVRQAPGKGPEWIAFISISTHSYATSYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Maylandia zebra V45 ighv AGTA03000364.1 267093 VNSETLTQPASMIVQPGEHLTITCQVSYSLGSYPTAWIRQPAGKALEWIGRAGDGWTTYYKDSLKNKFSISFESSSKTVTLRGTNVQPEDTAVYYCARE
Maylandia zebra V44 ighv AGTA03000364.1 248737 HAQTLTQSEPVVKKPGESHRLTCTTSGLSFSSNWMAWIRQAPGKGLEWIATDTNGGSNYYSQSVQGRFTASRDNSREQLYLQMNSLKTEDSAVYYCA
Maylandia zebra V43 ighv AGTA03000364.1 241061 VKCEQLTQSGPLTLQPGQRLTISCQVTYSISTYWTAWIRQPAGKGLEWVGGSGVGHSTLYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARK
Maylandia zebra V42 ighv AGTA03000364.1 188252 VDGQTLIESKPVIKRPGVSHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFVHTRSSHFFYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARQ
Maylandia zebra V41 trav AGTA03000364.1 178280 VKCEQLTHPASVTVHPGDRLTITCQTSYSLSSARTFWIRQPAGKELECIGSVHVGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Maylandia zebra V40 ighv AGTA03000364.1 171357 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAAFGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQLEESAVYYCARDSQ
Maylandia zebra V39 ighv AGTA03000364.1 166496 QTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISGSSSSIYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Maylandia zebra V38 ighv AGTA03000364.1 160843 VQCEQLTQKASETVQPGQRLTITCQVSYSVTGRWTAWIRQPAGKGLEWIGSRVGATLAYKDSLKNKFSISLDSSSNTVTLTGQNMQPEDTAVYYCARD
Maylandia zebra V37 ighv AGTA03000364.1 156736 VKCEQLTQPASVTVQPGHRLTITCQISYSLSSYWTGWIRQPAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARD
Maylandia zebra V36 ighv AGTA03000364.1 153306 VQCEQLTQPAYVTKQPGQHLSISCQVSYSMGGYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNGQNMQPEDTAVYYCAREP
Maylandia zebra V35 ighv AGTA03000364.1 144652 VDGQTLTESEPAVKKPGESHRLTCTTSGFTFSSYAMDWVRQAPGKGLEWIAFIHTGSSEIYYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARD
Maylandia zebra V34 ighv AGTA03000364.1 143071 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSTKYYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Maylandia zebra V33 ighv AGTA03000364.1 140263 VDGETLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGSTKHYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARD
Maylandia zebra V32 ighv AGTA03000364.1 135027 VDGQTLTESEPAVKRPGDSHRLTCTASGFSFSSFEMNWVRQAPGKGLEWVAYINSGGSTKHYSQSVQGRFTISRDNSREQLYLQMNSLRTEDSAVYYCVRE
Maylandia zebra V31 ighv AGTA03000364.1 122759 VKCAQLTQPASVIVQPGQHLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMKYTGDSRYKDSLKSKFSIDLDTSSNTVTLNQQNMQPEDSAVYYCAR
Maylandia zebra V30 ighv AGTA03000364.1 121874 QTLTESESVVKRPGDSHTLTCTYSGLGGDIAAAWVRQAAGKRLEWIALIYGDSITFNSQSFRGRFSISRDNSRKQVYLQMSSLTTEDSAVYYCAREPQ
Maylandia zebra V29 ighv AGTA03000364.1 109327 VKCEQLTQPEFVTVQPGQRLTITCQVSYSLSSWRTAWIRQPAGKGLEWIGGAHYGHNTYYKDSLKNKFTINLDTSSKTVTLNGQNMQPGDTAVYYCARG
Maylandia zebra V28 ighv AGTA03000364.1 69236 KKPGETLSLSCRGSGFTFSCCTMHWIRQKPGETLEWIGIGYSSSSSNRYVSSLSGRIEISRDDSNSMVHLSLSNLKPEDSAVYYCAKDTQWFK
Maylandia zebra V27 ighv AGTA03000364.1 59802 KKPGETLSLSCRGSGFTFSCCTMHWIRQKPGETLEWIGIGYSSSSSNRYVSSLSGRIEISRDDSNSMVHLSLSNLKPEDSAVYYCAKDTQWFK
Maylandia zebra V26 ighv AGTA03000364.1 55537 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGSWTAWIRQPAGKGLEWIGVKGTGSSYYEDSLKSKFSIDLDTSRKTVTLNGQNMQPEDSAVYYCARD
Maylandia zebra V25 ighv AGTA03000364.1 35396 KRPGETLSLSCRGSGFTFSCCTMHWIRQKSGESLEWMGEGYTDSSKNKYVSSLRGRIEITKDNSNSMVHLRLSNLKPEDSAVYYCAKDTQWFK
Maylandia zebra V24 ighv AGTA03000364.1 6610 KQPGETLSLSCRGSGFTFTCCGMSWIRQQPGKGLEWIGVGHRPSSSNSYASSLRGRVEIRRDDSNSMVHLKLSNLKPEDSAVYYCARHTQWFK
Maylandia zebra V23 ighv AGTA03000364.1 1919 VKCEQLIQPPSVIVQPGQRLTITCQVSYSMGSYYTAWIRQPAGKGLEWIGMKSIWYSYYKESLKSKFSIDLDTSSKTVTLNGENMQPEDTAVYYCAR
Maylandia zebra V21 trav AGTA03000302.1 554805 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGSDTYFFWYKQKPNSHPDFLIAYYSKQTEKLKFIHDKEKQEFHLEISSAAVSDSAVYYCALQ
Maylandia zebra V20 trav AGTA03000302.1 523192 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGSVYSLFWYHQKSGSHPQLVMAEHSEQTEKLKFIHDKEKQEFHLEISSAAVTDSAVYYCALQ
Maylandia zebra V19 trav AGTA03000302.1 522202 CKGEDKVIQEQGDVIAAEGDTVTLDCKYETSDSSPYLFWYKQEVNSYPNYMLHCLSTSTVKAEEFNNDRFDAKINKAEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V18 trav AGTA03000302.1 472956 DKVIQEQGDVIAAEGDTVTLYCKYETTSAYAYLFWYKQDVNDYPKYVLRRDASGTENAQEFPKDRFDAELNKTSVSLKIQKLQLSDSAVYYCALQ
Maylandia zebra V17 trav AGTA03000302.1 464458 DKVIQEQGDVIAAEGDTVTLGCTFASQTTPTLFWYKQEVNAYPKYILRKFLSGATDKAPEFQEDRFDAEINQTSVPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V16 trav AGTA03000302.1 464458 DKVIQEQGDVIAAEGDTVTLGCTFASQTTPTLFWYKQEVNAYPKYILRKFLSGATDKAPEFQEDRFDAEINQTSVPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V92 trgv AGTA03000736.1 2442 QLIQDDLTLTRRVGESVSFSCGGTEQCGDSYRYWYQKKEKETFRIILYSYKSGGNYRVSKPYNHPQQDDFIVENEENSCELKIEKVKRDHSATYYCSCVKYD
Maylandia zebra V91 igkv AGTA03000698.1 17076 SSAEIVLTQTPKAQSVAPGQTVSVRCKASSGMGSYLHWYLQKPSEAPKLLVYYATNRQSGVSDRFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Maylandia zebra V90 igkv AGTA03000698.1 7316 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVFGSNYLAWYQQKDGGVPKLLIKYASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLGEFYANSQYS
Maylandia zebra V89 igkv AGTA03000698.1 2497 SSGDVILTQTPEVQSVVPGQTVSVRCKASSSMGSYLHWYLQKPSEAPKLLVYHATNRHSGVSDRFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Maylandia zebra V88 igkv AGTA03000698.1 1277 LSGEKVLTQTPKAQSVVLGQTVSVRCKASSSVSNNLHWYLQKDGESPKLLIYHATNRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Maylandia zebra V87 ighv AGTA03000591.1 97030 VDGQTLTESESVIKRPGESHTLTCTASGFTFSNYWMHWVRQAPGKGLEWIASNYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V86 ighv AGTA03000591.1 91725 YFCPHRCVQFDLVQPDSMVIQPGQSLTITCQVSGYSLTSYGTAWIRQHEGKQLEWILIIWGGGSINKNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARR
Maylandia zebra V85 ighv AGTA03000591.1 86533 VYCIDLNQPDSRVVQPGQSMTITCRVSGYSVTDGYGTCWIRQREGKQMDWIFCIWSDGSSSKNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Maylandia zebra V84 ighv AGTA03000591.1 83324 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDSSYGTCWVRQSDGKQMDWINCMWYDGSTANNNALKNKFSVSRDTSARTVTIRGQNLQPEDTAVYYCAR
Maylandia zebra V83 ighv AGTA03000591.1 60014 VWSEVKLEQSPSEVKGFGERVKMSCALSGYTLTENDIHWIRQRPGRALEWIGYMSTGYNSPSYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYFCARQ
Maylandia zebra V82 trbv AGTA03000591.1 53648 VWSEVKLEQSPSEVKGFGERVKMSCALSGYTLTENDIHWIRQRPGRALEWIGYMSTGYNSPSYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYFCT
Maylandia zebra V81 trav AGTA03000591.1 47304 VWIEVKLEQSPSEVKGFGETVEMSCTLSGYNNDIHWIRQRPGRALEWIGYMSTGYNSPSYASSFQHHFIMTEEDSSRRQYLDINSLTAEDSAVYSCARQ
Maylandia zebra V80 ighv AGTA03000591.1 24919 VDGQTLTQSEPDLLKRPGESHRLTCTASEFTFRSSCMVWVKQATGKGPEWIAFIHTSSFRYSTYYSQSVQGRFTISRNDSSSKLYLQMDSLKTQDTAVYYCARE
Maylandia zebra V78 ighv AGTA03000591.1 118 VWSEIKLEQSPSEVKRPGERVKMSCIISGYTLTEYYLHWIRQRPGRALEWIGRMDTGKNSAIYGSTFQSRFVMTEEDSSSRQYLEIKSLTAEDSAVYFCARE
Maylandia zebra V77 igkv AGTA03000549.1 98485 SSGEQVLTQTPTAQSVVLGQTVSVRCKASSSVSSCLHWYLQKDGESPKLLIYLATSRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Maylandia zebra V76 igkv AGTA03000549.1 72742 QITVTQPGAVSSAVGGSVSIKCTTSQNVYYVSVHELHWYQQKDGETFKLLIYLANNRASGIPARFTGSGSYSDFTLTISGVQAEDAAVYYCQGTHMINSQRV
Maylandia zebra V75 igkv AGTA03000549.1 61377 SRGQITVTQPGAVSSAVGGTVSINCKTSQRVDDGEDQFWYQHRDGERPKLLTSYGNHKVSGIPDRFTSSGSNSDFTLTISGVQAEDAAVYYCLGEFNVNSQYS
Maylandia zebra V74 igkv AGTA03000549.1 58701 SRGQITVTQPGAVSSAVGATVSIKCRTSQNVYSSNRLAWYQQKDGGVPKLLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V73 igkv AGTA03000549.1 51091 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVYSKYYLHWYQQKDGGVPKLLIYVASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V72 igkv AGTA03000549.1 46499 SRGQITVTQPGAVSSAVGGTVSIICRTSQDVYVDGSYHRLAWYQQRNVGPPKLLISSASYKKSECPARFTGSGSNSDFILTISGVQAEDAAVYYCQSYHVINSKDV
Maylandia zebra V71 igkv AGTA03000549.1 6489 SRGQITVTQPGAVSSAVGGSVSIKCTTSQDVNNNNYMFWYQQKDGGIPKLLITYVSTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V70 ighv AGTA03000538.1 251055 KKPGETFSLSCRGSGFTFTCCTMNWVRQQPGKALEWIGEGWSDSSSNSYASSLRGRIEVSRDDSNSLTYLRLSNLKPEDSAVYYCARHTVV
Maylandia zebra V69 ighv AGTA03000538.1 243023 VTGQSLESVPSSPVMKRPGETLSLSCKGSGSDFTCCGMSWIRQQPGKGLEWIGVGHRPSSNNRYANSLIGRIEVSRDDSNYIVYLSLSNLKPEDSAVYYCARD
Maylandia zebra V68 ighv AGTA03000518.1 76064 QTITESEPAVKRPGESHRLTCTTSGFNFGSSVWSWIRQAPGKGLEWIAYIDTASTPIYYSQSVRGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCAKG
Maylandia zebra V67 ighv AGTA03000518.1 72145 SRILQPGQPLTITCQVSGYSLTDGSYGTCWVRQRQRQQMDWINCMWASGNTANNDALKNKFSVSRDTSAQTVTIRGQNLQPEDTAVYYCAR
Maylandia zebra V66 ighv AGTA03000518.1 49681 VKCEQLTQPASMLVQPGQHLTITCQVSYSLSSYYTAWIRQPAGKALEWMSDDETVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARRR
Maylandia zebra V65 ighv AGTA03000518.1 32820 VYSIDLIQPDARSVQPGQSLTITCQVSGYSMTDNSYATGWIRQREGKAMDWIFHQWGGGGFYKNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRY
Maylandia zebra V64 igkv AGTA03000507.1 11385 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVYSSNCLAWYQQKDGGVPKLLIKYASSRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V63 igkv AGTA03000465.1 543038 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVSGSSHLLAWYQQKDGGVPKLLIYHASIRESGIPARFTGSGSNSDFTLTISGIQAEDAAVYYCVG
Maylandia zebra V62 igkv AGTA03000465.1 538058 SRGQITVTQPGAVSSAVGATVSIKCTTSQNVYDSKRLAWYQQVDGNSPKRLIHSATTRDSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V61 trbv AGTA03000387.1 242824 FCCSVKIYQPPFTLSREGEKSATLQCEQDNDEYLYMFWYKHTDFRQMQLLTYSINKGIQTTEAPFNETKYFMSRPAVRNSSLHIKRVEPGDSAVYYCTSRL
Maylandia zebra V60 trav AGTA03000387.1 212909 CCVGIHQTPPALIKKPDDMVQLVCTHNLTEYRVMLWYQQPAGQTDMKCIGYINYRDVTVEETYKQNFEISGDLSTSDIKNVSLIIQLTGAQDSAVYYCAARF
Maylandia zebra V59 trbv AGTA03000387.1 202485 VSLSDQVHQTPADMCKNPNETATLRCLHTISTYNRILWYKQSQGGQLQLLGYMWGSRPTLEANVSATLDGSADENKNCTLTIEKLQQDSNAVYFCAAS
Maylandia zebra V58 ighv AGTA03000364.1 400157 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYGMVWIRQAPGKGLEWIAYISSGSGSIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARR
Maylandia zebra V57 ighv AGTA03000364.1 398311 VDGQTLTQSEPVVKKPGDSHTLTCTGSGFTFSDYWMHWVRQAPGKGPEWVAGISETSRYIHYSQSVQGWFTISRDNSKQQVYLQMNRLKTEDSAVYYCARQ
Maylandia zebra V56 ighv AGTA03000364.1 396005 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSHYWMAWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSKPQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra V55 ighv AGTA03000364.1 388806 VKCEQLTQPASETVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKALEWMSQDTDVKDSLKNKFSVELDSSSDTVTLKGQNLQPEDTAVYYCARQ
Maylandia zebra V130 ighv AGTA03000104.1 3755235 VYSIDLIQPESRSVQPGQSLTITCQVSGYSITDSSYATGWIRQREGKAMDWISHQWGGGTLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRR
Maylandia zebra V129 ighv AGTA03000104.1 3757919 VDSQTITQSESVVKRPADSHRLTCTGSNIEFSSYWMGWIRQAPGKGLEWVAIIGYDSGGIFYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Maylandia zebra V128 ighv AGTA03000104.1 3764871 VCSQTLTESEPVVKRPEDSHKLTCTYAGISDDNADISWIRQTEGKGLEWVAHISAPSGSTKVYSTSVQNRFTISRDNNVDQVYLQMNRLIAEDSAVYYCARK
Maylandia zebra V127 ighv AGTA03000104.1 3765858 VCSQTLTESEPVVKRPGESHKLTCTYAGISDSSDMSWIRQAEGKGLEWVAYISGPSGSTKRYSTSVQNRFTISRDNNVDQVYLHMSSLTTEDSAVYYCART
Maylandia zebra V126 ighv AGTA03000104.1 3768102 VYSIDLLQPDSSIVQPGQTLTITCQVSGYSLTDNSYATGWVRQRERRPMDWIFHQWGGGDFYKNDALENKFSYSRDTSARTVTITGQNLQMEDTAVYYCVRR
Maylandia zebra V125 ighv AGTA03000104.1 3769879 ARCQSLTSSEPVVSRPEQSVTLSCRVQGLSLAYLHWIRQKPGKGLEWIGRIDGGTGTIFAQSLQGQFSITKDTSQNRVNLVVNSLKQEDSAVYYCAKE
Maylandia zebra V124 ighv AGTA03000104.1 3784144 VCSQTLTESEPVVKRPGDSHKLTCTYAGISDGDADISWIRQAEGKGLEWVAHISAPSGSNKYYSTSVQNRFTISRDNNVDQVYLHMSSLTTEDSAVYYCARK
Maylandia zebra V123 trav AGTA03000104.1 3789287 VDSQTITQSEPVAIRPGESHRLTCTGSNIDFSSYCMAWVRQAPEKGLEWVASIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V122 ighv AGTA03000104.1 3792199 LHSCSQTLTESEPVIKHPGDSHKLTCTYAGISDSDAAISWIRQAGGKGMQWVAYISAPGGSTKSYSTSAQNRFTISRDNNVDQVYLHMSSLTTEDSAIYYCART
Maylandia zebra V121 trav AGTA03000104.1 3793552 ACCQSLTSSEPVVSRPGQSVTLSCRVQGIALSWLHWIRQKPGKGLEWIGRIDDGTGTIFAQSLQGQFSITKDTSQNRVNLVVNSLKQEDSAVCYCAR
Maylandia zebra V120 ighv AGTA03000104.1 3798848 VDSQTITQSESVVKRPADSHRLTCTGSNIEFSSYWMAWIRQAPEKGLEWVASIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Maylandia zebra V119 ighv AGTA03000104.1 3800759 VYSIDLIQPESRMVQLGQSLTVTCQVSGYSLTDDSYVTGWIRQREGKAMDWISHQWGTSGLRQNDALKDKFSYSRDTSARTATITGQNMQTEDTAVYYCVRY
Maylandia zebra V118 ighv AGTA03000104.1 3804010 VWSDVKLQQSSSELKRPGEIVKMSCIVSGYTMTSGYFSWIRHRAGKALEWIGTMNSGSNSASYSSSFQSRFLMTEDVPSSTQYLEIKSLTAEDSAVYFCARQ
Maylandia zebra V117 ighv AGTA03000104.1 3811584 WTITESEPAVKGPGESHRLTCTTSGFSFSSEVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVQGRFTISRDDSSSKVYLHMNNLKTEDTAVYYCARR
Maylandia zebra V116 ighv AGTA03000104.1 3821356 LNCQTLTQSGPVDKRPGESHKLTCTTSGFTFSTYSMDWIRQAPGKGLEWIADITSGGTTYYSQSAQGHFIISRDNNRQQVYLQMNNLKTEDSAVYYCARY
Maylandia zebra V115 ighv AGTA03000104.1 3824881 VDGQTLTESEPVTKRPGESHRLTCAASGFTLSSYHMGWVRQAPGKGLEWIALIYTDSSGSFYSQSVQGRFTISRDNSKQQLYLQMNSLKPEDSAVYYCARN
Maylandia zebra V114 ighv AGTA03000104.1 3834028 VYSIDHIQPSSLVVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYSGDPYQNYALNNKFSISRDTSAQTVTITGQHLQPEDTAVYYCARYLTVIQ
Maylandia zebra V113 ighv AGTA03000104.1 3840739 VYSIDHIQPSLLVVQPGQALTITCRVSGYSLTDGGYGTGWIRQREDKPLEWIFYIWYSGGTYQDDALKNKFSISRDTSAQTLTITGQNLQPEDTAVYYCIC
Maylandia zebra V112 ighv AGTA03000104.1 3841934 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALAWVASHYNSANIHYSQSVQGRFTISRDNSKQQLYLQMNSLRTEDSAVYYCA
Maylandia zebra V111 ighv AGTA03000104.1 3852495 VDGQTLTQSELVVKRPGESHTLTCTASGFTFSSYGMSWVRQAPGKGLEWIAHIYTDGSRTFYSQSVQGHFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Maylandia zebra V110 ighv AGTA03000104.1 3856293 VDGQTLTESEPVVKRPGESHTLTCTASGFTFTNYYLVWVRQATGKGLEWLASHYNSANIYYSQSVRGRFTISRDNSKQQVYLQMNSLSTEDSAVYYCTRE
Maylandia zebra V109 ighv AGTA03000104.1 3861029 ADCQTLTESEPAVKRPGESHRLTCTTSGFNFGGYSMHWIRQAPGKGLEWIAYIQYNSAYIYYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARD
Maylandia zebra V108 ighv AGTA03000104.1 3863674 VYGIDLIQPDSVIVQPGQSLTITCRVSGYSLTSSSYATSWIRQRDGKQMDWIFTMWYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCAR
Maylandia zebra V107 ighv AGTA03000104.1 3869003 VDGQTLTESESVIKRPGESHTLTCTASGFTFSSYWMAWVRQAPGKGLEWIASNYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V106 ighv AGTA03000104.1 3871375 YFCPHRCVQFDLVQPDSMVIQPGQSLTITCQVSGYSLTSYGTAWIRQREGKQLEWILIIWGGGSINKNDALKNKFSVSRDTSAQTLTITGQNLQPEDTAVYYCARR
Maylandia zebra V105 igkv AGTA03000097.1 212843 ITGVTQDSLSNPVHPGDPVTLQCSVLSNSENRRCTEDHSVYWYRTKPDESHPSLIYIQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra V104 igkv AGTA03000097.1 212843 ITGVTQDSLSNPVHPGDPVTLQCSVLSNSENRRCTEDHSVYWYRTKPDESHPSLIYIQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra V103 igkv AGTA03000097.1 221042 ITGVTQDSLSNPVHPGDPVTLQCSVVSNSENRRCTEDHSVYWYRAKPDESHPSLIYIQGNNSYDCERSPEAASQQKCVYSFSRNVSSSDTGTYYCAV
Maylandia zebra V102 igkv AGTA03000054.1 1202440 CSGQVTVTQPPVVTFTPGNTVTLTCRTNPKVYTWTDGDSRVAWYQQKSGAAPKLVIYLGTKPTSEFSSRFSGRGDGVDAAMTISGVQAEDAAVYYCQSAHEINSAWV
Maylandia zebra V101 igkv AGTA03000054.1 1202440 CSGQVTVTQPPVVTFTPGNTVTLTCRTNPKVYTWTDGDSRVAWYQQKSGAAPKLVIYLGTKPTSEFSSRFSGRGDGVDAAMTISGVQAEDAAVYYCQSAHEINSAWV
Maylandia zebra V100 igkv AGTA03000054.1 1209000 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDNDLSWYLQKPGQPPKLLFYKISRRQSGTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYTGPE
Maylandia zebra V99 igkv AGTA03000054.1 1209000 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDNDLSWYLQKPGQPPKLLFYKISRRQSGTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYTGPE
Maylandia zebra V98 igkv AGTA03000054.1 1209000 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDNDLSWYLQKPGQPPKLLFYKISRRQSGTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYTGPE
Maylandia zebra V97 igkv AGTA03003388.1 775 SRGQITVTQPGAVSSAVGGTVSIKCTTSQNVYNNNYLAWYQQKDGGVPKRLIHSVNTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V96 ighv AGTA03003044.1 696 VNGQTLTESEPAVKQPGQSHRLTCTTSGLSFSSYYMTWIRQAPGKGLEWIASINTGGGSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V95 igkv AGTA03002976.1 2831 SRGQITVTQPGAVSSAVGATVSIKCRTSQNVYNNNHLAWYQQKDGGVPKLLIYVASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V94 ighv AGTA03001074.1 6222 VKCEQLTQPASVIVQPGQHLTITCQVSYSFSSYWTAWIRQPAGKGLEWIGVKSTGSSHYKDSLKSKFSIDLDTSSKTVTGNGQNIEPEDTAVYYCARESHYSFSQML
