WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Labeotropheus fuelleborni ABPK00000000.1 (ABPK01) 33 8 0 8 3 8 1 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Labeotropheus fuelleborni Vs42 trbv ABPK01045502.1 653 FSFSVKIKQDPFLNSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELITYSLGEKVWDTEAPFDKSKYSMSRPSLLRSSLQIHSVAAGDSAVYYCVSRR
Labeotropheus fuelleborni Vs45 trav ABPK01055121.1 472 CKGEDKVIQEQGDVIAAEGDTVTLGCTFETTDTYPYLFWYKQEVNDFPKYVLRRDKTAGDNAQEFPKNRFDAELKEKSVPLKIQKLQLSDSAVYYCAVR
Labeotropheus fuelleborni Vs44 trbv ABPK01054081.1 734 HSQDVIQYPEISWRFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAVS
Labeotropheus fuelleborni Vs46 ighv ABPK01058242.1 619 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSYLMGWVRQAPGKGLEWVATINVTSKYYAQSVQGRFTISRDNNRQQVYLDMNSLKAEDSAVYYCA
Labeotropheus fuelleborni Vs27 igkv ABPK01005237.1 422 SRGQYTVTQPGAVSSAVGGTVSIKCTTSQNVYNNNYLAWYQRKDGGVPKLLIYLASTRYSGIPARFTGSGSNSDFTLTIMGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs25 ighv ABPK01001093.1 744 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKGLEWVATISDSSSNIYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Labeotropheus fuelleborni Vs24 igkv ABPK01000873.1 364 SRGQITVTQPGAESSAVGGSVSIKCRTSQNVYVWNNNHRLHWYQKKDGGVPKRLIHSASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs22 ighv ABPK01060477.1 113 VKCEQLTHPASVTVHPGDRLTITCQTSYSLSSARTFWIRQPAGKELECIGSVHVGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Labeotropheus fuelleborni Vs21 igkv ABPK01056362.1 261 SDASSSVTQSPVFKAAALGETVSLSCTASEGVGNDLSWYLQKPGQPPKLLFYKISRLQSGTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGLYDGPV
Labeotropheus fuelleborni Vs20 trbv ABPK01056149.1 67 LTVVVLQSGDQISDPGRKVLLECKMGPGFSMGSYTMFWYRQNHHRAPIEFLVKEYEKPVGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Labeotropheus fuelleborni Vs28 trbv ABPK01007089.1 1520 SSLSDRVHQDPADMYKNQGRAAEITCSHSIDSYDVILWYKQTENSQLQLLGYMYITNPFVEPGVTVTIGGDANKDKTCTLKIKDLFMNSSAVYFCAVR
Labeotropheus fuelleborni Vs1 trdv ABPK01001052.1 1949 LTAGDSITPQQPEVTETEGESVKLTCSYETTSSYPLLHWYRHHSDLQAPQCILWKGARSDSHLKYIPDNRYDSETSPTITNLTIAALTLADTALYYCALQ
Labeotropheus fuelleborni Vs4 igkv ABPK01003514.1 1631 SRGQITVTQPGAVSSAVGGSVNIKCRISQNVRVSSNNHLLAWYQQKDGGVPKLLIYLASSRVSGIPAHFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs5 igkv ABPK01004389.1 1049 SRGQITVTQPGAVSSAVGATVSIKCTTSQNVFVSGSSHCLAWYQQKDGGVPKRLIYYASTRVSGIPARFTGSGSKSDFTLTISGVQTEDAAVYYCQS
Labeotropheus fuelleborni Vs6 trbv ABPK01004790.1 568 SSLSDQVYQNPADMYKEQGQRADITCSHSIDNYDRILWYKQIKSKQLHFLGYIVGNLGSPETGANVTSKGNANKDQTCTLTIKDLTLNSSAVYFCAAS
Labeotropheus fuelleborni Vs7 trdv ABPK01007514.1 671 LTAGDSITPQQPEVTKTEGKSVKLTCSYETGYRNIYLHWYRHDSDLQAPQFILRKGAKGNSGEYIPDKRYKTQTTPTSTTLTIPALTLADTALYYCALQ
Labeotropheus fuelleborni Vs8 trav ABPK01008410.1 28 QKDNVLQAKGEETAAAGGTVTLDCQYESSSSQPSLFWYKQDGNNSPKFILSRVSGDQGNIAAEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Labeotropheus fuelleborni Vs9 trdv ABPK01008410.1 796 LTAGDSITPQQPEVTKTEGESVTLTCDYQTSYSGIYLYWYRHDSDLQAPQFILRKGAKGNSGEYIPDKRYKTQTTPTSTTLTIAALTLADTALYYCALQ
Labeotropheus fuelleborni Vs34 igkv ABPK01010828.1 431 SRGQITVTQPGAVSSAVGGSVSIKCTTSQDVYVWNNNHYLAWYQQKDGGVPKLLIYDADTLYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs35 trdv ABPK01011213.1 373 LTAGDSITPQQPEVTKTEGESVKLTCRYETDAGGALLHWYRHDSDLQAPQFILWKGARSWSDQYIPDNRYKSETSPTSTNLTIAALTLADTALYYCALE
Labeotropheus fuelleborni Vs10 igkv ABPK01012196.1 538 TRGQITVTQPGAVSSAVGATVSIKCTTSQDVRVWSNYHLLAWYQQKDGGVPKLLIYYASNRQSGIPAHFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs11 trbv ABPK01012591.1 488 GSSVQVYQTPSNIYTTGGDAKIYCSHSIPTYNQILWYKQSEKTLQLLGYLRFGTGTPETGVNVTIDGGANEKENCTLTLKDLKVSSSGVYFCAAS
Labeotropheus fuelleborni Vs16 trgv ABPK01023369.1 745 EQLIQDDLTLTRRVGESVSFSCGGTEQCDDDYIYWYQKKETKTFRVILDINKNDGNIDISYSSHPQKDEFSSVNTNKGWELEVKQVKLDHSATYYCNCLKVD
Labeotropheus fuelleborni Vs31 trbv ABPK01008576.1 1229 FSRGVKIDQPQFISSSKGSAFVTLKCEQDDRQHYYLYWYKQSSSGKLELVAYSTGQDNSFIEAPFEKMKYTMSRRSVLNSTLQLHLVEPEDTALYYCASSR
Labeotropheus fuelleborni Vs32 igkv ABPK01008826.1 1914 SRGQYTVTQPGAVSSAVGGSVSIKCTTSQNVYVYSNNHCLAWYQQKDGETPKRLIYWSSTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Labeotropheus fuelleborni Vs33 trav ABPK01010039.1 1004 AAQLSDVSQPESLKTVKIGDSATIKCFIKSASKKTVWYKVTTGRKLQLVVKTNSQYNVREFSDEFVNRSSVKFDMTNNHLTINKTSWEDVGTYFCGV
Labeotropheus fuelleborni Vs18 ighv ABPK01034290.1 24 VGVRSELDQSPSVVKRPGERMKILCTLSGYRLTSYNIHWIQQRPGRALEWIGYMSTGNNSPSYASSFQSRFIMTEEDSSSRQYLEIKSLTADDSAVYFCARQ
Labeotropheus fuelleborni Vs19 trdv ABPK01043221.1 702 LTAGDSITPQQPEVTETEGESVKLTCSYETTSEYVRLYWYRHDSDLQAPQFILFKGERLWSGGDYIPNNRYDSETSSTSTTLTIPALTLADTALYYCALQ
Labeotropheus fuelleborni Vs12 ighv ABPK01016061.1 396 VYSIDLIQSDSIVAQPGQSVTITCQVSGYSLTDRSYATGWIRQSEGKTLEWILHRWGNGDMAQNNALKNKLLHHTYSATSSVTLTGVTLQPEDTAVYYCVRS
Labeotropheus fuelleborni Vs13 ighv ABPK01020887.1 597 GLNGQALESIPSTTVXKKPQEAFSLSCRGSGFDFGQYGMHWIRQPAGKTLEWMGAIWYDASKTIYASSVQGRIEITRDNSNSMVHLSLSSLKPEDSAVYYCARK
Labeotropheus fuelleborni Vs36 trbv ABPK01015778.1 602 QVSAVTFQQSTPQIVAEKSEVQIDCSHNDGNLPLMLWYQHIKENQSMTLIGYGYQNARQTFEGQFEEQFKLTRGSATTGTLTIPSAELSHSAVYFCAA
Labeotropheus fuelleborni Vs30 ighv ABPK01008200.1 1001 VLGQTLTESEPVIQKSGESHRLICTSSGFLFSSYYMAWIRQAPGKGLEWIASISNGGGSSYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Labeotropheus fuelleborni Vs29 ighv ABPK01007295.1 352 TEGQTLTESESVIKRPGESHRLTCTYSGFSSDINGAWIRQAAGKVPEWVAWIRYDSNEIYYSQLVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCATEPR