WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Microtus ochrogaster AHZW00000000.1 (AHZW01) 231 68 21 46 56 31 6 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Microtus ochrogaster V172 trbv AHZW01077035.1 1151 SVDTRITQTPKHLVAVTGNERTLKCKQYLDHNAMYWYRQSAKRSLELMFSYNYQALVENQTIQSRFQPHNPEKSELDLQISALEPDDSATYFCASSQ
Microtus ochrogaster V173 trbv AHZW01077035.1 2547 HTGPNVLQIPSHQVIHEGQMVTLSCDPVSNHLYFYWYKLILGQKMEFLVSFYNGKLSDKSELFKEDRFSVERQENSYFTLKIQPTTLEDSAVYFCASSL
Microtus ochrogaster V174 trbv AHZW01077035.1 11864 SLETAVFQTPQYLVTQVGHKASFKCNQELGHDAMYWYKQDSKQSLKIMFTYNNKQLILNESVPGRFSPQSPDKAHLNLQVKPVEPDDSAVYFCASSY
Microtus ochrogaster V203 igkv AHZW01088726.1 3992 ACADIVMTQSSSSLAVSAGEKVTISCKSSQSLLYSGNQKNYLAWYQQKPGQAPKLLIYWASTRHTGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCMQYYDIP
Microtus ochrogaster V204 igkv AHZW01088734.1 2133 VCADIVMTQSPSSLVVSVGEKVTISCRSSQSLLNIGTQKNYLNWYHQKPGKSPKLLIYYVYTRDTGVPDHFIGSGSGTDFTLTINSAQAEDLAVYYCQQDFLY
Microtus ochrogaster V205 igkv AHZW01088737.1 3923 STADIVLTQSPALLVVLLGHRATIFCRASQSVTIDSFYLTHWYQKKPGQSPKLLIYEASNLESGVPDRFSGSGSGTDFTLTISPVEADDAATYYCQQSYDLP
Microtus ochrogaster V206 igkv AHZW01088738.1 3023 ACADIVMTQSPSTVAVSAREKVTISCRSSQSLLHSALKKNLLNWYQQKPGQSPKLLIYWASTRDTGVPDRFIGSGSGTDFTLTISSVQAEDVADYYCQHGYSYP
Microtus ochrogaster V207 igkv AHZW01088739.1 5586 STRDIVLTQYPTSLALSLGQSVTISCKSSGSVNKFGINLMHWYQKKPGEPLKLLIYNEGIRPTGIPARFSGNEASLDFTLTINTVEADDAATYYCQQGIDFP
Microtus ochrogaster V208 igkv AHZW01088740.1 10659 ACADITMTQSQSSLAVSVGEKITITCKSSQSLFSSSIKNCLYWYQQKQGKSPKLLIYWASTRETGVPDRFIGSGSGTDFTLTINSVQAEDLADYYCQQGYRYP
Microtus ochrogaster V209 igkv AHZW01088748.1 1955 VCADITMTQSPSSLAVSVGEKITISCRASQSLYNSNTNKNYLNWYQQKPGQSPKLLIYYASTRHTGVPDRFIGSGSETDFALTISSVQAEDLADYYCQQSYSYP
Microtus ochrogaster V210 igkv AHZW01088749.1 2768 ACADITMTQSPSSLAVSVGEKITISCKASQSLYNSNTKKNYLNWYQQKPGQSPKLLIYYASTRHTGVPDRFIGSGSGTDFALTINSVQAEDLADYYCQ
Microtus ochrogaster V211 igkv AHZW01088751.1 11450 ACADIMMTQSPSSMAVRAGEKVTIRCKSSQSLFNSKNQKNYLTWYQQKPGQAPKMLIDYASTLETGVPDRFIGSGSETDFTLTISSVQAEDLAVYYCMQFSEFP
Microtus ochrogaster V212 igkv AHZW01088756.1 2930 ACADITMTQSPSSLAASVGEKITISCRASQSLYNSNSKKNYLYWYQQKPGQAPKLLIYWASTRHTGVPDRFTGSGSETDFTLTISSVQAEDLADYYCQQGYSFP
Microtus ochrogaster V213 igkv AHZW01088758.1 6748 ACADIVMTQSPSSLAVPAGEKVTISCRSSQSLLAGGTNYLAWYQQKPGQAPKLLIYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCMQANEYP
Microtus ochrogaster V214 igkv AHZW01088759.1 774 ACADIVMTQSPSSMAVSAGEKVTISCKSSQSLYSSNYKKNFLNWYQQKPGQAPKLLIYWASTQDTGVPDRFIGSGSEKDFTLTIRSVQAEDLGHYYCMQAYDVP
Microtus ochrogaster V215 igkv AHZW01088760.1 10246 ACADIVMNQSPTSLAVSAGEKVTISCKSSQSLLYSGNNYLAWYQQKPGQAPKLLIYYASNRYTGVPDRFTGSGSETDFALIISSVQAEDVADYYCQQGFSNP
Microtus ochrogaster V216 igkv AHZW01088765.1 1372 TCADIVMTQSPSSMVMSLGEKVTISCKSSQSLFDSRYNKNDLSWYQQKSGQAPKLLIYWASTRHTGVPDHFIGSGSETDFTLTISSVQTEDLADYYCVQTYEY
Microtus ochrogaster V217 igkv AHZW01088769.1 8500 ACADITMTQSPSSLAVSVGEKITISCRASQSLYNSNNKKNYLSWYQQKPGQSPKLLIYLASTRETGVPERFIGSGSETDFTLTISSVQAEDLADYYCQQGYSYP
Microtus ochrogaster V218 igkv AHZW01088771.1 778 ASADIMMTQSSPSMAVSAGEKVTISCKSSQSLLYSGNNYLAWYQQKLGQAPKLLIYDASTQHTGVPDHFIGSGSGTVFTLTISSVESEDLADYYCQQ
Microtus ochrogaster V219 igkv AHZW01088771.1 17952 ACADVVMTQSPSSLAVSAGEKVTINCKSSQSLVYSDDKKNYLYWYQQKPGQAPKLLIYWASTRHTGVPDRFTGSGSETDFTLTISSVQAEDLADYYCMQANEYP
Microtus ochrogaster V220 igkv AHZW01088781.1 8437 TYGNIVMTQSPKSLPVSVKDKATMSCKSSQNVGTAIAWYQQKPGQAPKLLIYSASSRYTGVPDRFSGSGSGTDFTLTISNVKAEDLADYYCQQYSNWP
Microtus ochrogaster V221 igkv AHZW01088783.1 5462 TYGNIVMTQSPKSLPVSVEDKAIMSCKSSQNVGTAIAWYQQKPGQAPKLLIYSASTRYTGVPDRFSGSGSGTDFTLTISNVQDEDLADYYCQQWY
Microtus ochrogaster V222 igkv AHZW01088785.1 7798 VQCDIHMTQSPVSLSTFIGHTVKCQASQDIGRYLGWYQQKPGASPKFLIYYASNLLADVPKRFSGSGSGTDYWLIIINLDPEDSGIYYCQQCYTYP
Microtus ochrogaster V223 igkv AHZW01088786.1 2113 VTGETMTQFSASLSFSQGETATLTCRSIQSVGSYLSWYQQKPMQVPKLLIYGASTKASDVPARFSGSGSGTDFTLTISNLEPEDAASYYCQSMSGWS
Microtus ochrogaster V224 igkv AHZW01088818.1 7554 ARCDIQMAQSPSTLFASLGESVTITCLASQDIYGHLAWYQQKPGECPKLLIYGTSSLADGVSPRFSGSRSGSQYSFKIGSLQSEDAATYYCHQGDN
Microtus ochrogaster V225 igkv AHZW01088824.1 882 ARCDIQVTQSPSSLSASLGNRITITCRTSQGVSNYMSWYQQKPGEVPKLLIYHAPALQSGVPQRFSGSGSGTDFSFTISLLEPEDIVTYYCMQGQGW
Microtus ochrogaster V226 igkv AHZW01088824.1 7811 SKGEIVLIQSPAYMTASRGGKVIITCRASSSINSNYLHWYQQKPGASPKLLIYSTSYLADGVLDRFSGSGSGNSYFLTISCMQDEDAATYYCQHGSSS
Microtus ochrogaster V227 igkv AHZW01088825.1 2100 AKCDIQMTESPASLSASLGDSVTITCRASENIYTNLAWYQQKPGKCPNLLIYNAKSLAAGVPSRFSGSESGTQYSLKISSLPAEDIAIYYCQRHYSTP
Microtus ochrogaster V328 trbv AHZW01137710.1 12501 VGAQIIDQRPAVSVQPVGSSLSLECTVKGQSSPNLYWYWQDKGGTLQQLFYSISVGDVVSVTARNLSASRPQDGQFILSSEKLLLSHSGFYFCAWS
Microtus ochrogaster V356 iglv AHZW01153379.1 4084 SCAQFVLTQPNSVSGSLGSTVTISCKRSSGNIGSNYVHWYQQHVASPPTNVIYYDNQRPSGIPDRFSGSIDRSSNSASLTITDLQIEDEGDYYCQSSDSGY
Microtus ochrogaster V357 iglv AHZW01153406.1 3509 SFSQPVLTQSPTASASLGSSVKLTCTLNSDYSTITIYWYQQQPDKAPKYLMYVNSYGSHGKGDGIPDRFSGSGSGAQRYLSISNIQPEDEANYFCGTYGSSVY
Microtus ochrogaster V358 iglv AHZW01153411.1 10021 SFSQPVLTQSPTASASLGASVKITCTLSSQHSTYYIGWYQQQPDKAPKYLMYVSSNGNHGKGDGIPDRFSGSSSGAHRYLSISNIQPEDEAVYFCGTDDNSG
Microtus ochrogaster V359 iglv AHZW01153415.1 2872 SFSQPVLTQSPTASASLGASVKLTCTLNSDYSAYFIYWYQQQPDKAPKYLMYVNSNGYHSKGDGIPDRFSGSGSGTHRYLSISNIQSEDEADYFCGVAY
Microtus ochrogaster V360 iglv AHZW01153418.1 2373 SFSQPVLTQSPTASASLGASVKLTCTLSSDYSTNTIYWYQQQPDKAPKYLMYVYSSGNHGKGDGIPDRFSGSGSGAQRYLSISNIQPDDESIYFCGTSY
Microtus ochrogaster V361 iglv AHZW01153420.1 827 SIASYVLTQPSSLSVALGQTATITCSGDKLSDKSVHWYQQKEGHAPVLVIYNDNIRPNGIPDKFSGSNSGNKATLTISKVQAEDEADYYCQCWD
Microtus ochrogaster V362 iglv AHZW01153423.1 3333 SFSQPVLTQSPTASASLGASVKLTCTLSSDYSTYTIRWYQQQPDKAPKYLMYVSSNGNHGKGDGIPDRFSGSSSGAQRYLSISKLQPDDEADYFCGTYY
Microtus ochrogaster V363 iglv AHZW01153424.1 13311 SIASYVLTQPSSLSVALGQTATITCSGDKLSDEYVHWYQQKEGHAPVLVIYGDDKRPDGIPDQFSGSNSDNKATLTISNIQAEDEADYYCQSWD
Microtus ochrogaster V364 iglv AHZW01153427.1 2183 SMASYVLTQPSSLSVALGQTATISCSGDKLSDKYVQWYQQKEGHAPVLVIYKDDKRPDGIPDQFSGSNSDNKATLTIRNIQAEDEADYYCQIWD
Microtus ochrogaster V365 iglv AHZW01153428.1 2229 SFSQPVLTQSPTASASLGASVKLTCTLSSAHSSYNIEWYQQLPEKPPKYLMFLRSNGNYNKGDGISDSFSGSSSGAHRYLSISNIQPEDEGDYYCATGDSSG
Microtus ochrogaster V366 iglv AHZW01153439.1 2224 SFSQPVLTQSPTASASLGASVKITCTLSSQHSTYTIEWYQQQPDKAPKYVMWLSSNGNHGKGDGIPDRFSGSSSGAHRYLSISNIQPEDEADYFCGASDSSG
Microtus ochrogaster V367 iglv AHZW01153446.1 10152 SFSQPVVTQSPTASASLGSSVKLTCTLSSEYSIYAIGWYQQHPGKPPKYLMYLYDNGNHSKGDGIPDRFSGSSSGAHRYLSISNIQPEDEADYFCGIDY
Microtus ochrogaster V368 iglv AHZW01153448.1 822 SFCQPVLTQSSTASASLGASVKLTCTLSSQHSTYTIAWYQQQPDKAPKYLMYVYSNGNYDKGDGIPDCFSGSSSGAHRYLSISNIQPEDEGDYYCGTGDSSGR
Microtus ochrogaster V369 iglv AHZW01153453.1 5374 CFSQPVLTQSLSASASLGASVKLTCTLSSEHSTYSIGWYKQQPDKAPKYLMYLHNNGNYDKGDGIPDRFSGSSSGAHRYLSISNIQTEDEADYFCGVNY
Microtus ochrogaster V370 iglv AHZW01153456.1 8760 SFSQPVLTQSPIASASLGASVKLTCTLSSEHSTYAIEWYQQQPEKSPKYLMYVEDNGNHGRGDGIPDRFSGSSSGAHRYLSISSVQPEDEADYFCGVVYLNDR
Microtus ochrogaster V371 iglv AHZW01153463.1 1886 SFSQPVLTQSPSASASLGASVKLTCTLNSEYSTYKIQWYQQQPEKDPKYLMWLNSNGNHSKGDGIPDRFSGSSSGAHRYLSISNIQPEDEAIYFCGADY
Microtus ochrogaster V400 igkv AHZW01173221.1 8491 TSGDAVMTQTPLSLSVTIGQSASISCRSSQSLLSSDGNTYLIWLLQRPGQSPQNLIYLVSKGNSGVPDRFSGSGSGTDFTLKISKVEAEDLGVYYCFQHTYAP
Microtus ochrogaster V401 igkv AHZW01173224.1 9856 TTGDVVMTQNPLSLSVTIGQSASISCRSSQSLLSSNGNTYLSWFRQRPGLSPQLLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG
Microtus ochrogaster V402 igkv AHZW01173234.1 657 AICDIQMTQSPSSLSASLGDRVTITCRASEDIYNNLNWYQQKPGKSPKLLIYYTNNLADGLPSRFSGSGSGTDYSLTISSLESEDIATYYCQQVYNYP
Microtus ochrogaster V403 igkv AHZW01173248.1 15122 AKCDIQMTQSPASLFPCLGDSVTITCRASQNIYSVLAWYQQKPGNPPKLLIYGANGLADGVPSRFSSSGSGTQFSLKISGLKSEDVATYYCQQHRSY
Microtus ochrogaster V406 trav AHZW01173869.1 6244 LSQGEQVEQHPSTLRVQDGASAVINCTYVDRTSYNFLWYKQGPGEHPKLIVDIHSNMGRKHDERLIVFLDKKAKHFSLHITDAQPEDSAMYFCATD
Microtus ochrogaster V407 trav AHZW01173884.1 2177 MSQGEQVEQRPSTLRVSEGARAVINCTYVDSASSYFPWYKLEPGKHPKLIIDILSNMERKQDQRLIISHDKKAKFFSLHITDTQPGDSAMYFCAAS
Microtus ochrogaster V408 trav AHZW01173884.1 9425 VSSQEKVQQTPEFLSVSEGATASLNCTFSDRNYDYFWWYKQYPGKGLMLLVSIFSNGEKKEGRFTVDVNKSSLHVSLHIRDSQLSDSAVYICAV
Microtus ochrogaster V409 trav AHZW01173886.1 4222 VNSQQGEGNPRALSIQEGEDVTMNCSYKTYSVNLQWYRQDSGRGPVMLILLRSNEREKHSGRLRATFNTSTQSSSLSIPAARTADTAVYFCATE
Microtus ochrogaster V410 trav AHZW01173886.1 10617 TSTAQKVTQAQTSISVMEKKMVTLDCVYETRESTYYLFWYKQTTNGEMVFLIQQESYKGNSTEGRYSLNFQSSQSSIGLIITATQIEDSAVYFCAMRE
Microtus ochrogaster V411 trav AHZW01173887.1 7654 VKGQQVKQSPVSLVLQEGESTELQCNFSNMATQVQWFHQSPGGHLISLIYNPSGTKQSGRLTSKIVANEYRSSLYISSCQTTDSGTYFCAVDTQCS
Microtus ochrogaster V412 trav AHZW01173888.1 6970 VSRGEQLEQPSLLSVQEGGSAVINCTYTDSANYYFYWYKQEPGAGLKFLMNVLSNVDRKEEQGLTVLLNKEDKRLSLNITIAHPGDSATYFCAAS
Microtus ochrogaster V413 trav AHZW01173888.1 8181 KSNAESITRTKHLVTLTVGESLILSCTYQTPYLDPLLLWYVQYLNKAPRLLLKSFTNNKKTEHQGFQATLHRSSSSFHLQKSSVQLSDSALYYCALS
Microtus ochrogaster V414 trav AHZW01173889.1 941 VKGQQVKQSPVSLVLQERERAELQCKFSTSVRQVQWFYQIPEGHLISLFFSPSGTKQSRLTFKTVTREYQSSLYISSCQTTDSGTYFCAV
Microtus ochrogaster V415 trav AHZW01173891.1 1539 GNRAQSVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYVQYPGQSLQLLLKYVARDTLIKGINGFEAEFGKSNSSFNLRKNPAHWSDSAKYFCALS
Microtus ochrogaster V416 trav AHZW01173894.1 2071 IAGDAKTTQPDSMESIEEETVHLPCSHSAISGNEYIHWYRQVPLRGPEYVIHGLQQNTSNRMAFLAIPSDRKSSSLILPRVSLSDAAVYHCILRE
Microtus ochrogaster V418 trbv AHZW01174914.1 2133 HMEAAVSQSPRSKVTVTGGKAELSCHQTDGHDYMYWYRQELGHALRPIYYSYGVDSIEKGDAPDGYKVTRPRREDFSLILEKASPSQTAVYFCASSY
Microtus ochrogaster V419 trbv AHZW01174917.1 1827 HMEAAITQNPRSKVTVTGGKVELNCHQTFNHGNMYWYRQDLGHGLRLIYYSYGADNIQKGDVPDGCKVTRPRTEDFSLILEKTSLSQTSVYFCASSD
Microtus ochrogaster V420 trbv AHZW01174918.1 6188 LSEAGVTQSPRYVIIQERQEVSFWCDPISGHNTLYWYLQPRDQGLQSLVYFQNEAVMDGSQLPKDRFSAVRPDGVNSTLKIQSAKLEDSATYLCASSL
Microtus ochrogaster V421 trbv AHZW01174918.1 10291 HTDAGVTQSPRHEVAGKGQTVTLTCKPVSGHNDLYWYRQTKAQGLELLRYFRSKSLMEDDKTGEDRFTAEMLESSVSTLKIQPTEPQDSAVYLCASSL
Microtus ochrogaster V422 trbv AHZW01174919.1 3707 STNTGVIQTPSHKVTKMVQEATLRCKPISGHSGVYWYRQTTVQELEFLISFRNQAPIDDTGMPKERFSAQMPDAKLSTLKIQTTQPQDSAVYLCASSL
Microtus ochrogaster V423 trbv AHZW01174919.1 10404 CVDTMVMQNPRYKVAMIGKPVNLSCSQSLNHDAMYWYQQKPNQAPKLLLYYYDTTLNREADTSENFQSNRPNTSFCSLGIRSAGLGDSSMYLCASSR
Microtus ochrogaster V424 trbv AHZW01174919.1 22881 STHGAITQTPKFLIGVQGQRLTVECQQDFNHDTMYWYRQDPGKGLRLIYYSLTETDIQKGELSEGYSVSREKKPFFPLTVTSAQKNQMAVYLCASSI
Microtus ochrogaster V425 trbv AHZW01174919.1 29869 CGLGALVYQYPRRSICRSGTSMKIECHSVGVQATSVAWYRQFPQRAFELMAISTVSSTVKYEQNFPEDKFPISHPNLTFSSLTVSNAYPEDGGLYICGAR
Microtus ochrogaster V426 trbv AHZW01174920.1 5751 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHSYVYWYYKKLGEELKFLAYFQNADILDKIDTIGKNISAKCPTDLPCTIEIQSSQLTDSAVYFCASSQ
Microtus ochrogaster V427 trbv AHZW01174921.1 7693 SLDGQVIQTPKHLFRGKGQKAQMNCSPENGHTFVYWYRQKQNKELKFLIYFQRQEVRERIDFVKERFIAECPINSFCSLEIQSSEAGDSALYLCASSL
Microtus ochrogaster V428 trbv AHZW01174921.1 9368 FGDAAVTQIPRHLIKMKGQKATMKCSPEKGHTAVYWYQQKQDKELMFLIYFQNKQPLDQIDMVKERFLVEFRSDSNCSLEIKSSESRDSALYLCASSQ
Microtus ochrogaster V429 trbv AHZW01174921.1 11350 SFDAKVVQSPRHLVKEKGQKANMDCFPEKGHTAFYWYHQSQKEFKLLINFRNEEIMEQTDMAKKRFSAKCPSNSPCSLEIQSSEAGDSGLYFCASSQ
Microtus ochrogaster V430 trbv AHZW01174922.1 23713 STEAQVSQAPRHVITETGKKLIITCSQNMNHDYMFWYKQDSGLGLKLIYYSINADHIDKGEVSDGYNVSRKGKEAFLLTLESTQISQTSLYFCASS
Microtus ochrogaster V431 trbv AHZW01174922.1 26946 LVDMDVMQTPRYLVKRMGEEVLLDCVQDIGHERMFWYRQDPGLGLRLIHFSYDVDSNSKGDIPEGYRVSRKKRERFSLILESAETSQTSVYFCASSL
Microtus ochrogaster V432 trbv AHZW01174922.1 33319 SVFSVLVYQKPQRVICQSGTSLKIQCVLDSQVAGMFWYRQIPGQSLVFMAAANEGSDATYENEFNKDKFPISRPSLTFSTLTVSNARPEDSSFYFCSAG
Microtus ochrogaster V433 igkv AHZW01175048.1 2582 IRCDILMTQSPSSLSVPLGERVTLSCRASQGISNYLSWYQQKPERPPKPLIYLASNLENGVPSRFSGSGSGTDFTLTISSLESEDTGIYYCLQTNSLP
Microtus ochrogaster V436 trav AHZW01177119.1 197 IVVDAKTTQPDSMESIEEETVPCSHSAISGSEYIHWYRQVPLRGPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYYCILRE
Microtus ochrogaster V437 trav AHZW01177121.1 949 VIYSEQVEQRPSILAIQEGAGTVINCRYVDSASSYFLWYKQGHGKHPELIIGIRSNMEKKQDQRLIVLLDKKGKQFSLNITDTQPGDSAMYFCATD
Microtus ochrogaster V438 trav AHZW01178834.1 1357 VSRGEQLEQTSLLSVQEGGSAVINCTYTDSTNYYFYWYKQEPGAGIKFLMNVLSNVDRKEDQGLIVLLNKEDKRLSLNITAAHPGDSATYFCAAS
Microtus ochrogaster V439 trav AHZW01178835.1 292 VSRGEQLEQPSLLSVQEGGSAVINCTYTDSANYYFYWYKQEPGAGLKFLMNVLSNVDRKEEQGLTVLLNKEDKRLSLNITIAHPGDSATYFCAAS
Microtus ochrogaster V440 trav AHZW01178835.1 1503 KSNAESITRTKHLVTLTVGESLILSCTYQTPYLDPLLLWYVQYLNKAPRLLLKSFTNNKKTEHQGFQATLHRSSSSFHLQKSSVQLSDSALYYCALS
Microtus ochrogaster V442 iglv AHZW01179142.1 455 SFSQPVLTQSPTASASLGASVKLTCTLSSQHSSYTIAWFQQQPDKAPKYVMWLSSNGNHGKGDGIPDRFSGSSSGAHRYLSISNIQPEDEADYFCGTGDSSG
Microtus ochrogaster V444 trav AHZW01179802.1 2984 GVRGVEVEQSPSALSLQEGTSYVLTCNFSTSMRSVQWFQQNSRGSLISLFNLTPGTKQNGRLNSTFNSKERKSTLHIRDAQLEDSGTYFCAAE
Microtus ochrogaster V445 trav AHZW01179804.1 1571 GVRGVEVEQSPSALSLQEGTSYVLTCNFSTSMRSVQWFQQNSRGSLISLFNLTPGTKQNGRLNSTFNSKERKSTLHIRDAQLEDSGTYFCAAE
Microtus ochrogaster V446 trav AHZW01180467.1 1196 GNRAQSVVQPDAHLTVSEGAPLELKCSYSYGATPYLFWYVQYPGQSLQLLLKYVSGNTLVKGINGFEAEFGKSNSSFNLRKNPVHWSDSAKYFCALS
Microtus ochrogaster V509 ighv AHZW01024127.1 3991 VQCEVQLLESGGELVQPGKSLKLSCAASGFFFSDYYMSWVRQAPGKGLEWVARISYGGTTYHADAVKGRLTISRDNAKNTLYLEMSSLKSEDTAMYYCTR
Microtus ochrogaster V647 igkv AHZW01088725.1 8396 SKGQIVLTQPAESLHVTPGERVSITCRASQSLLYTDGKHYLSWYQQKKGQPIKAFIYHASVRIDGVPTRFIGSGSGTEFTLTIEDLQPEDFAVYHCLQ
Microtus ochrogaster V648 igkv AHZW01088765.1 6513 ACAGIVMTQSPSSMALSAGEKVTISCKSSQSLLYSGNNYLAWYQQKLGQAPKLLIYDASTQHTGVPDHFTGSGSGTDFTLTISSVESEDLADYYCQQ
Microtus ochrogaster V649 igkv AHZW01088769.1 11155 ACADIVMTQSPSSLAVSAGEKVTISCRSSQSLLADSTNYLAWYQQKPGQAPKLLIYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLGHYYCMQAYDVP
Microtus ochrogaster V650 igkv AHZW01088770.1 5493 AFADIVMTQSPSSMAVSAGEKVTISCKSSQSLYSSNYKKNFLNWYQQKPGQAPKLLIYWASTQDTGVPDRFIGSGSEKDFTLTIRSVQAEDLGHYYCMQAYDVP
Microtus ochrogaster V651 igkv AHZW01088829.1 5954 TKCDIQMTQSPASLSASLGDSVTITCQASQNIGSWLAWYRQKTGTSPKLLIYNAKSLAEGVPSRFSGTGSGTQFTLKISSLQPEDVATYYCLQRNNVP
Microtus ochrogaster V652 igkv AHZW01088842.1 3869 ARCEIQMTQSPMSLSASLGDSVTITCRASQNIYNVLAWYQQKPGKSPKLLIYAANILADEVPTRFSGSGFFTQYSLKIGGLHAEDVATYYCLQFRYAS
Microtus ochrogaster V653 igkv AHZW01088843.1 8056 ARCEIQMTQSPASLSSSLGDSITITCQAGQNIKSYLVWYQQKPGKPPKLLIYATNRLADGIPPRFSGSGSGTQYSLKISGLQPEDVATYYCQQGFRTP
Microtus ochrogaster V654 igkv AHZW01088847.1 17847 ARCDIQMTQSPDSLPVSLGDTVTMTCQASQNIYSSLAWYQQKPGNPPKLLICEAKGLADGVPKRFSGSGSGTQYSFKISGLKSEDVATYYCQQYSS
Microtus ochrogaster V655 igkv AHZW01088853.1 10933 IICDIQMTQSPSLYASLGNSVSITCRASESISNWLAWYQQKPGSSPKLLIYHAASLESGVTSRFSGSGFGTDFTLTISSLQPEDVATYYCQQYWNTP
Microtus ochrogaster V775 ighv AHZW01140460.1 10339 VQSDVKLVESGGGLVKPGGSLRLFCVASGFIFRDYWILWVRQAPGKGLEEVGGINTDSSTIRYAPSVKDRFTISRDNAKNTLYLQMRSVRSEDTATYYCAR
Microtus ochrogaster V776 ighv AHZW01140480.1 1542 ILSQVQLQESGPGLVKPSQSLFLTCSVTGFSITSGYYWIWIRQSQGKNLEWMGYITHSGETTYNPSMKSPISITRETSKNQFFLQLNSVTTKDTATYYCAGD
Microtus ochrogaster V777 ighv AHZW01140481.1 2558 VQCEVKLVETGGGLVQPGGSLRLSCAASGFTFSDYWMSWFRQTPENALQWVGEIKPDGSKTNYAPSIKDRFTISGDNAKNTLYLQMNSVRSEDTATYYCA
Microtus ochrogaster V778 ighv AHZW01140484.1 5151 VLSQVQLHQSGPELGKPGSSVKLSCKASGYTFTNDYIAWVKQRPGQVLEWIGWIYPGSGGTDYSEKFKGKAKLTADKSSSTAYMELSSLTSEDTAVYFCA
Microtus ochrogaster V779 ighv AHZW01140491.1 8976 VLSQVTLKESGPELLQPSQDLILTCSFSGFSLSTSGIGVGWIRQPSGKGLEWLANIWWDDTKFYNTFLKSRLTVSHDNNNRVFLKITSVYAADTGTYYCAWR
Microtus ochrogaster V780 ighv AHZW01140495.1 2525 VHSQVQLQQSGPELRKPGSSVKLSCKASGYTFTDYTIEWIKQKPGESLEWIGYFYPGNGNTEYNEKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V781 ighv AHZW01140497.1 11033 VNSQIQLLQSGAELVKPGASVKMSCKASGYPFTSYYMHWMKQKPGQGLEWIGRIDPSDGETKYAQKFQGKVTLTADKSSSTVYMELSSLTSEDSAVYYCA
Microtus ochrogaster V782 ighv AHZW01140498.1 10744 VHSQVQLHQSGPELGKPGMSIKLSCRASGYIFTSYYIIWVKQSPGQGLEYIGYIYPSNGGTGYAQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V783 ighv AHZW01140499.1 9614 VHSQVQLHQSGPELGKPGTSVKLSCKTSGFTFTSNYVSWLKQRPGQSLEWIGLIYPGNGNTKYNEKFQGKATLTADKSSSTAYMELSSLTSEDSAVYFCA
Microtus ochrogaster V784 ighv AHZW01140500.1 12302 VHSQVQLQQSGPELRKPGSSVKLSCKASGYTFTDYTIEWMKQKPGQSLEWIGHTVPEYDITIYNEKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V785 ighv AHZW01140502.1 13840 VHSQVQLHQSGPELGKPGTSIKLSCKASGYTFTSYYISWVKQSPGQGLEWIGWIYPGSGSTYYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V786 ighv AHZW01140507.1 12734 VNSQIQLLQSGAELVKPGASVKISCKASGYTFTSYYMHWVKQKPGQGLEWIGRIDPEDGETEYAQKFQGKATLTADTSSNTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V787 ighv AHZW01140514.1 5635 IHSQDQLHQSGPELVGPDTSVKLSCRASDDISYYYIHWVKQSPGQGLEWFARIFPGDGNTKYNQKFQGKATLTADTSSNTVYLELRSLTSEDSAVYYCA
Microtus ochrogaster V788 ighv AHZW01140521.1 2560 VHSQLQQSGPELVRPGTSVKLSCRASDDITYYYINWVKQSPGQGLEWFARIYPGDGNTKYNEKFQGKATVTADTSSNTAYMELRSLTSEDSAVYYCA
Microtus ochrogaster V789 ighv AHZW01140525.1 2290 VYSQVQLHQSGPELGKPGTSVKLSCKASGYTFTNNFMHWLKQRPGQGLEWIGWIYPGNGNTNYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V790 ighv AHZW01140528.1 5679 VHSQVQLQQSGPELRKPGSSVKLSCKASGYTFTDYTIHWMKQKPGESLEWIGWIYPKNGNTKYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCT
Microtus ochrogaster V791 ighv AHZW01140540.1 1310 VHSQVQLQQSGPELVSPGTSVKLSCRASDDITNYYINWVKQRPRQGLEWIGDIDPANGNTDYNQKFQDKATLTADTSSNTAYMELRSLTSEDSAIYYCA
Microtus ochrogaster V792 ighv AHZW01140551.1 7422 VHSQVQLQQSGPELRKPGSSVKLSCKASGYTFTDYSIDWMKQKPGESLEWIGVIYPRNGNTEYNQKFQGKATLTADTSTSTAYMELSSLTSEDSALYYCA
Microtus ochrogaster V793 ighv AHZW01140556.1 1607 VNSQIQLLQSGAELVKPGASVKMSCKTSGYTFTSYYMHWVKQKPGQGLEWIGRIDPSDGETKYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCS
Microtus ochrogaster V794 ighv AHZW01140565.1 4032 VHSQVQLQQSGAELVKPGSSLKLSCKTSGYNFASYYINWVKQRPGQGLEWIANIYPGNGGTNYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAIYYCA
Microtus ochrogaster V795 ighv AHZW01140569.1 1682 VNSQVQLHQSGPELGKPGTSIKLSCKASGYTFTSYAISWVKQSPGQGLEWIGVINPSNGGTAYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V796 ighv AHZW01140579.1 4273 VHCEVQLIESGGGLVQPKGSLKLSCATSGFTFTNAAMNWVRQAPGKGLEWVARIRSKSNNYATNYADSVKDRFIISRDDSKSTAYLQMNNLKTEDTAMYYCTT
Microtus ochrogaster V797 ighv AHZW01140584.1 984 VHCEVQLIESGGGLVQPKGSLKLSCATSGFTFTSYAMYWVRQAPGKGLEWVARIRSKSNNYATNYADSVKDRFIISRDDSKSTAYLQMNNLKTEDTAMYYCTR
Microtus ochrogaster V862 ighv AHZW01170299.1 536 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVIWVRQPPGKGLEWMGAIWSGGSTNYNSALQSRITITRDTSKSQVFLKLNSLQTEDTAMYYCAR
Microtus ochrogaster V863 ighv AHZW01170301.1 8216 VQCEVQLLESGGGLVQPGKSLKLSCAASGFTFSNYWMDCFRQAPGKGLEWLAHINANGGSTWYTDAVKGRFTISRDNAKNSLYLEMSSLKSEDTAMYYCAR
Microtus ochrogaster V864 ighv AHZW01170302.1 11982 GQCEMQLLESGGGLVRPGKSLKLSCAASGFTFSSYWMIWVRHAPGKTLEWITHINPDGGSTWYIDSVKGRFTISRDNAKNTLYLEMNSLISEDTALYYCAR
Microtus ochrogaster V865 ighv AHZW01170303.1 9503 IQCDVQLLESGGGFVQPGKSLKLTCAASGFIFSSYPMNWVRQAPGKGLEWVAYIRSNVYYTDAVKGRFTISRDSAKNTLYLEMSSLRSEDTAMYYCTR
Microtus ochrogaster V866 ighv AHZW01170307.1 604 VFSQVQLKETGPGLVQPSQTLSLTCTVSGFSLTGYHMHWIRQPPGKGLEWMGVIWHDGGTKYNSALQSRITISRDTSKSEVFLKLNSVHTEDTAIYYCAR
Microtus ochrogaster V867 ighv AHZW01170310.1 1394 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTRYSVHWVRQPSGNGLEWMGVIWGSGSTDYNSALQSRITITKDTSKSQVFLKLNSLETEDTAMYFCAR
Microtus ochrogaster V868 ighv AHZW01170316.1 7035 VFSQVQLKETGPGLVQPSQTLSLTCTVSGFSLTDYHMHWIRQAPGKGLEWMGVIWRSGNTKYSSALQSRITISKETSKSEVFLKLNSLRTEDTAIYYCAR
Microtus ochrogaster V869 ighv AHZW01170327.1 8474 ALSQIQLKESGPGLVQSSQTLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWMGVIAYNGNTNYNSALQSRISITRDTSKSQVFLKLNSLQTEDTAMYYCTI
Microtus ochrogaster V870 ighv AHZW01170331.1 2743 VFSQVSLKETGPGLVQPSQTLSLTCTVSGFSLTSNNIHWVRQPPGKGLEWMGIIWYDGETKYSSALQSRITISRDTSKSEVFLKLNSVHTEDTAIYYCAR
Microtus ochrogaster V871 ighv AHZW01170332.1 1848 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSNSISWIRQPPGKGLEWMGVIANNGNTYYSSALQSRITITRDTSKSQAFLKLISLQTEDTAIYYCA
Microtus ochrogaster V872 ighv AHZW01170342.1 23643 VQCEVQLLESGGGLVQPGQPLKLSCAASGFTFSNYEMSWIRQAPGKGLEWVAYITSGGGSTSYADAVKGRFTISRDNAKNTLYLEMGSLKSEDTAMYYCAK
Microtus ochrogaster V873 ighv AHZW01170348.1 2967 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTSYAVYWIRQPPGKGLGWMGGIWGDGSTEYNSALQSRISITRDTSKSQVFLKLNSLQTEDTAMYYCAK
Microtus ochrogaster V874 ighv AHZW01170352.1 3929 VQCEVQLVESGGGLMQPGKSLKLSCVASGFTFSNYWMSWVRQAPGKSLEWVASIYNSNNIYYTDAVKGRFTISRDNSKNTLYLEMGSLKSEDTATYYCAR
Microtus ochrogaster V875 ighv AHZW01170354.1 17145 VQCEVQLSESGGELVQPGKTLKLSCAVSGFTFSSFAMGWVRQAPGKGLEWVASSGSSTYYADAVKGRFTISRDNAKNTLYLEMSSLRSEDTAMYFCAR
Microtus ochrogaster V876 ighv AHZW01170360.1 13744 VSSQIQLKETGPGLVEPSQTLSLTCTVSGFSLNSYHIHWVRQPPGKGLEWLGIMWAGGSAEYNSALQSRITISMDTSKNEVFLKLNSVHTEDTAIYYCAR
Microtus ochrogaster V877 ighv AHZW01170362.1 1156 ALSQIQLKETGPGLVQPSQTLSLTCTVSGFSLTSNAVSWIRQPPGKSLEWMGIIWSGGSTEYNSALQSRITITRDTSKSQVFLKLNSLQTENTATYYCAR
Microtus ochrogaster V878 ighv AHZW01170379.1 2517 VQCEVHLLESGGRLVQPGKSLKLSCAASGFTFSNYWMNWVRQAPGKGLEWVAKINQGGDTTRYTDAVKGRFTISRDNAKNTLYLEMNNLRSEDTAMYYCAN
Microtus ochrogaster V879 ighv AHZW01170380.1 6784 ALSQNQLKESGPGLVQPSQTLSLTCTVSGFSITSYGVSWVRQPPGKGLEWMGAIWYNGNTDYNSALKSRVTITRDTSKSQVFLKLNSLQTEDTAMYYCAR
Microtus ochrogaster V880 ighv AHZW01170382.1 3543 IHCEVQLVESGGGLVKPDGSLKLSCVASGFTFSNYYMHWVRQPPGKGLEWVALIRNKANSYTTEYSASVKGRFTISRDDSKNTLYLQMNSLRAEDTATYYCTR
Microtus ochrogaster V881 ighv AHZW01170385.1 751 IQCDVQLVESGGGLIKPDGSLKLSCVASGFTFNNYYMYWVRQPPGKGLEWVALIRNKANSYTTEYSASVKGRFTISRDDSKNTLYLQMNSLRAEDTATYYCTR
Microtus ochrogaster V882 ighv AHZW01170393.1 24171 IHSQVQLQQSGAELVKDGTSVKMSCKASGYSFTSYYMHWVKQRPGHNMEWIGWINAGSGSTYYNQKFQGKATLTVDQSSSTAYMELSSLTSEDSAVYYCARQ
Microtus ochrogaster V883 ighv AHZW01170395.1 17350 VQCDVQLVETGGGLVQPGGSLKLSCAASGFTFSDSWMDWVRQAPGKGLEWVGRIKHKPNNYETSYAESVKGRFTISRDDSKSMLYLQMNSLRVEDTAIYYCA
Microtus ochrogaster V884 ighv AHZW01170395.1 6040 VQCDPQLVETGGGLVQPGGSLKLSCAASGFTFSDYWMDWVRQAPGKGLEWVGRIKHKPNNYETSYVESVKGRFTISRDDSKSMLYLQMNNLRVEDTAIYYCAR
Microtus ochrogaster V885 ighv AHZW01170407.1 2114 VQCDVQLKETGGGLVQPGGSLKLSCAASGFTFSDYWMHWVRQAQGKSPEWVGVIKHKPDNYATQYAESVKGRFTISRDDSKSTLYLLMNSLRVEDTAIYYCTI
Microtus ochrogaster V886 ighv AHZW01170412.1 4615 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITTGYNWSWIRQSSEKKFEWIGYISYGGSTNYNPSFKSRTSITRDTSKNQYFLQLNSLTTEDTATYYCAR
Microtus ochrogaster V887 ighv AHZW01170415.1 8019 VQAEVLLVQSGSELKQPGQSVKISCKASGYTFTNHTMYWVKQEPGQHLKWIGYIRTDTGTPTYADDFKGRFAFSLDTSVSTAYLQINSLKNEDTAMYYCAR
Microtus ochrogaster V888 ighv AHZW01170430.1 7466 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSIASGYAWSWIRQSPEKKLEWIGYISSGGSTDYNPSFKSRTSITRDTSKNQFFLQLNSLTTEDTATYYCAR
Microtus ochrogaster V892 trdv AHZW01171641.1 8230 VSLDVSLEQVDQITVVAGDRAVFYCTVTGGDLRKFQMSWYKKSEDNALILVYKLNNNSTEDLMGNFKGKIDISESRFILDIQKATTKDAGTYYCGSD
Microtus ochrogaster V893 trav AHZW01171649.1 24419 ASMAQTVTQPQQEKLVQEAESATLDCTYNTNDTSNYNLFCYRWKRGQMTLVIHQEAYRQQDTKENHFPMNFQRAAKSFSLEISDSQLEDAAMYFCALMER
Microtus ochrogaster V894 trav AHZW01171649.1 15273 ASMAQTVTQPQQQKFVQEAESATLDCMYDTNDTSNYNLFWYRQQRRRMTLVIRQEAYRQQNAKEDRFSVNFQRAAKSFSLEITDLHMEDAAMYFCALMER
Microtus ochrogaster V896 trav AHZW01171654.1 1814 VNGQVLSQSTQYVSIPEGKDVSMSCNSSSALDNVLWYKQDPKEGLVLLVALYKSGEVVRSGKVTAEFGGTRKDSVLTLSVSEPADSSTYFCAG
Microtus ochrogaster V897 trav AHZW01171660.1 11407 LSTQQLEQNPQFLSIQEGQDLTMYCNSSSTFPQIYWYKQEPREGPVFLMTLVKGGEVKEQKRMTAKFGEARKDSSLNIIRAQPGDTGIYFCAG
Microtus ochrogaster V898 trav AHZW01171664.1 13265 VKGQQVKQSSLSLVLQEGESTELQCNFSTSANQVQWFYQIPEGHLISLFFNPSGTKQSRLTFKTVTREYQSSLYISSCQTTDSGTYFCAV
Microtus ochrogaster V899 trav AHZW01171668.1 2532 VKGQQVKQSPVSLVLQEGESTELQCNFSTSASQMQWFYQSPGGHLISLFFNPSGTKQSGRLKSTTVTQERCSSLSISSSQSTDSGTYFCAVDPQCS
Microtus ochrogaster V900 trdv AHZW01171669.1 12266 SSIAQKATQEQRAINKKEGEQVTLDCSYETSKSFYQLYWYKQTPSGEMIFLIRQISSSHHNESSGRYAVIFQKSAKFISLIISASQVEDSMNYFCALGEP
Microtus ochrogaster V901 trav AHZW01171669.1 7565 VNSQQGEENPRTLSVQEGEDVTMNCSYKTYSVNLQWYRQDSGRGPVMLILLRSNEKEKHSGRLRATFNTSTQSSSLSIPAARTADTAVYFCATE
Microtus ochrogaster V902 trav AHZW01171670.1 3683 VKGQQVKQSPVSLVLLEGESAELQCNFSTVFNSVQWFYQSPGGHLITLFYNPSGTKKSGRRKSTTVTQERRSSLSISSSQSTDSGTYFCAMEPQCS
Microtus ochrogaster V903 trav AHZW01171671.1 5738 VSSQEKVQQNPEFLSVSEGATASLNCTSNDRNYNYFWWYKQYPGKGPMFLMSIFSNGEKKEGRFTVHLNQESLHVSLHIRDSQLSDSAVYLCAV
Microtus ochrogaster V904 trav AHZW01171672.1 725 VSQGEQVEQRPSTLRVQEGARAVINCTYEDNMSSYFPWYKQEPGKHHKLIIDIRSNMERKQDQRLIISHDKKAKHVSLHITDTQLGDSAMYFCAAS
Microtus ochrogaster V905 trav AHZW01171673.1 12088 MSNGDSVTQTEGLVTVTEGFPIKMNCTYQTTNLLPFLSWYVQYLNKVPKLLLRSATDNKRTENQVFHATLHKINSSFHLQKTSVQLSDSALYYCALS
Microtus ochrogaster V906 trav AHZW01171673.1 4740 VKGQQVKQSPVSLVLQEGESAELKCNFSITATQMQWFHQSPGGHLISLFYNPSGTKQSGRLKSMTVTQERCSSLSISSSQSTDSGTYFCAVDPQCS
Microtus ochrogaster V907 trav AHZW01171674.1 489 VSRGEQLEQQPSLLSVQEGGSAVINCTYTDSANYYFYWYKQEPGADLQFLLSILSNVDRKEELEFTVLLNKEEKHLSLNITAAHIKDSATYFCATS
Microtus ochrogaster V908 trav AHZW01171680.1 8459 VKGQQVKQSPVTLVLQEGESTELQCNFSTSAKQMQWFYQSPGGHLISLFFNPSGTKQSGRLKSTTVTQERRSSLSISSSQSTDSGTYFCAVDPQCS
Microtus ochrogaster V909 trav AHZW01171681.1 908 RSNGDSVTQTEGLVTVTEGSPLTLNCTYQTTYSSSFPLWYVQYPNKALQRLLSSATDNKKTENQGFHATLHKSNSSFHLQKPSVQLWDSALYYCALS
Microtus ochrogaster V910 trav AHZW01171684.1 12487 VKGQQVKQSPVSLVLQEGESAELQCNFSTSANQMQWFYQSPGGHLISLFFNPSGTKQSGRLKSTTVTQERRSSLYISSSQSTDSGTYFCAVDPQCS
Microtus ochrogaster V911 trav AHZW01171688.1 7575 RSNGDSVTQTDGQVTVTEGLPVKLNCNYETAYTSPSLFWYVQHPRKAPQLLLNTFTDKKRIEHQGFYASLNKSSSSFHLQKSSVQLSDSALYYCVLS
Microtus ochrogaster V912 trav AHZW01171691.1 3025 RTQGYSVTQTGGQVTISEGGFLTINCTYIITNIVSPALFWYVQYPGESLQFLLKVITAGAKGSSRGFEATYDEGSSSFHLEKASVQESDSAVYYCALS
Microtus ochrogaster V913 trav AHZW01171691.1 496 AAGKTQVEHSPKSLVVLQGENCILHCNYTVSPANNLRWYRQDRGRSLVSLALMTNSENKKSNGRYSAILDADAQHSTLHITAAQLEDTAFYICVVG
Microtus ochrogaster V914 trav AHZW01171692.1 3868 ESNGDSVTQTKGQVTLFEGTSLTVNCSYETKQYPALFWYVQYPGEGPKLLFKVSKANEKGSSGGFEATYDEGSTSFHLQKSSVQESDLAVYYCALG
Microtus ochrogaster V915 trav AHZW01171698.1 1281 VNSQQKVQQSPGYLSVSEGAMAFINCTFSDSNSQYFWWYRQHPGKGPKALMSIFSNGKREEGRFTVHLNKTSLQVSLHIRDSQPSDSAVYFCAV
Microtus ochrogaster V916 trav AHZW01171700.1 1360 RTHGDSVIQTVGPVTLSEEDFLTIHCNYSVSGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDKESSSFHLQKASVQESDLAVYYCALS
Microtus ochrogaster V917 trav AHZW01171702.1 1851 LSQGEQVEQRPSTLRVQEGAIAVINCTYVDSTSYYFPWYKQEPGKHPNPIIGIRSNVERRQEQRLIISHDKKAKQFSLHITDTNPGDSAMYFCATR
Microtus ochrogaster V918 trav AHZW01171704.1 22465 GVRGVEVEQSPSALSLQEGKSSTLLCNFSTTMTNVQWFRQNSRGSLINLFYLNPGTKENGRLNSTFVSKERYSTLQIRDAQLEDSGTYLCAAY
Microtus ochrogaster V919 trav AHZW01171704.1 12898 GVRGVEVEQNPSALNLQEGSSSTLSCNFSTTMTKVQWFRQNSRGSLINLFYLTPGTKQNGRLNSTFNNKERKSTLHIRDAQLEDSGTYLCAAE
Microtus ochrogaster V920 trav AHZW01171704.1 900 MSNGDSVTQTEGLVTVTEGSPVMLNCTYQTTDSAPYVFWYVQYLNKAPQLLLKGFTDKKRTEYQGFYATLHKSNSSFHLQKSSMKLSDSALYYCALS
Microtus ochrogaster V921 igkv AHZW01173240.1 4261 VSCNIQMAQSPLTVSASLGERVTITCHASQNINSWLVWYQQKPGNAPVLLIYKTSNLQPGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCMQHQSC
Microtus ochrogaster V922 igkv AHZW01173253.1 10124 SWGQVVLTQSPESMAASQGEKVTISCLSSVSTGYLHWYQQKPKASPKLLIYEVTNLASGVPARFSGSRSGSSYSLTISSVEAEDAATYYCQQGTSY
Microtus ochrogaster V923 trgv AHZW01173337.1 3022 GFGQLEQPEMSVTKAIGESAQIACKIPPDHSDTDIHWYRQRENQQFDYLIHARQNYYQRPLDGINKKIEVSKDRQTSTSTLKVNFLKKEDEAFYYCAIWT
Microtus ochrogaster V924 trgv AHZW01173339.1 18999 RQTSPNLEERIMSITRTVGFSVSITCDIRTANSYIHWYRFQEGRTPQYLLSYNIIRSTTMVDSGLSLEKYHVYEGTDKTYKFVLRNLEESDAGLYYCASWT
Microtus ochrogaster V925 trgv AHZW01173339.1 12002 GLGKVEQPEISVTRTTDETAQISCKVSINSFKSVAIHWYRQKPNQGLQFLLYVMATPTHILLDETKKMEASKNSSASTSTLTIYSLKEEDEAIYYCSYG
Microtus ochrogaster V926 trgv AHZW01173339.1 6906 IGGSIPTSHLMSYITKRKGDTAFLECQFKIILKHDTYIHWYRQKPGQPPKRMLCLNSRGNIIYEKGFSEERYEAKQWQNDLYSNLRIYRVTEEDTGIYYCAYWA
Microtus ochrogaster V927 trgv AHZW01173339.1 4670 GDYWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Microtus ochrogaster V928 trgv AHZW01173340.1 1655 RQTSPNLEERIMSITRTVGFSVSITCDIRTANSYIHWYRFQEGRTPQYLLSYNIIRSTTMVDSGLSLEKYHVYEGTDKTYKFVLRNLEESDAGLYYCASWT
Microtus ochrogaster V929 trbv AHZW01173498.1 9060 SASPGVIQSPRHIIKAKGGRSFVKCTPISGHDSVGWYQQSQGKELKFLIQHYEKMERAKGNIPNRFSVQQFRDFHSEMNMSALQLEDSAVYFCAS
Microtus ochrogaster V930 trbv AHZW01173498.1 6631 HMEAAITQSPRSKVTVTGGKVELSCNQTDNHNYMYWYRQDLGHGLRLIHYSYGAGSTEKGDVPDGYDVIRPSQNDFSLILEKASPSQTSVYFCASSD
Microtus ochrogaster V931 trbv AHZW01173501.1 405 SASPGVIQSPRHIIKAKGGKSILKCTPISGQDNVFWYQQTLGKELTFLIQHYKSMERAKGNIPKRFSVQQFSDSHSEMNMSALQLEDSGVYFCAS
Microtus ochrogaster V932 trbv AHZW01173503.1 47166 PVSAGITQNPKSMLMKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDVPEGYNVSRSNTEDFFLILQSASPSQTSVYFCASSY
Microtus ochrogaster V933 trbv AHZW01173503.1 44465 LTNAGVSQSPLYRIIKRGQDTALECDPVSGHRGLYWYRQNLGQGPVFMVSFQDELLSDKSGMSNDRFSAVRPEGSFSTLKIQSTDEEDSGIYLCASSL
Microtus ochrogaster V934 trbv AHZW01173503.1 40368 LTDAGITQTPRYWIAQTGRKTTLECSQNMNHYSMFWYRQDAGEGLKLIYYSGSAGSTTKGDVPEGYSVSRNKTEHFPMTLGSARPSQTSMYFCASS
Microtus ochrogaster V935 trbv AHZW01173503.1 27169 HTKAGVSQSPTYSIIKKGQNVSFRCDPISGHLGLFWYQQKSGQGPEFLIYFQNELAPDKSGMPGDRFSAERPEGSYSVLKIQPVKQEDSAVYLCSSSL
Microtus ochrogaster V936 trbv AHZW01173503.1 22407 SASPGVIQSPRHIIKAKGGSSFVKCIPISGHNTVFWYQQTLGQELKFLIQHYEKVEGEKGNIPNRFSVQQFSDYHSQMNMSALQLEDSAVYFCAS
Microtus ochrogaster V937 trbv AHZW01173503.1 21039 HMEAAVTQSPRSKVTVTGGKVELSCHQTDNHDNMYWYRQDLGHGLRLIYYSYRDGSTEKGDVPDGYKVTRPRTEDFSLILEKASPSQTSVYFCASSD
Microtus ochrogaster V938 trbv AHZW01173503.1 14797 SASPGVIQSPRHIIKAKGGRSILKCIPISGHDTVFWYQQTLGKELKFLIQHFEKTEREKGNIPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Microtus ochrogaster V939 trbv AHZW01173503.1 12388 HMEATVTQSPRSKVTVTGGKVELSCNQTNNHENMYWYRQDLGHGLRLIYYSYGAGSTEKGDVPDGYDVIRPRTEDFSLILEKASPSQTSVYFCASSD
Microtus ochrogaster V940 trbv AHZW01173503.1 6458 SASPGVIQSPRHIIKAKGGRSILKCTPISGHDTVGWYQQTLGQELKFLIQHFEKTEREKGNIPNRFSVQQFSDYQSEMNVSALQLEDSGVYFCAS
Microtus ochrogaster V942 ighv AHZW01174359.1 11147 VQCEVQLLESGGGLVQPGKTLKLSCAASGFSFSGSWMNWVRQAPGKGLEWVAYISNDGSSTSYADAVKGWFTISRDNAKNTLYLEMSSLKSEDTAMYYCAT
Microtus ochrogaster V943 ighv AHZW01174359.1 7064 GQCEVQLVESGGSLVQPGKSLKLFCAASGFTFSDYYMNWVRQAPGKGLEWVAYISGGGSDIKYADAVKGRFTISRDNAKNTLYLEMNSLRSEDTAMYYCTR
Microtus ochrogaster V945 ighv AHZW01174376.1 16237 VQCEVQLLESGGGLVQPGKSLKLSCAASAFTFSSSDMNWFSQAPRKGLEWMAYISYNGGTTSYTDAVKGRFTISRNNAKNTLYLEMSRLRSEDTAIYYCAR
Microtus ochrogaster V946 ighv AHZW01174376.1 1237 ALSQIQLKVSGPSLVQPSQTLSLTCTVSGFSLTSYGIHWVRQTPGKVLEWIGAIWSGGGTEYNPALQSRITITRDTSKSQAFLKLNSLQTEDTAMYYCAK
Microtus ochrogaster V947 ighv AHZW01174383.1 5695 VQCEVQLLESGGGLVQPGNSLKLSCAASAFTFSDYAMSWVHQDSGKGLEWVTTIGTDSSAYYTNAVKGRFTISRDNAKNTLYLEMSSLMAEDTAMYYCAR
Microtus ochrogaster V948 ighv AHZW01174387.1 1050 VFSRLQMKETGPGLVQPSQTLFLTCTVSGFSLTDYDISWVCQPPGKGLEWMGAIWRGGSTKYSSPLQSRITISKDNSKSEVFLKLNSLHTEDTGIYYCDR
Microtus ochrogaster V949 ighv AHZW01174388.1 1055 ALSQIQLKEAGPGLVQPSQTLSLTCTVSGFSLTSYGVHWVRQLPGKGLEWMGVIANNGNTYYNSGLQSRITITRDTSKSQVFLKLNSLQTEDTAMYYCAK
Microtus ochrogaster V950 ighv AHZW01174397.1 5480 VQCEVQLLESGGGLVQPGKSLKLSCAASGFTFRNYYMDWVRQAPGKRLEWVAEINTSGSSTWYTDAVKGQFTISRDNAKNTLYLEMNSLKSEDTAMYYCAR
Microtus ochrogaster V951 ighv AHZW01174401.1 7173 IQCDVQLLESGGGLVQPGKSLKLSCTASEFTLSSYPMNWVRQAPGKGLEWVAYIRSNVYYTDAVKGRFTISRDNAKNTLYLEMNSLRSEDSAMYYCAR
Microtus ochrogaster V952 ighv AHZW01174401.1 2017 ALSQIQLKESGPGLVQPSQTLSLTCTVSGFSLTDYDIHWIRQPPGKGLEWMGIIWASGNTKYNSALQSRITITRDTSKSQVFLKLNNLQTEDTAMYFCAR
Microtus ochrogaster V953 ighv AHZW01174405.1 3222 VFSREQLKETRPGLIQPSQTLSLACTVSGFSLTSYYIHWVRHPPGKNLEWMGLIRNNGNTKYSSALQSRIIISRDTSKSEVFLKLNSVHTEDTAIYYCAR
Microtus ochrogaster V954 igkv AHZW01175034.1 4040 TTGDVVMTQNPLSLSVTIGQSTSISCRSSQSLLHSDEYTYLSWLLQGPGQFPQSLIYLVSKHNSEVPDRFSSSGSGTDFTLKINRVEAEDLGVYYCFQD
Microtus ochrogaster V955 igkv AHZW01175042.1 714 IRCDILMTQSSSSLSVSLGDRVTISCRASQGISNYLNWYQQKSGEAPKPLIYYASNLENGVSSRFSGSGSGTDFTLTISSLEPEDIGTYYCQQYNNYP
Microtus ochrogaster V956 igkv AHZW01175043.1 8478 ISCDILMTQSPSSLSVSLGDRVRISCQASEGISNYLSWYQQKPERPPKPLIYLASNLENGVPSRFSGSGSGTDFTLTISSLESEDTGIYYCLQTSSYP
Microtus ochrogaster V957 igkv AHZW01175049.1 8486 STGDVTMTQTPSSLPVSIGDQASISCRSSQSLVYSDGNTYLHWYLQKPGQSLKFLIYKVSNRFSGVSDRFSGSGSGTDFTLKIIRVEPEDLGVYYCMQA
Microtus ochrogaster V958 igkv AHZW01175053.1 3924 ARCDIQVTQSPPFLSASLGDKVTITCLASQGISNDLNWYQQKSGQAPTLLIYFANSLQSGVPSRFSGQYSGKSFTLTIGSVEPEDVGTYFCLQHYNT
Microtus ochrogaster V959 ighv AHZW01175324.1 4424 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITAGYYDWSWIRQSPEKKFEYIGHIYSSGGSTYYNPSFKSRTSITRDTSKNQFFLQLNSLTTEDTATYYCAR
Microtus ochrogaster V960 ighv AHZW01175329.1 4336 VQSEVKLVESGGDLVKPGGSLRLSCVASGFTFSDYWMDWVRQAPEKGLEWVGEINKDSSTIRYAPSVKDRFTISRDNAKNTLYLQMNSVRSEDTATYYCTR
Microtus ochrogaster V961 ighv AHZW01175337.1 1641 VQAEVLLVQSGSELKQPGQSVKISCKASGYTFTDYAMTWVKQEPGQPLKWMGYITTDTGTPNYADDFKGRFVFSLDTSVSTAYLQINSLKNEDTAMYYCAR
Microtus ochrogaster V962 trav AHZW01175555.1 7976 VSSQQKLQQNPEFLSVPEGTMASFNCTFSDGNSDDFRWYRQQPGKGPELLASIFSSGETKEGRFTIHLNKDSRQVSLHIRVSQPSDSAVYFCAVR
Microtus ochrogaster V963 trav AHZW01175555.1 3849 RSNGESVTQTEGQVTVTEGLPVKLNCNYETAYTSPSLFWYVQHPRKAPQLLLKTLTDKKRIEHQGFYASLNKSSSSFHLHKSSVQLSDSALYYCALS
Microtus ochrogaster V964 trav AHZW01175556.1 4937 RTHGDSVTQAEDQMIISEGGFLTINCTYIITHIGSAALFWYVQYPGESLQFLLKVITAGAKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALR
Microtus ochrogaster V965 trav AHZW01175556.1 2462 AAGKTQVEQSPKSLVVLQGENCILHCNYTVSPANNLRWYRQDTGRGIVSLALMTYIENKKSNGRYSAILDANAKNSTLHITAAQLEDTAFYICVVG
Microtus ochrogaster V966 trav AHZW01175557.1 32041 LSQGEQVEQCPSTLRVQEGASAIINCTYVDSTSYYFPWYKQEPGMHPKLIIDIRSTVERKQDQRLIVSHDKKTKQFSLNITDTQLGDSAMYFCAAS
Microtus ochrogaster V967 trav AHZW01175557.1 27159 RTHGESVTQTEGQVTLSEEDFLTIHCTYSASGYPVLFWFMQYPGEGPQLLFRASKDNEKKSSRGFEATYDKGSSSFHLQKASVQESDSAVYYCALT
Microtus ochrogaster V968 trav AHZW01175557.1 6827 DVQTQSVTQLDAHVTVFEGNLVKLRCNYSYSGAPYLFWYMQRPGQGLQLLLSYRSGSSAVHGMNGFEANFQKSNSSFHLKKTSVHWSDSAVYFCALS
Microtus ochrogaster V969 trav AHZW01175559.1 22463 GVRGVEVEQNPSALSLQEGTSSVLTCNFSIIVRNVQWFRQNSRGSLINLFYLSPGTKQNGRLNSTFNNKEGKSTLHIKDAQLEDSGTYLCAAM
Microtus ochrogaster V970 trav AHZW01175559.1 8628 RSNGDTVTQTEGLVSVTEGSPVMLNCTYQTTYSAFVFWYVQYLNKAPQLLLKGSTDKRTEHQGFHATLHKSNSSFHLQKSSVQLWDSALYYCALS
Microtus ochrogaster V971 trav AHZW01175560.1 2773 VSRAEQLEQQPSLLSVQEGSSALITCTYTATVPSFFSWYKQVPGAGLQFLLNIFSNVDRKEEQGLTVLLNKEDKRLSLNITAAHPGDSATYFCAAS
Microtus ochrogaster V972 iglv AHZW01176192.1 715 SCAQFVLTQPNSVSGTLGSTVTISCKRSSGNIGSYYVHWYQQHIGSPPTNVIYDDNQRPSGIPDRFSGSIDSSSNSASLTITELQIEDEGDYYCLSSTNGY
Microtus ochrogaster V973 iglv AHZW01176196.1 501 SCAQFVLTQPNSVSGSLGSTINISCKRSSGSIGSYYVHWYQQHIGSSPTNVIYDYNKRPSGIPDRFSGSTDSSSNSALLTITDLQIEDEADYYCLSSDSNY
Microtus ochrogaster V974 iglv AHZW01176198.1 1469 SCAQFVLTQPNSVSGSLGSTVTISCKRSSGNIGSYYVHWYQQHVGSPPTSVIYKDNQRPSGIPDRFSGSIDSSSNSASLTITDLQIEDEADYYCQSYDDSY
Microtus ochrogaster V976 ighv AHZW01177417.1 2686 VQSQVQLHQSGPELGKPGTSVKLSCKTSGFTFTSNYISWVKQRPGQGLEWIGWIYPGDGDTEYNQKFQGKATLTADESSSTAYMELRSLTSEDSAVYYCA
Microtus ochrogaster V977 ighv AHZW01178573.1 345 VHSQVQLQQSGPELRKPGSSVKLSCKASGYTFTGYIIHWVKQKPGESLEWIGWIYPGSGSTEYNEKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V978 trav AHZW01179009.1 884 VSRGDKLEQPPLLSVQEGGSVLITCTYTDSANDYFYWYKQEPGTGLQFLLNILSNVDRKEEQELTVLLNKEDKRLSLNITAAHPRDSATYFCAAS
Microtus ochrogaster V979 trdv AHZW01179228.1 5452 KDALCITLTQSSPDKTVASGSGVTLLCTYEGTFRNPELFWYRRRQDLSFQFILYRDDTRSPDADFVQGQFSVRHSSVYRTFHLVISPVRPKDSGTYYCAS
Microtus ochrogaster V980 ighv AHZW01179332.1 1798 VNSQVQLHQSGPELGKPGTSVKLSCKASGYTFTNYAMHWVKQRPGQGLEWIGAINPSNGGTDYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus ochrogaster V981 iglv AHZW01179690.1 821 TCAQVVLTQQSSVSGSLGSTVTITCKRNSGSIGSYYVHWYQQHIGSPPTNVIYDYNKRPSGIPDRFSGSIDSSSNSASLTITALQIEDEADYYCQSYSSSN