Maylandia zebra V169 trbv AGTA03000175.1 2182795 HSQDVIQYPEISWRFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAVS
Maylandia zebra V168 trbv AGTA03000175.1 2184783 SSLSDQVFQTPANMYKNQEQTAEINCVHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPEPGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Maylandia zebra V167 trbv AGTA03000175.1 2186572 VCLGIEVRQFPSGVITDVGSKVEILCSHEKTDYRVMLWYQQPPGETAMKLIGFLQYQVVTFDEDQYKDHFDINGNLGGNTAKNGSLIVKVTQKEHSAVYYCAARE
Maylandia zebra V166 trbv AGTA03000175.1 2196018 VCLSVKVGQTPSEFITNVGSRVEIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFQAFTFDQDQYKDHFDFTGDLSGDTAKNGSLIVKVTQHEHSAVYYCAARY
Maylandia zebra V165 trbv AGTA03000175.1 2197347 SSLSDQVFQTPADMYKNQGQRAEINCVHKITNYDRIFWYKQTENSQLQLLGYMVGTSPFLEPGVTVTIHGNANKDKTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra V164 trbv AGTA03000175.1 2198781 SSLSDRVHQDPADMYKNQGRAAEITCSHSIDSYDVILWYKQTENSQLQLLGYMYITNPFVEPGVTVTIAGNANKDKTCTLTIKDLFMNSSAVYFCAAR
Maylandia zebra V163 trbv AGTA03000175.1 2202698 SSLSDRVHQDPADMYKIQGQTAEITCSHSIDSYDVILWYKQTKNSQLQLLGYMLKTRDVIEPGWMVEIKGSADKDQTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra V162 trbv AGTA03000175.1 2203828 SSLSDQVFQTPADMYKNQGQRAEINCVHKITNYDRIFWYKQTENSQLQLLGYMLVTRDVLEPGWMVEIKGSANKDQTCTLIIKDLTLNSSAVYFCAAS
Maylandia zebra V161 trbv AGTA03000175.1 2205465 SSLSDRVHQDPADMYKIQGQTAEITCSHSIDSYDVILWYKQTKNSQLQLLGYMLKTRDVIEPGWMVEIKGSADKDQTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra V160 trbv AGTA03000175.1 2206595 SSLSDQVFQTPADMYKNQGQRAEINCVHKITNYDRIFWYKQTENSQLQLLGYMLVTRDVLEPGWMVEIKGSANKDQTCTLIIKDLTLNSSAVYFCAAS
Maylandia zebra V159 trbv AGTA03000175.1 2208028 SSLSDRVHQDPADMYKNQGRAAEITCSHSIDSYDVILWYKQTENSQLQLLGYMYITNPFVEPGVTVTIAGNANKDKTCTLTIKDLFMNSSAVYFCAAR
Maylandia zebra V158 trbv AGTA03000175.1 2213632 SSFSDRVHQDPADMYEIQGQTAEITCSHSIDSYNVILWYKQTENNQLQLLGHVYSTNPSVEPGVTVTIAGNANKDKTCTLTIKDLFMNSSAVYFCAARYHSAT
Maylandia zebra V157 trbv AGTA03000175.1 2214936 VCLGVKVSQTPLEVFRRPGEKVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEESFKTHFNISGDLSGDDAKNASLFIVDLKAPEHSAVYYCAASF
Maylandia zebra V155 trbv AGTA03000175.1 2217860 SSLSDRVHQNPADMYKEQGQTAQITCSHSIDSYNVILWYKQTNSQLQFLGYMLGTTQFPEPGVTVTMDGSADKDKTCTLTIKDFVMNNSAVYFCAARYHSAT
Maylandia zebra V154 trbv AGTA03000175.1 2219600 VCLGIEVRQSPSEFITKVGSKVEIFCSHEKTDYRVILWYQQQPGDTAMKLTGHLYFKDDKYEEQYKDHFNITGDLSGNTAKNVSLIVKVAQKEHSAVYYCAARQ
Maylandia zebra V153 trbv AGTA03000175.1 2221571 SSLSDQVYQNPADMYKEQGQRADITCSHSIDNYDRILWYKQIKGHLQYLGYIVGNLGSPETGANVTIIGNANKDQTCTLTIKDLTLNSSAVYFCAAR
Maylandia zebra V152 trbv AGTA03000175.1 2227749 VSSTYNVLQTPSIIKKVGQSVSSEIHCSHSVSSFNQILWYKQDKHRALKFLGYLNVNSPNPEDDVKGKISFNGDARKHSNLTISNVSVTDSAVYFCAA
Maylandia zebra V151 trbv AGTA03000175.1 2232100 VCLGIEVRQFPSGVITDVGSKVQIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFKAVTFEDQNNDNFSITGDLGGNTAKNGSLTVKVVQKEHSAVYYCAARE
Maylandia zebra V150 trbv AGTA03000175.1 2234304 LTDAKDVKQTPMLWEQQGNNATMDCSHTKDANYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVHDGTFTVKDLEPKDSGWYFCAVS
Maylandia zebra V149 trbv AGTA03000175.1 2235594 VSSTYTVQQTPPSIIKKVGQSVSSEIHCSHSVSSFNRILWYKQDKHRALKFLGYLNVNSPIPEDDVKGKISFNGDGRKHSNLTISNVSVTDSAVYFCAA
Maylandia zebra V148 trbv AGTA03000175.1 2237415 VCLGIEVRQFPSGVITDVGSKVQIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFKAVTFEDQNNDNFSITGDLGGNTAKNGSLTVKVVQKEHSAVYYCAARE
Maylandia zebra V147 trbv AGTA03000175.1 2240613 LSPSDRVHQEPADMYKTSEDIAKIQCLQSIDDNHNQILWYKQSNSQLQLLGYMVANRGLPETGFNVSIDGSANKDQTCTLTIKRLDFNSSAVYFCAASYHSAT
Maylandia zebra V146 trbv AGTA03000175.1 2246197 LTDAKDVTQTPMLWEQRGNNATMDCSHTKDAFYVQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVHDGTFTVKDLEPKDSGWYFCAVS
Maylandia zebra V145 trbv AGTA03000175.1 2247716 SIDAKDVTQTPMLWEQQGNNATMDCSHTKDASYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEAHDGTFTVKDLEPKDSGWYFCAVS
Maylandia zebra V144 trbv AGTA03000175.1 2248724 SSTYNVLQTPPSIIKKVGQSVSNEIHCSHNVSIFEWILWYKQDKHRAPQFLGYLNLNFPYPEEDVKGKIIFNGNGKEYSNLTISNVSVTDSAVYFCAAS
Maylandia zebra V143 trbv AGTA03000175.1 2249172 SIDAKDVTQTPMLWEQQGNNATMDCSHTKDASYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVHDGTFTVKDLEPKDSGWYFCAVS
Maylandia zebra V142 trbv AGTA03000175.1 2253177 ASDTKSLSQTPPSIIRRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFSDSAVYFCAAK
Maylandia zebra V141 trbv AGTA03000175.1 2256859 LTDGGEVKQTSILWKNQGDNVSIECSHTYGSSYYYMYWYRQLPGELMKQMVFTTQNSQPDFEPDFRDDKFSATKTDAHSGTLIVKNLVPGDQGLYFCAAS
Maylandia zebra V140 trbv AGTA03000175.1 2257920 ASDTKRANQTPPSIIKRIGESVESEIKCSHSIPGYQVILWYKQDEKGVLQFLGYLNLEFPNIEDDVKGKISFDGDGQKYSNLAISNVSVTDSAVYFCAAS
Maylandia zebra V139 trbv AGTA03000175.1 2259003 DGSDVTQNSMIWKKQDEYATINCNHTKDYTYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTVKDLEPKDKGLYFCAVS
Maylandia zebra V138 trbv AGTA03000175.1 2261259 RTYGSYINQASMLWKNQGEDATLNCSHVMTIEFYQMYWYRQLPGEPMKQMVYTIPNAEPDFEPDFRDEKFSVTKPDAHSGTLTVKNLVPGDQGLYFCAVS
Maylandia zebra V137 trbv AGTA03000175.1 2263257 DGSDVTQNSTIWKKQDEDATINCKHTKNENYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTIKNLEPTDKGLYFCAVS
Maylandia zebra V136 iglv AGTA03000130.1 1577418 VSGVTVLTQKPPVLSVRKGETATVDCNLGTVTGSNARWYKQIPGEVPQFVLRFYHSWGSPTYGSGFSAPKFTSTHQSTTDYRLIISKVEEGDSAVYYCK
Maylandia zebra V135 iglv AGTA03000130.1 1577418 VSGVTVLTQKPPVLSVRKGETATVDCNLGTVTGSNARWYKQIPGEVPQFVLRFYHSWGSPTYGSGFSAPKFTSTHQSTTDYRLIISKVEEGDSAVYYCK
Maylandia zebra V134 trav AGTA03000130.1 1589996 VDAAKVLTQTPPVHTVSPGDEVLLKCNVQRDEGYYVSWYKQVPGSTPQYILKFYHSHSSPSFGTGFSSDRFNSKASSNIDYQLIIKQAEAGDSAVYYC
Maylandia zebra V133 trav AGTA03000130.1 1589996 VDAAKVLTQTPPVHTVSPGDEVLLKCNVQRDEGYYVSWYKQVPGSTPQYILKFYHSHSSPSFGTGFSSDRFNSKASSNIDYQLIIKQAEAGDSAVYYC
Maylandia zebra V132 trgv AGTA03000126.1 2302582 LVTMAAELIQKDLTLTATPGKKVSFSCGTSQCSGNYVHWYQKKDGDKFRVILHINIRTGEVKSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCSCAQS
Maylandia zebra V208 trbv AGTA03000175.1 2065366 SSHTDKVQQTPAESFYTSEETVAKIKCVHHIQDYTRIFWYKQSKNNELQLLGYMNVDKEYPETGVNVTMTGRSTKGETCTLTIKGLNPNSSAVYFCVA
Maylandia zebra V207 trbv AGTA03000175.1 2066735 SSYSDKVYQTPADIYTNGEDAKISCSHNISSYNQILWYKQSKKQLELLGYMVLTGGNPEAGVNVVMEGSASQGKNCTLTIKETKLNSSGVYFCAASYHSS
Maylandia zebra V206 trbv AGTA03000175.1 2067501 SSLHNQVQQNPAEIYYRAEETAKISCSHSFQYYDKILWYKQSRNDQMQFLGYMNVNDGYPETDANVEISGSAIQGSTCTLTIKGLIVNSSAVYFCAA
Maylandia zebra V205 trbv AGTA03000175.1 2069325 SSLSDQVDQDPADIYTRGEDAKIYCSHSIPSYNQILWYKQLETQLQFLGYMYLNNDNPETGVNVMMNGSARTGEKCTLTIKDIKPSSSGVYFCAAS
Maylandia zebra V204 trbv AGTA03000175.1 2070654 SSSSDQVDQTPADIYTKGEDVKVYCSHSIQSYDEILWYKQSKKQLQYLGYMNIDKGYPETGVNLMIEGNANKGENCTLTIKDIKVSSSGVYFCAAR
Maylandia zebra V203 trbv AGTA03000175.1 2073690 SSLRDQVHQSPANIYTKGEEAKIYCWHSNPSYDTILWYKKSEKQLHLLGYTYYDNSYPEPGVNITMDGDARQHKNCTLTIKYVKLSSSGVYFCAAR
Maylandia zebra V202 trbv AGTA03000175.1 2075290 SSLSDQVDQTPADIYTKGEEAKIHCSHSNPNFYTILWYKQSEKQLQLLGYTNYDKSYPEPGVNMTMDGDARQHKNCTLTIKYLKLSSSGVYFCAARYHSA
Maylandia zebra V201 trbv AGTA03000175.1 2077162 GSPASEQVDQTPANIYTKGEDAKIHCSHSIQNYETILWYKQSEKQLQLLGYMNYDKSYPEAGVNVTMDGGAEKNQNCILTIKDIKASCSGVYFCASRYHSAA
Maylandia zebra V200 trbv AGTA03000175.1 2078841 SSLSDQVDQTPADIYTKGEDVEIHCSHSISSYETILWYKQTEKKLQLLGYMLNDRGYPETGVNVMMDGDARQHKNCILTIKDIKVSSSGVYFCAAR
Maylandia zebra V199 trbv AGTA03000175.1 2080922 GSPANDQVDQTPANIYTKGEDAKIHCSHSIQSYYQILWYKQSKKQLQLLGYMNYDRSNPEPGVNVTMDGGAEKDQNCTLTIKDIKASSSGVYFCAAS
Maylandia zebra V198 trbv AGTA03000175.1 2084865 SSDSDQVDQTPANIYTNGEEAKIHCSHSISSYNQILWYKQSEKQLLLLGYMYYDKSYPEPGVNVTIDGDARQHKNCTLTIKEFELSSSGVYFCAASYHSA
Maylandia zebra V197 trbv AGTA03000175.1 2088741 SSFSDQVHQTPSNIYTKEDAKIYCSHSISGYNRILWYKQSEEQLQFLGYMLNDKGNPEPGVNLTMDGGANQNENCTLTIKDVKVSSSGIYFCAA
Maylandia zebra V196 trbv AGTA03000175.1 2090095 SSSSDKVDQTPANIHTKEKEVKIYCSHRIQDYNQILWYKQSKKELQLLGYLRYGTSTPETGVNVKIDGGAEKEENCTLMIKDLKVSSSGVYFCAAS
Maylandia zebra V195 trbv AGTA03000175.1 2093022 SSFSDQVDQTPANIYTKGEEAKIHCSHSVQSFYQILWYQQSNKELQYLGYMYLGKSSVETGVNVTIDGGANKGENCTLTIKDLKLSSSGVYFCAAS
Maylandia zebra V194 trbv AGTA03000175.1 2096887 GSSFSDQVHQTPPNIYTKEDAKIYCSHSISGYYTILWYKQSEKQLQFLGYMLNDKGNPETGVNVTMDGDARQHKNCTLTIKDVKVSSSGVYFCAAR
Maylandia zebra V193 trbv AGTA03000175.1 2098182 GSSVQVDQTPTNIYTTGGDAKIYCSHSIPTYNQILWYKQSEKTLQLLGYLRFGTVTPETGVNVTIDGGANEKENCTLTLKDLKVSSSGVYFCAASYHSAE
Maylandia zebra V192 trbv AGTA03000175.1 2099372 SSSSDKVDQTPANIHTKEKEVKIHCSHSIQNYDTILWYKQSEKQLRLLGYLRYGTSTPETGVNVTIDGSAEKEENCTLTLKDLKVSSSGVYFCAAS
Maylandia zebra V191 trbv AGTA03000175.1 2101048 GSSVHQTPADIYTKGEDVKINCSQSIQNYDTILWYKQSAKLLQFLGYMYLNNYNPEPGVNVSMDGNADKGKNGTLIIKELKLSSSGVYFCAAY
Maylandia zebra V190 trbv AGTA03000175.1 2102154 SSVSDQVNQTPFNVYAEEEEVKMHCSHSIQSYDTILWYKQSEKQLQLLGYMRYDKGYPEAGVNVTMDGDARQHKNCILTIKYLKVSSSGVYFCAAYYHSAA
Maylandia zebra V189 trbv AGTA03000175.1 2105183 SSVSHQVDQTPANIYTTGEEAKINCSHSIQSYNTILWYKQSEETLQLLGFLFLGKGTIEPGVNVTIDGGANVKENCTLTIKDIELSSSGVYFCAAS
Maylandia zebra V188 trbv AGTA03000175.1 2106610 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYDTILWYKQSEETLQLLGYLRFGTGYPEPGVNVTIDGGANVKENCTLTITDLKVSSSGVYFCAAS
Maylandia zebra V186 trbv AGTA03000175.1 2114655 SSSSDKVDQTPTNIHTKGEEAKIYCSHSIQSYNTILWYKQSEETLQLLGHLRFGTGTPETGVNVTIDGGAEKEENCTLTIKDLNVSSSGVYFCAASYHSA
Maylandia zebra V185 trbv AGTA03000175.1 2115817 SSFSDKVDQTPANIYTKGEDAKIYCSHSITNYNRILWYKQSKTQLQLLGFLFLGKGTIEPGVNVTMDGGANEKENCTLTIKDIELSSSGVYFCAAS
Maylandia zebra V184 trbv AGTA03000175.1 2117386 VPKSGVHQTPAALIKAPGEEIQINCNHSNTKLDMIQWYKQSPGKNEMILLGYAQFTFTAVEDAFENIYKVTGEGSKLSTFHIPKLRESVDSAMYFCAASA
Maylandia zebra V183 trbv AGTA03000175.1 2118111 PSLCTRVQQVPSSILGSIHGETRISCNHSESTYNVILWYQKPRGDSALKLIGYILYGNPTIEDGFQESFKISGDGSVKSQLEVEKLKAEDSGSYYCAAS
Maylandia zebra V182 trbv AGTA03000175.1 2119605 LTGGSDVSQTPLLWSTEGQSVTMNCSHTKGVAYRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEEKFPATKTNEQTGSLTVEKLVPGDSGVYFCSVS
Maylandia zebra V181 trbv AGTA03000175.1 2139844 LTDGSDVSQTPLLWKSEGQSATMTCNHTKNHDYSQMYWYQQLPGQKIKQIVFTAPKTQHTYESGFSEEKFPATKSSYETGSLTVEKLVPGDSGVYFCAVS
Maylandia zebra V180 trbv AGTA03000175.1 2140732 HVDGSDVTQTPILWKYQGDSATMSCNHTKGDLYFQMYWYRQLPGETMKLIVFTTRGKKDDDQDFGEFSKEKFSVTKPTADKVSQCYQNLQPNDKGLYFCAVS
Maylandia zebra V179 trbv AGTA03000175.1 2159094 FSFSVKIKQDPFLNSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELKTYSLGEKVWDTEAPFDKSKYSMSRPSLLRSSLQIHSVAAGDSAVYYCVSRR
Maylandia zebra V178 trbv AGTA03000175.1 2161321 FSFSVKIKQDPFLNSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELKTYSLGEKVWDTEAPFDKSKYSMSRPSLLRSSLQIHSVAAGDSAVYYCVSRR
Maylandia zebra V177 trbv AGTA03000175.1 2165655 QASAVIFQQSPPQIVDKNQEIQINCKHDDSTRILMLWYQQRKENASMTLIGSGYYQQSQSFEGQFEKQFTLTRNSAVEGTLTIKNTDVSHSAVYFCAA
Maylandia zebra V176 trbv AGTA03000175.1 2166842 QASAVIFQQSPPQIVDKNQEVQINCKHDDSSLVIMFWYQQRKENTSMTLIGFGYYQQSQNYEGQFKEQFTLTRSSTVEGTLTIKKTDVSHSAVYFCAA
Maylandia zebra V175 trbv AGTA03000175.1 2168348 QASAVIFQQSPPQIVDKNQEIQINCKHNDSSLLIMLWYQQLKENTSMTLIGSGYYQQSQSYEGEFEKQFTVARSSTVEGTLTIKKTDVSHSAVYFCAA
Maylandia zebra V174 trbv AGTA03000175.1 2169205 VSESVLITQWPHYISNPSNGLAKMHCYQNDTDYQYLYWYKQPRGKSFQLIVATVAGTSQFEEGFKSGFQAEKNDKQWSLTITSIQEKDEAVYLCAAR
Maylandia zebra V173 trbv AGTA03000175.1 2175046 ISLGIEVRQSPSAVIKKVNDDVQLICTHDKSDYRVMLWYQRLPGETALKLVGYGYTQFKDDSAEEPFRENFKLEGDLNSNKKNGSLFINKLKAPEHTATYFCAASQ
Maylandia zebra V172 trbv AGTA03000175.1 2176535 VFLGLEVRQSSSDIIANVSSKVQIFCIHDKTDYYVMLWYQRPPGETAMKLIGYLYHKQVTMEDQYKSNFIISGDLTGSTAKNSSLIANAAQQGDSAVYYCAASK
Maylandia zebra V171 trgv AGTA03000175.1 2177643 VSLGIEVRQSSSDIVAKASDKVQIFCSHDKTDYRMMFWYQQSPGDTAMKLIGFLNYVAVTLEEQYRDLFSITGNLGGDSAKNGSLTIQVKGREHSAVYYCAASK
Maylandia zebra V247 trdv AGTA03000377.1 345470 LTAGDSITPQQPEVTETEGESVTLTCSYETGYSDIYLHWYRHYSELQAPLFAVKKGAKGFKNLYTSDNRYKSETSSTSTNLTIAALTLADTALYYCALQ
Maylandia zebra V246 trdv AGTA03000377.1 371890 LTAGDSITPQQPEVTKTEGESVKLTCSYETTSEYVRLYWYRHDSDLQAPQFILWKGAKDFSGYEYIPDNRYDSETSSSSTNLTIAALTLADTALYYCALQ
Maylandia zebra V245 trav AGTA03000377.1 372667 QKDNVLQAKGEETAAAGGTVTLGCQYESSGTNIYLFWYKQDGNNSPKFILSRVSGDQGNTADEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V244 trdv AGTA03000377.1 383408 LTAGDSITPQQPEVTETEGESVKLTCSYETDAGGALLYWYRHDSDLQAPQFILWKGARSWSDQYIPDNRYESKTSRTTTNLTIAALTLADTALYYCALQ
Maylandia zebra V243 trav AGTA03000377.1 384182 DKVIQEQGDVIAAEGDTVTLGCNFETSASYSYLFWYKQEVNDFPKYVLQRGTTGTADNAQEFPKDRFDAEVDKKENSAPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V242 trav AGTA03000377.1 397180 QKDNVLQAKGEETAAAGGTVTLHCLYNTSSLSNYYLYWYKQDGNNSPKFILSRDSGDQGNTADEFKERFSSTLDSSNRSAPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V241 trdv AGTA03000377.1 403580 LTAGDSITPQQPEVTKTEGESVKLTCSYETSDDTPWLYWYRHDSDLQAPQFILWKGAKDSTSEYIPNNRYGSQTSPTTTNLTIAALTLADTALYYCALQ
Maylandia zebra V240 trav AGTA03000377.1 404354 KVIQEQGDVIAAEGDTVTLGCNFETTDTYPYLFWYKQEVNDFPKYVLRRDKTAGDNAQEFPKNRFDAELKEKSVPLKIQKLQLSDSAVYYCAVK
Maylandia zebra V239 trdv AGTA03000377.1 420476 LTAGDSITPQQPEVTKTEGESVKLTCSYETTSEYVRLYWYRHHSDLQAPQFILYKGARSWSGNEYIPDNRYESKTSRTTTTLTIAALTLADTALYYCALE
Maylandia zebra V238 trav AGTA03000377.1 421125 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGSVLNLYWYHQKSGSHPQLLIDEHSEKIEKLKFRKDQDKSDFYLEISSAAVSDSAVYYCALQ
Maylandia zebra V237 trdv AGTA03000302.1 500637 LTAGDSITPQQPEVTETEGESVKLTCSYETTSEYVRLHWYRHDSDLQAPQFILWKEARSWSDEYIPDNRYESKTSRTTTNLTITALTLADTALYYCALE
Maylandia zebra V236 trav AGTA03000302.1 501491 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGYVQNLFWYHQKSGSHPQLVMAEHSEQTEKLKFIHDKEKQQFHLEISSAAVSDSAVYYCAVR
Maylandia zebra V235 trav AGTA03000302.1 501491 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGYVQNLFWYHQKSGSHPQLVMAEHSEQTEKLKFIHDKEKQQFHLEISSAAVSDSAVYYCAVR
Maylandia zebra V234 trdv AGTA03000302.1 620064 LTAGDSITPQQPEVTETEGESVKLTCSYETSESSLLLHWYRHDSDLQAPQFILWKGARSWSGNEYIPDNRYGSKTSRTTTNLTIAALTLADTALYYCALQ
Maylandia zebra V233 trav AGTA03000302.1 620841 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGSETYFFWYKQKPNSHPDFLIAYYSKQTEKLKFIHDKEKQEFHLEISSAAVSDSAVYYCALQ
Maylandia zebra V232 trav AGTA03000302.1 620841 SSEDLLTPSKDVVTSLEGGTVTLSCNYSGSETYFFWYKQKPNSHPDFLIAYYSKQTEKLKFIHDKEKQEFHLEISSAAVSDSAVYYCALQ
Maylandia zebra V231 trav AGTA03000288.1 1658 WISVSLAQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASRISFMPTANSRATFCDGFQDTKFNMTSNTSVLFLEIKQLDPSDSGLYFCGE
Maylandia zebra V230 trav AGTA03000288.1 1658 WISVSLAQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASRISFMPTANSRATFCDGFQDTKFNMTSNTSVLFLEIKQLDPSDSGLYFCGE
Maylandia zebra V229 trgv AGTA03000288.1 309149 QVNNQEFFSSGHQERRFISVRTGDSVTLHCYSKNGVTPRFYWYKQTLAEKPRLISTFYVYEQNATFHSEFKSDPRFTLDTQTGQNNLIISDVRISDSATYYCICSY
Maylandia zebra V228 igkv AGTA03000288.1 322189 SQMFSSVHQESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGQKPKIISHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVYYL
Maylandia zebra V227 igkv AGTA03000288.1 357597 SQIFSSEHQESRFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIISHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVQYS
Maylandia zebra V226 trav AGTA03000279.1 43746 VIQTTEVPQLISLTVVDLGDNVTFGCEVSEKKLKSLHWYKQSLGHLPQSVASVILDKITLSDAFKDSRFTLNKDIFTIRNVSKEDEATYFCQTRTTY
Maylandia zebra V225 trav AGTA03000279.1 43746 VIQTTEVPQLISLTVVDLGDNVTFGCEVSEKKLKSLHWYKQSLGHLPQSVASVILDKITLSDAFKDSRFTLNKDIFTIRNVSKEDEATYFCQTRTTY
Maylandia zebra V224 trav AGTA03000279.1 71833 VTQTSEVPQLISLTVVDLGDNVTFGCEVSEKELKSLHWYKQSLGHLPQSVASVILDKITSTDAFKDSRFTLNKEIFTIRNVSKEDEATYFCQMRTTY
Maylandia zebra V223 trav AGTA03000279.1 71833 VTQTSEVPQLISLTVVDLGDNVTFGCEVSEKELKSLHWYKQSLGHLPQSVASVILDKITSTDAFKDSRFTLNKEIFTIRNVSKEDEATYFCQMRTTY
Maylandia zebra V222 igkv AGTA03000245.1 1509062 QITVTQPGAVSSAVGATVNMDCKISHTVINSDSVEWYQHKQGEPPKLLIYWSNLRASSTSSRFTGSGSDKDFTLTISGVQAEDAAVYYCKG
Maylandia zebra V221 igkv AGTA03000245.1 1512451 SRGQYTVTQPGAVSSAVGGSVSINCTTSQDVTGNFLAWYQQKDGGVPKLLIYDADTLESGIPDRFTGSGSNSDFILTISGVQAEDAAVYYCQS
Maylandia zebra V220 igkv AGTA03000245.1 1528613 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVWSIYHYLAWYQQKDGDVPKLLIKRAHERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V219 igkv AGTA03000245.1 1537609 SSGEKVLTQTPTAQSVVPGQAVSIRCKASSSVSGCLNWYLQKDGESPKLLIYSATNRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Maylandia zebra V218 igkv AGTA03000223.1 358058 SAGQNVVVTQSASKSVQLGQTVNINCKVSTQVAQYSGSQYYLTWYHQKTGEAPKALIYRTSDRLSGISSRLSGSGAGNGLDFTLSISAVQADDAGVYYCQS
Maylandia zebra V217 igkv AGTA03000223.1 360520 SSGQIIVTQSPGAQSVVAGQSVSITCRTSTSVGDWLHWYLQKPGKAPKLLIYKATNRQSGVSDRFSGSGSGTDFTLSIRGVQAEDSGVYYCQQGSNL
Maylandia zebra V216 trbv AGTA03000175.1 2043896 FSRGVKIDQPQFIFSYEGTANVTLDCKQDDSDYYYMYWYRQSSSGKLELVTYSLSKDSWNIEAPFKNSQYTMSRPSLLESTLKIHLVGAGDTALYYCASSI
Maylandia zebra V215 trav AGTA03000175.1 2046492 KVESVTFEQSSAQVVNKGTEELRINCSHDGNSLQVMLWYQHKQSDQAMSLIGYTVLMGEPNYESQFTDRFQIKRDNTVKGSLIIKNVNLSDSAVYFCAA
Maylandia zebra V214 ighv AGTA03000175.1 2047601 FSRGVKIDQPQFISSSKGSAFVTLKCEQDDRQHYYMYWYKQSSSGKLELVAYSTGQDNSFIEAPFEKMKYTMSRRSVLNSTLQLHLVEPEDTALYYCASSK
Maylandia zebra V213 ighv AGTA03000175.1 2051558 FSRGVKIDQLQIIFSREGTKNVTLDCKQDDSQYYYMYWYRQSSSGKLELVTFSPGQNSWNIEAPFEKIKYTMSRPSVLESTLQIHPVEPEDTALYYCASRI
Maylandia zebra V212 trav AGTA03000175.1 2052750 LTVVVLQSEDQMSDPGRTVTLECKMGSGFSMSSYTMLWYRQNHHGAPVDYLLNEYDKTVGRLKSFLEASKNNFSLQITELHMNDSSTYYCAA
Maylandia zebra V211 trbv AGTA03000175.1 2054781 QVSAVTFQQSTPQIVAEKSEVQIDCSHNDGNLPVMLWYQHIKENQSMTLIGYGYQNTRQTFEGQFEEQFKLTRGSATTGTLTIPSAELSHSAVYFCAA
Maylandia zebra V210 trbv AGTA03000175.1 2060598 GISLGVQVRQSPSAAIRNAGDDVQLICTHEKTDYRVMLWYQQSPGDTALKLIGYVDYSTIKYEGDFEKYCNITGDLSGNTAKRGSLFIAGLKESEHSAVYYCAARY
Maylandia zebra V286 trav AGTA03000742.1 17539 VSCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEILTPPSSSRLSVGVRKEETKMTLQISSAAVSDSAVYYCAVR
Maylandia zebra V285 trdv AGTA03000742.1 35577 LTAGDSITPQQPEVTETEGESVKLTCSYETTGYPRLHWYRHHSDLQAPQFILWKDGQGYTGEYIPDNRYRSETSDRSTNLTIAALTLADTALYYCALQ
Maylandia zebra V284 ighv AGTA03000686.1 3344 VYSIDLIQPDSRSVQPGQSFSITCQVSGYSMADSSYGTGWIRQHEGKAMDWISHQWGGGTLRQNGDLKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Maylandia zebra V283 ighv AGTA03000686.1 5296 VNSQTITQSESVVKRPADSHRLTCTGSNIDFSSRWMAWIRQAPGKGLEWIAIIEYNSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTTVYYCARE
Maylandia zebra V282 ighv AGTA03000686.1 57139 VDGQTLTESEPAVKRPEESHRLTCTTSGFNFGDYWMHWIRQTPGKGLEWIAGISYWAGSTINYSQSVRGRFTISRDNNKRQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra V281 ighv AGTA03000686.1 61689 VVGQTLTQSESALKRPGESHRLTCTASGYNFGGYSLVWVRQASGKGLEWIAYIYYGGSTTSYSQSVQGRFTISKDNSRQQLYLQMNNLKTEDSTVYYCA
Maylandia zebra V280 ighv AGTA03000686.1 67422 RGVGISLLVKRPGESHTLTCAASGFTFTDYYLVWVRQATGKGLEWLASHYNSAYIHYFQSVRGRFTISRDNSKQQVYLQMNSQRTEDSAVYYCTRQ
Maylandia zebra V279 ighv AGTA03000518.1 5910 LDGQTLTESGPVVKRPGESHRLTCTASGFTFSSYSMDWIRQVPGKGLEWIAHIWGNGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra V278 ighv AGTA03000518.1 5910 LDGQTLTESGPVVKRPGESHRLTCTASGFTFSSYSMDWIRQVPGKGLEWIAHIWGNGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARD
Maylandia zebra V277 ighv AGTA03000518.1 56818 VKCEQLTQPASMLVQPGQHLTITCQVSYSLSSYYTAWIRQPAGKALEWMSDDETVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARRR
Maylandia zebra V276 ighv AGTA03000518.1 56818 VKCEQLTQPASMLVQPGQHLTITCQVSYSLSSYYTAWIRQPAGKALEWMSDDETVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARRR
Maylandia zebra V274 trgv AGTA03000509.1 10098 EQLIQDDLTLTRRVGESVSFSCGGINKCDYDPIFWYQKKEKETFRVILFIDKSSGYVYSGYDHPQKDDFSVVNTQNSCELKIEKVKLDHSATYYCSCWVSD
Maylandia zebra V273 igkv AGTA03000506.1 6503 SSGEQVLTQTPTAQSVVPGQTVSVRCKASSGVSNNLHWYLQKDGESPKLLIYYATSRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYC
Maylandia zebra V272 igkv AGTA03000506.1 6503 SSGEQVLTQTPTAQSVVPGQTVSVRCKASSGVSNNLHWYLQKDGESPKLLIYYATSRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYC
Maylandia zebra V271 igkv AGTA03000506.1 25026 SRGQITVTQPGAVSSAVGGTVSIKCRTSQRVDSGTAFWYQQKDGGVPKLLIYYASRRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V270 igkv AGTA03000506.1 29652 SSGEQVLTQTPGSQSVVPGQTVSVRCKSSSSVHSNLHWYLQKDGESPKLLIYYATNRQSGISDRFSGSGSGTDYTLTISRVQAEDAGVYYC
Maylandia zebra V269 igkv AGTA03000506.1 36622 QRTNTVTQPGAVSSAVGGTVSIKCTTSQRVDSGNRLAWYQQKDGGVPKLLIYYASTQQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V268 igkv AGTA03000506.1 103310 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVHASGSTHYLHWYQQKDGGVPKLLIYAASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V267 igkv AGTA03000506.1 152007 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHDNNLLAWYQQKDGGVPKLLIYYTSSRYSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHVINSQLC
Maylandia zebra V266 trav AGTA03000377.1 160833 DKVIQEQGDVIAAEGDTVTLDCRYETTRTGPTLFWYKQEVNSYPKYMLKSFSETTEKSEEFNDDRFDAELNKTSVSLKIQKLQLSDSAVYYCALQ
Maylandia zebra V265 trdv AGTA03000377.1 168483 LTAGDSITPQRDKVTATEGESVKLTCSYETTSSYPLLHWYRHHSDLQAPQFILWKGRRQQTGEYIPDKRYKSETSPTSTNLTIAALTLADTALYYCALQ
Maylandia zebra V264 trav AGTA03000377.1 178138 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V263 trav AGTA03000377.1 178138 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V262 trav AGTA03000377.1 178138 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V261 trav AGTA03000377.1 178138 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V260 trav AGTA03000377.1 189627 VSCDQLTAVKDEESTVEGNTLTLSCTYPQISPGNDFFWFQQYAGKPPEFLFYISGMNISRKSEFLKSAARFPTKLSGKNRLNLQISSAAVSDSAVYYCAVR
Maylandia zebra V259 trav AGTA03000377.1 189627 VSCDQLTAVKDEESTVEGNTLTLSCTYPQISPGNDFFWFQQYAGKPPEFLFYISGMNISRKSEFLKSAARFPTKLSGKNRLNLQISSAAVSDSAVYYCAVR
Maylandia zebra V258 trav AGTA03000377.1 201619 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V257 trav AGTA03000377.1 201619 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V256 trav AGTA03000377.1 205886 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V255 trav AGTA03000377.1 205886 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V254 trav AGTA03000377.1 205886 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V253 trav AGTA03000377.1 205886 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTEKSVPLKIQKLQLSDSAVYYCAVR
Maylandia zebra V252 trdv AGTA03000377.1 252177 LTAGDSITPQRDKVTATEGESVTLTCKYQTSESDVWLNWYRHDSDLQAPQFILYKGARSQSGNDYIPDNRYDSETSSTSTNLSIAALTLADTALYYCALQ
Maylandia zebra V251 trdv AGTA03000377.1 252177 LTAGDSITPQRDKVTATEGESVTLTCKYQTSESDVWLNWYRHDSDLQAPQFILYKGARSQSGNDYIPDNRYDSETSSTSTNLSIAALTLADTALYYCALQ
Maylandia zebra V250 trdv AGTA03000377.1 298679 LTAGDSITPQQPEVTETEGESVKLTCSYETSDDIVYLHWYRHDSDLQAPQFILWKGARLRGEYIPDKRYKTQTSPTSTNLTIAALTLADTALYYCALE
Maylandia zebra V249 trav AGTA03000377.1 299451 GNSLEDDITASSAEVFSSEGRTVTVSCNYSVQADNLQWYRQDPGSAPQFLLLITDTSEPSVLRATPPNPRLTAALDKERNRVNLEISSAAVSDSAVYYCALQ
Maylandia zebra V302 ighv AGTA03003098.1 643 VYSIDLIQPDSRMVQPGLSLTITCQVSGYSLTDDSYATGWIRQREGKAMDWIFHQWGAGGLRQNDALKDKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRY
Maylandia zebra V301 ighv AGTA03002878.1 459 IYGQTLTESEPVVKRPGDSHRLTCTASGFTFSSFWMGWIRQAPGKGLEWVATIRYDSGEIYHSQSVRGRLTISRDNSRQQLYLQMNSLTTEDSAVYYCARE
Maylandia zebra V300 ighv AGTA03002243.1 395 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGGSTKHYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCTRD
Maylandia zebra V299 iglv AGTA03001532.1 1734 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDSAARWYKQIPGGVPQYVLRFRHDWSSPTYGSGFSSPKFTSTHQSTSDYRLIISNVEEGDSAVYYCQTW
Maylandia zebra V298 trav AGTA03001492.1 536 SSEDLLTPSKDVVTSLEGDTVTLSCNYSAVVQTLFWYQQKSGSHPQLLMAEHSEETEKLKFIHEREKKEFHLEISSAAVSDSAVYYCALQ
Maylandia zebra V297 trdv AGTA03001492.1 4607 LTAGDSITPQQPEVTKTEGESVTLTCSYEISGTPDVYWYKHHSDLQAPQFILWKEARGSTTQYIPDKRYGSETSDRSTNLTIAALTLADTALYYCALE
Maylandia zebra V296 trdv AGTA03001492.1 4607 LTAGDSITPQQPEVTKTEGESVTLTCSYEISGTPDVYWYKHHSDLQAPQFILWKEARGSTTQYIPDKRYGSETSDRSTNLTIAALTLADTALYYCALE
Maylandia zebra V295 igkv AGTA03001188.1 14874 QRTDHSDSAWSSELCCGRICEHQVYDQSECLWQHRLAWYQQKDGGVPKLLIYRASSRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V294 ighv AGTA03000808.1 6605 VDGQILTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSSVYYCAR
Maylandia zebra V293 ighv AGTA03000808.1 12586 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALAWVASHYNSANIHYSQSVQGRFTISRDNSRQQLYLQMNSLRTDDSAVYYCA
Maylandia zebra V292 ighv AGTA03000808.1 21668 VKCEQLTQPASETVQPGHRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Maylandia zebra V291 ighv AGTA03000808.1 26213 VDGQTLTESDPAVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKGLEWIARISSSGGSTWYSQSVQGRFIISRDNSREQLYLQMNSLKTEDSAVYYCARE
Maylandia zebra V290 ighv AGTA03000808.1 30120 VKCEQLTQPASETVQPGHRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Maylandia zebra V289 ighv AGTA03000808.1 31692 LKCEQLNQPASVIVQPGQRLTITCQVSYSGYWTAWIRQPAGEGLEWIGMALGSSTEYKDSLKSKFSISTDSSSKTVTLTGQNMQPDDTAVYYCARY
Maylandia zebra V288 trav AGTA03000742.1 9870 DKVIQEQGDVIAAEGDTVTLGCRYETTRTGPTLFWYKQEVNGYPQYMLHCLSTSTFKAEEFNVDRFDSKIIETSVPLKIQKLQLSDSAVYYCALQ
Maylandia zebra V303 igkv AGTA03003471.1 3020 SRGQITVTQPGAVSSAVGGTVSIKCTTSQNVWSSNCLAWYQQKDGGVPKLLIYYASSRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V287 trdv AGTA03000742.1 16009 LTAGDSITPQQPEVTETEGESVKLTCSYETSASDAWLHWYRHDSDLQAPQFILWKRGKGGTYEYILDKRYNSETSDRSTNLTIAALTLADTALYYCALE
Maylandia zebra V275 trgv AGTA03000509.1 10098 EQLIQDDLTLTRRVGESVSFSCGGINKCDYDPIFWYQKKEKETFRVILFIDKSSGYVYSGYDHPQKDDFSVVNTQNSCELKIEKVKLDHSATYYCSCWVSD
Maylandia zebra V248 trdv AGTA03000377.1 333894 LTAGDSITPQQPEVTETEGESVKLTCSYETDAGGALLHWYRHHSDLQAPQFILWKQGKGGSAEYIPDNRYKSETSSTSTNLTIAALTLADTALYYCALQ
Maylandia zebra V209 trbv AGTA03000175.1 2063406 SSLNSQIYQTPAQLYISKETEEVKINCSHSIQGYDRILWYRQMNNRHLQFLGYMYGTVDNPEKGLDVKLKGDANKNKTCTLTIEKLGPNSSAVYFCA
Maylandia zebra V187 trbv AGTA03000175.1 2113344 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYEIILWYKQSEETLQLLGYLRFGTGYPEPGVNVTIDGGANVKENCTLTITDLKVSSSGVYFCAAS
Maylandia zebra V170 trbv AGTA03000175.1 2179081 LCLGVEVHQTPVEVFRTRGDEVQLVCSHGKTDYTFMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLSGSKPKNASMFIVDLKPEHSAVYYCAASY
Maylandia zebra V156 trbv AGTA03000175.1 2216119 VCLGVEVRQTPSEFITNVGSKVEIFCSHEKTDYRMMLWYQQPPGETAMKLIGYLYYKDDKYEEQYKDHFNITGDLSVNTVKKGYLIVQVAQQEHSAAYYCAASK
Maylandia zebra V131 ighv AGTA03000104.1 3755235 VYSIDLIQPESRSVQPGQSLTITCQVSGYSITDSSYATGWIRQREGKAMDWISHQWGGGTLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRR
Maylandia zebra V93 igkv AGTA03000823.1 18427 SRGQYTVTQPGAVSSAVGASVSIKCKISQRVDSGNRLGWYQQKDGGVPKLFIYTTSSRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Maylandia zebra V79 ighv AGTA03000591.1 17776 VDGQTLTQSEPDLLKRPGESHRLTCTASEFTFRSSCMVWVKQATGKGPEWIAFIHTSSFRYSTYYSQSVQGRFTISRNDSSSKLYLQMDSLKTQDTAVYYCARE
Maylandia zebra V54 ighv AGTA03000364.1 375727 VKCEQLTQPASETVQPGQRLTITCQVSYSVTGYYTAWIRKPAGKGLEWIGMAATGSTTYYKDSLKSKFSISTDSSSKTVTLTGQNLQPDDTAVYYCARN
Maylandia zebra V22 trdv AGTA03000302.1 590412 LTAGDSITPQQPEVTKTEGESVTLTCSYETDASYPRLHWYRHDSDLQAPQFILWKGGKRETTQYIPDNRYHSTTTDKSTNLTIAALTLADTALYYCALE
Maylandia zebra V12 igkv AGTA03000130.1 1523617 VDAVIVLTQTPAVHTVSPGQEVVLNCNIERYDGNYVRWYKHVPGEAPQYVLRFRHSDSSLEFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS