WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pteronotus parnellii AWGZ00000000.1 (AWGZ01) 118 60 16 0 20 16 0 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pteronotus parnellii V0 ighv AWGZ01003035.1 4003 VLSQVQLQESGPGLMKPLQTLSLTCTVSGFSLSSYGVHWACQPPGKGLEWVGVIWGDGSTYYSPGLKSRLSITKDNSKIQVYLTPNSLRADDTAMYYCAR
Pteronotus parnellii V3 ighv AWGZ01003660.1 1910 VHSEVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYMHWVRQAPGQSLEWIGWVYPRSGSTYYAQKFQGRATITADKSTNTAYLELRSLRTEDTAVYYCAR
Pteronotus parnellii V11 ighv AWGZ01010266.1 14158 VQCEVQLVESGGGLVQPGGSLRLSCVVSGFSLSDYGQNWVRQAPGMKLEWVAVMWYDGSKQYYADSVKGRFTISRDIAKNTLHLQMNILRAEDTAVYYCAS
Pteronotus parnellii V20 iglv AWGZ01019460.1 1425 SVASYELTQPSSASVALGETVTISCSGDLIGKKYASWFQQKPGQAPVLVIYKFSERPSGIPDRFSGSNSGNTATLTIGGAQAQDEADYYCRAEDEAD
Pteronotus parnellii V21 iglv AWGZ01019460.1 14335 SVASYELTQSSSLSVALGETAKITCTGDFIDKKYTYWYQQKPGQVPVLVIYKDSERPSGIPERFSGSSSGKTVTLTISGAQAEDEADYYCLSAESDDS
Pteronotus parnellii V22 ighv AWGZ01020247.1 6155 VQCEVQLMESGGGLVQPGQSLIHSCVSSGLAFSSSWMSWVHQASGKKLEWVCGINTDGSTTYYPSSVKGRFIITKDNSKNTLYLQMNNLRAEDMAVYYCMT
Pteronotus parnellii V29 ighv AWGZ01032225.1 4440 VRSQMQLQESGPGMEKPSQTLSLICTVSGFSITTSSYGWIWIHQSPAKGLEYIGYITGGGSTSYSPPLKSRASISRDTSKNQFSLQLSSLSTKDSAVYYCAR
Pteronotus parnellii V37 ighv AWGZ01041053.1 1408 VWLQVQLQESGLGLLKPSQTLSLTCTISGGSVTSKSLSWIRQPPGKGLEWIGIIYYDGYTYYSPSLKSRATMSRDTSKNQFSLQLSSVSTEDTAVYYCAG
Pteronotus parnellii V39 ighv AWGZ01044774.1 15276 VWSHVQLLESDPGLVKPSQTLSLTCTVSGYSITSGYAWSWIRQLPGKGLDWIGHIYSAGSTYYSPSFKSRASISRDTSKNQFFLQLSSMTTEDTAVYYCAR
Pteronotus parnellii V57 trbv AWGZ01070862.1 7144 SVDTEVTQSPRHLVKGKEREARMECVPRKGHSYVYWYHQKLGEELMFLAYLQNDKVIEKAKVANDRFSFLCPETSPCSLAIQPTGRGDSALYLCASSQ
Pteronotus parnellii V58 trbv AWGZ01070863.1 2150 SSDAQVTQTPGHLVKGKGQKARMTCTPQKGHPVVYWYQQIPQKEFKFLISFQNEDVLDHIELFKGRFSANCSKNSPCSLAIQPSEPGDSAVYLCASSL
Pteronotus parnellii V59 trav AWGZ01071738.1 4456 GIRAQTVTQPEDHISVLEGTSVEVRCNYVYSGSPYLFWYVQYPTQSLQLLLKHTSGSSIKGFTADLNRSETSFHLKKQFAQEEDSAVYYCVLD
Pteronotus parnellii V61 ighv AWGZ01071935.1 6416 LQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYHWSWICQPPGKALEWMGYWSGGSRYIPGFQGHISITADTSRNQLSLQLSSVTPGETAVYYCAR
Pteronotus parnellii V62 ighv AWGZ01072440.1 6143 VQYEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYYMYWFRQAPGKGLEWVSLITHNSGGTYYANSVKGRFTISRDNAKNELYLQMSNLRAEDTALYYCAR
Pteronotus parnellii V63 ighv AWGZ01072580.1 5215 VCSQVHLQESGLGIVKPSQTLSLTCTVTGYSITTDCYWNWIHQPPWKGLEWIGSISNTGRTPYSPPLKTRTSTSRDMSRNQFSLQLSSMTMEDSAVYYCAR
Pteronotus parnellii V67 ighv AWGZ01076209.1 4833 GRSKVQLQESGPGLVQPSQALSLKCTVSGYSITSNYYWIWVCQSPVKGLEWIGDIYYTGSTKYNPSFESRASISRDTFKNQFFLQLRYVSTEDSAIYYCAR
Pteronotus parnellii V68 ighv AWGZ01076210.1 8615 VWSQVQLQESGPGLVKPSQTLSLTCIVSGESITSSYTYWHWIRQAPEKGLEWIGYISYSGSSYYSPPFKSRSSISRDTSKNQFSLQLSSITTEDSAVYYCAR
Pteronotus parnellii V73 ighv AWGZ01083443.1 10971 VWSQVQLQESGPGTVKPSQTLWLTCTVSGFSITSSGYSWSWIRQSPGKGLEWIGNINSGGSPYYSPSLKSHASISRDTSKNQFSLQLSSVSTEDSAVYYCTR
Pteronotus parnellii V75 ighv AWGZ01083770.1 10846 VWSQVKLQEWGPGTVNPSQNITVTCAVYGYYITSGYYWSWIRQSPGKGLEWIGQLGKTGNTYYSPSFESRAFLSRDTSKNQFSLQLSSASTEDTAVYYCAR
Pteronotus parnellii V79 trav AWGZ01095856.1 43 GTRGDSVNQTEGPVTVRETEFLTLNCTYQTTYTSSYYFFWYVQYQNKEPVLLLKSSSDNQEVNSQGFRATHVKEERSFHLKKPSVQMSDSAVYFCALR
Pteronotus parnellii V81 trav AWGZ01098590.1 17882 ESTQQLEQSPSFLSIQEGENCTVYCNSPNIFPTFQWYRQRVRGGPLFLVTSAMAGEINFQKRLRGQFVKERKDSSLVLTAAQPEDAGIYLCA
Pteronotus parnellii V97 trav AWGZ01121557.1 1806 VSRGEKVDQNPSILSVQEGNTSVITCSYSDSASSYFPWYKQEAGKGPQLIIDIHSNKNKTKHEKLTILLNKKAKHFSLHIENTQPGDSALYFCAAN
Pteronotus parnellii V98 trav AWGZ01121994.1 6891 VCSDDKVIQSPPSLLVHAGDNATLNCRYEVSYSQSLQWYKQEERSPIFLFRLITSEVDYGRIRGTLDKKERLSTLHITATQPGDSATYLCAVE
Pteronotus parnellii V109 trdv AWGZ01142206.1 6900 FLMTQKVTRAQMTKTVLEGQTVTMDCMYQTTWTYYYLYWYKQLPSGQMVFLIYQSSSSQSALQGRYSVNFQKEKKIISLIISSLQLADSAKYFCALSD
Pteronotus parnellii V118 ighv AWGZ01151811.1 5312 VLCQWKLQESGPGLVKPSQTLSLTCTVSGGSVTSSDYWSWIRQPPGKALEWMGYWTGSTRYNPAFQGRISITADTSRNQFSLQLSSVTPGDTAVYYCAR
Pteronotus parnellii V121 ighv AWGZ01152244.1 20707 VLSAVQLQESGPGLVKPSQTLSLTCTVSGYSITSSCWNWLRQPQGKGLEWIGKICSGRDTYYSLTLKSRTSISSDTSKNQVSLQLSSMTTEDTAVYYCAG
Pteronotus parnellii V122 ighv AWGZ01152245.1 5852 ALSQGQLQESGPGQVKPSQTLSLTCTVSGFSITTSGDCWHWIRQPPGKGLEWIGCINYGGSTYYSPALKSRTSISRDTSKNQVSLQLSSMMTEDTAVYYCAK
Pteronotus parnellii V123 ighv AWGZ01152246.1 6561 VQCDVQLVESGGGLVQPGWSLRLSCTASGFKFDDYSMYWVCQAQGKELKWVSYINWDSGSIYYANSVKGRFTISRENSKNTLYLQMDSLRAEDTVLYYCAR
Pteronotus parnellii V125 trbv AWGZ01155107.1 1881 HLDAKVTQSPRYLVTGTEKEVTVKCDQTYNHDYMYWYRQDPGHGLRLIYYSYGVGMIDKGEVPNGYIVTRSNTEHFPLTLESTTPSQTSVYFCASSD
Pteronotus parnellii V126 trbv AWGZ01155109.1 2876 PTHAGVTQIPRHEVTEMGQDVTLSCEPITGHNELYWYRQTVGQGLKFMIYFLNRSLVEDTGMPKKRYSAQRPTGSCSTLKIQSTEPGDSAVYLCASSF
Pteronotus parnellii V128 trbv AWGZ01155110.1 335 PTHAGVTQTPRHKVTEMGQDVTLSCEPIAGHAALYWYRQTMGQGLKFMIYFNNQSPIDDTGMPNKRYSARMPNASFSTLKIQSTEPGDSAVYLCASSF
Pteronotus parnellii V129 trbv AWGZ01155110.1 3090 PTQAGVTQTPRHEVAEMGQDVTLSCKPKSGHTDIYWYRQTSVKGLVFMIYFNSRTVVDDTGMPNKRYSARMSNDSFSTLKIQSTEPGDSAVYLCASSFAPA
Pteronotus parnellii V130 trbv AWGZ01155111.1 333 PTQAGVTQTPRHEVTEMGQDVILSCEPISSHTYLYWYRQTSVQGLEFMIYFSSQSLMDDTGMPNKRYSARMPNASSSTLMIQSTEPGDSAVYLCASSF
Pteronotus parnellii V134 trav AWGZ01159922.1 65 GTRGDSVNQTEGLVTVPEAEFLTLNCTYQTTYTSSYYLFWYVQYQNKEPVFLLKSSSDNQEVNSQGFWATHVREERSFHLKKPSVQMSDSAVYFCAVR
Pteronotus parnellii V145 trav AWGZ01172090.1 45 SSLAQTVTQPQPEISVQETETVTLACTYDIRDSQYYLFWYKQPPSREMILIIRQESFRQQNATDNRFAVNFQKASKHFSLRISDSQLEDAAVYFCALSG
Pteronotus parnellii V152 trav AWGZ01177855.1 2092 VSGQQLTQSPQSMSIQEGEGISMSCSSSKMLNTLQWYKQEAGEGPVLLISLFKGGKLTSKGELMAYFGGTRKDSFLNISASEPAHSGTYFCAG
Pteronotus parnellii V154 ighv AWGZ01180594.1 135 VRSQAQLQESGPGLVKPSQTLSLTCTASGDSISSVYYWNWIRQPPGKGLEWVGSIRYSGSTYHNPSFKSRASISSDTSKNQFSLQLSTVSSEDSAVYYCAA
Pteronotus parnellii V161 ighv AWGZ01190392.1 5165 VHSQVLLVQSGAEVGRPGSTVKISCKTSGYTFTSSTMHWVQQAPGQRLEWIGRGYPGFGNANYAQNFQGRATITTDKSTNTVILDLKRLRTEDTAMYYCAR
Pteronotus parnellii V164 trdv AWGZ01193201.1 10912 KGMLCDKVTQSSLEQIVESGSEVTLPCAYDSEYSNPDLYWYRERSGHSFQFILYRDNNRALDADFTQGRFSVQHSQTHSTFNLVISSVRTEDRATYYCAITF
Pteronotus parnellii V168 trbv AWGZ01196771.1 10006 HTSAGVSQAPNHVVTNRGQNVSFQCDPISGHAGLYWYRQRQGHGPEFMISFQSKEVLDSSGMPNDRFSAVRPEGSSSRLRILPAEPGDSAVYLCASSS
Pteronotus parnellii V169 trbv AWGZ01196771.1 11166 SVAAGVTQSPRHLIKGRGGEAVLKCHPISGHKSLYWYLQARRQEPRFLIQYYEKEKYGEGNLPANFSGRVFSDYSSELAMNALQLGDSAVYLCASSL
Pteronotus parnellii V170 trbv AWGZ01196771.1 13356 PLDAGITQRPRYVITRRGKKVTLSCHQTDRHNALSWYGQDPGHGLRRIYFSVGVGLISKGQVPEGYSVNRSNIEDFPLTLESATPSQTSVYFCASSEGAS
Pteronotus parnellii V174 ighv AWGZ01201360.1 111 VWSQVQLQESGPGLVKPSQTLSLTCTVSGLSITSNDWSWIRQPPGKGLEWIGRINSGGSTYYSPSFKSRASISRDTSKNQFSLQLSSVSTEDSAVYYCAR
Pteronotus parnellii V208 ighv AWGZ01242618.1 2592 VLCQWKLQESGPGLVKPSQTLSLTCTVSGGSVTSNDYWHWIRQPPGKALEWMGRWSGGAKYNPAFQGRISITADTSRNQFSVQLSSVTPGDTAVYYCAR
Pteronotus parnellii V212 ighv AWGZ01244216.1 12173 VHSEVQLVQSGAEVRKPGASVKVSCKASGYTFTNYVMHWVRQAPGKGLEWMGWVYPYNGNTNYAQKFRGRVTMTADKSSSTAFMDLNSLKAEDTAVYYCAR
Pteronotus parnellii V216 ighv AWGZ01247737.1 913 VLSQVQLQESGPGLMKPSQTLSLTCTVSGFSLSSYAMHWVRQAPGKGLEWFGIIWSGESTDYNRTLKSRLSITKDNSKSQVYLTLNSLRADDTAMYYCAR
Pteronotus parnellii V219 trav AWGZ01249931.1 5675 RSNGDLVTQTEGPVTVSEEDSLTVNCSYESAMYPTLFWYVQYPGERPQVLLKAATVTEKGSNKGFEASYHRKPNSFNLEKRSPHVSDSATYYCVQM
Pteronotus parnellii V223 trav AWGZ01254340.1 336 VSRGEKVDQPPPTLSVPEGNTSVITCSYSDSGSDYFPWYKQEAGKGPELITYIRSTTNERKQERLTVVLRKTDKHFSLHIENTQPGDSAVYFCAAS
Pteronotus parnellii V226 ighv AWGZ01258554.1 3659 ALCQVQLVESGGGLVRPAASLTLSCKASGFTFTDYSMSWVRQAAGKGLEWVARVSKPSGDKQWYAPSVQGRFTISRDNPTNTVSLKMTNLKTEDTAVYYCTR
Pteronotus parnellii V232 trav AWGZ01266994.1 1672 LGGEDQVEQSPQALRIQEGESVSLTCSYTVSSFRGLQWYRQGPGKGLRSLFLLYSFEKEQQNERLTAILSQKGSSLSIKTPEAEDSATYFCAVE
Pteronotus parnellii V233 trav AWGZ01266994.1 3774 VSSKEEVNQSPAALPVREGDSFFLNCTYSSSGIYFLQWFRQRPGKGLTSLFLLRSNQREERNDRITALLDATSRHSALHISTSQLGDSATYLCAV
Pteronotus parnellii V234 trav AWGZ01266995.1 2292 VRGVQVEQSPPELNLQEGASSTLWCNFSTSVAYVQWFRRSPGGRLISLFYIPSGTKWNGNLKATKRERQSSLFISSSQTTDSAIYFCAVEPQCFP
Pteronotus parnellii V243 ighv AWGZ01280524.1 1413 AHSQVQLMQSGAEVRKPGASVKVSCKASGYTFTDYAMNWVRQPPAGALQYMGWINTKSGKPTYSQGFSGRFVFSMDTSVSTAYLQVNGLKSEDTAVYYCARQCDD
Pteronotus parnellii V249 trdv AWGZ01287400.1 623 FIMTQKVTQAQTTVPGQEGKPVTMDCTYETQWTNYALYWYKQLPSGEMVFLIYQYSSNPNAIQDRYSVNFEKAKNLISLRISSLQLADSAKYFCALWE
Pteronotus parnellii V254 ighv AWGZ01296710.1 4728 VVLQVQLQEWGTELLKPSQTIILTCAVYGYSITNGYCWTWIRQPLGKGLEWIGRICNDGNIYYSRSLKSRATISKDTSKNQFSLHLSSVTAEDTAVYYCA
Pteronotus parnellii V256 trbv AWGZ01299200.1 797 SMDAGVTQTPRNKIAKTGNSIILECTQNMNHDDMYWYRQDPGLGLRLIYYSIDVNDFNKGDISDGYTVSRKDKKKFSLFLKTASLNQTAVYFCASSY
Pteronotus parnellii V257 trbv AWGZ01299203.1 431 PMDAEVTQTSRYLVKRMGEKVVIECSQDMGHDRMFWYRQDPGLGLRLLHFSYGTGVYEKGDFPDGYSVFRPKEEEFSLTLGSASTNQTSVYLCASSV
Pteronotus parnellii V258 trbv AWGZ01299203.1 3902 SVFGTVISQKPRRFICQRGTSVTIECQADSQLVYMFWYRQLPGQSLTLIATANQGSDATYESGFNTIKFPISRPNLTFSTLTVGSVSPQDSSSYFCSAG
Pteronotus parnellii V259 trav AWGZ01299380.1 3303 MCLLIGTAGQSVQQPAVVKAMEGASVRVNCTYQTSGFNGLFWYQQRDGGTTVFLSYNVLDGLEKGGHFSSFLSRSDTYSYLLLKELQVKDSASYFCAVR
Pteronotus parnellii V264 ighv AWGZ01308307.1 2287 ILSEVRLQEAGPGLVNPSQTLSLTCTVSGYSITTSGPCWNWIRQPPGKGLEWIGRICYDGSTAYSPNLKSRASISRDTSKNQFSLQLSSMSTEDSAVYYCAR
Pteronotus parnellii V291 trbv AWGZ01339320.1 336 PTHAGVTQTPRHEVTEMGQNVTLSCEPISGHNDLYWYRQTSVQGLEFMIYFSSQSPMDDTGMPNKRYSARMPNASFSTLMIQSLEPGDSAVYLCASSF
Pteronotus parnellii V292 iglv AWGZ01339990.1 711 SWAVVSLTQPPTVTGAPGQSVTLSCAGSSNDVGYGSYVTWYQQQPGMAPKHLIYAVSYRLSETSDRFSGSKSGNTAFLTISGLKPEDEADYYCSSYRNPNS
Pteronotus parnellii V300 trdv AWGZ01347597.1 8866 SVRTQKVTQAQTTVTTHEGQAVILDCTYETTLSSYYLYWYKQHPSGKMVFLIYQLSSNRNATQDGYSVNFQKEKNFISLTISSLQLADSAKYFCALPD
Pteronotus parnellii V301 iglv AWGZ01347621.1 1488 SWAQSVLTQPPSVSGNPGQSVTISCTGSSSNIGGYSVQWYQQLPGKAPKLLIYSNSNRPSGVPDRFSGSKSGSSATLTISGLQAEDEADYYCSAWDSSLKA
Pteronotus parnellii V307 ighv AWGZ01349487.1 1506 VLSQMQLQESGPGLAKPSQTLSLTCAVTCYSITSSGYCWNWIRQPPGKGLEWIGYICYDGGTYYSPSLKSHTSISRDTSKNQFSLQPSSVSNKDMVVYYCAG
Pteronotus parnellii V312 ighv AWGZ01350997.1 7778 VWSQIQLQESGPGFVKPSQTLSLTCTVSGYSITSGYVWYWICQPPGKGLEWIGYIHYSGSTNYNPSFKSRASISRDTSKNQFSLQLSSVSTEDSAVYYCAR
Pteronotus parnellii V317 iglv AWGZ01352538.1 405 VDSQTVVTQEPPLSVSPGATVTLTCGSSSGSVSSGNYVNWYQQTPGKAPRTLINNTNRRPSGVPERFSGSISGNKAALTISGAQPEDEGDYYCGMHYSGSYF
Pteronotus parnellii V327 ighv AWGZ01009720.1 4210 VHSQVQLVQSGAEVRKPGASVKISCKASGYTFTSYGMIWVRQPPAGALQYMGWINTNTGKPTYAQGFSGRFVFSMDTAVSTAYLQVNGLKSEDTAVYYCA
Pteronotus parnellii V335 ighv AWGZ01020580.1 1800 VWSELQLQELGAGRVKSSQTLFLTCTVSGYSITSNYYWNLIHQSPGKGLEWIEYIDYSGRTHYNPSFKSCASFSRATSKNQFSLHLGSVSTDDSVMYYCA
Pteronotus parnellii V348 trav AWGZ01035417.1 2129 VSRGEKVDQPPPTLSVPEGNTSVITCSYSDSASDYFPWYKQEAGKGPELITYIRSTTNERKQGRLIVVLHKTDKHFSLHIENTQPGDSAVYFCAAR
Pteronotus parnellii V351 ighv AWGZ01041206.1 1762 VHPQVQLVQSGSEGRRPGSTVKVSCKASGYTFSSNYMHWVQQTPRQDLEWIGSVLPAIDIANYSQKFQGRATITADQTTSTAYLELKRLRTEDTAVYYCTK
Pteronotus parnellii V356 trbv AWGZ01048891.1 3554 HVSAGVTQLPSHRVIEKEQAVTLRCDPISGHETLFWYQHVAGKEITFLIRFLKEQVQDKSGMPDDDRFSAERTEGTFSTLKIQRARPGDSGVYFCASSL
Pteronotus parnellii V358 iglv AWGZ01049526.1 5619 SSSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTNNNYPYWFQQKPGQTPRTLIYNTNNKFSWTPARFSGSITGDRAALTLSGAQTEDEAEYYCALWYSSY
Pteronotus parnellii V366 ighv AWGZ01059458.1 6177 AGVGPRTGEALADPLSRLHFPCDSISIVNSWHWICQPPGKGLEWIRRIDYDGGTYYSPFFKSQASISSDTSKIRFSLQLSSVTTEDSAVYYCVG
Pteronotus parnellii V388 ighv AWGZ01088295.1 21204 VLSEVQVQQLGPGLVKPWQTLSITCTVSGFSITSSTCWNWMRQPQGKGLEWIGRMCYDGRTVYSSDFKSRASISRDMYKKQFSLQLSSLITEDSAVYYCAV
Pteronotus parnellii V390 ighv AWGZ01091681.1 6908 ALCQVQLMESGGGLVQPGGSLTLSCKASGFTFTDYNMNWVRQAAGKGLEWVATVSSPSGSNQRYAPSVQGRFIISRDNPTNTVSLKMTNLKPEDTAMYYCA
Pteronotus parnellii V397 ighv AWGZ01102041.1 12545 VLCELQLQESGPGLVKPTQTLSLTCTVSGSSVTSSYHWSWIRQPPGKALEWMGYWSGGSRYIPAFQGRISITADTSRNQFSLQLISVTPEDTAVYYCAS
Pteronotus parnellii V419 iglv AWGZ01139003.1 466 SWAQSGLTQEASVSGSVGQKVTLTCTGSSPAIRLFGAGWYQQVPGAAPKTVMLGTTRPPGIPDRFRGSKSRNTASLTITGLQPEDEGDYYCSIHDPSST
Pteronotus parnellii V436 ighv AWGZ01159447.1 9951 VLSQVQLQESGPGLVKPSQTLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYISGSGSTYYSPSLKSRASISRDTSKNQFSLQLSSVSTDDTAVYYCAR
Pteronotus parnellii V437 ighv AWGZ01159460.1 450 VHSEVQLVQSGAEVWKPGASVKVSCKASGYIFTSYIMYWVRQAPGKELEWVGLVNPNSGYTNYAQNFQGRVTITADKSTSTAFMDLSSLRAEDTAVYYCER
Pteronotus parnellii V438 ighv AWGZ01159462.1 886 IHSQVQLVQSGSEVRRPGSTVKVSCKASGYNNWVSWVRQAPAQGLEWIGMVDLRDDDTKYAQKFQGRATFTTEKSTSTAYLELKSLGTEDTAVYYCAT
Pteronotus parnellii V452 iglv AWGZ01176390.1 834 FAASYEVTQTSSVSVNLGQTARITCEGDNIGSKYASWYQQKPGQAPVTVIYSDSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYFCAAGHSSIN
Pteronotus parnellii V453 iglv AWGZ01177435.1 2243 SWAQAPPTQPSSVSGSLGQSVTITCAGSSSDVGYTNDVSWLQQQPGMAPKMLIYDVSKRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCASYTSS
Pteronotus parnellii V454 iglv AWGZ01177436.1 16978 SWAQSALTQPSSVSGTLRQSVTISCVGSSNDIGRYTYVSWYQQRPGTAPKLLIYYVNTRPSGIPDRFSGFKSGNTAFLMISGLQPEDEADYHCFSYVGS
Pteronotus parnellii V455 iglv AWGZ01177436.1 8280 SWAQAPLTQPSSVNGSPGQSVTITCAGSSSDVGYTNDVSWYQQQAGMAPKLLIYGVSSRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCSSYRGG
Pteronotus parnellii V456 iglv AWGZ01177436.1 4568 SWAQAPLTQPPSASGAPGQSVTITCAGSSNDVGSYNDVFWYQQQAGMAPKLLIYGVSSRPSGIPDRFSGSKSGSTASLTISGLQPEDEADYYCTSYSSS
Pteronotus parnellii V457 trav AWGZ01180598.1 2061 SSVAQTVTQPHPEVSVQEAETATLACTYDTSDSEYYLFWYKQPPSREMILIIRQESFRQENATDNRFSVNFQKASKHFSLRISDSQLEDAAVYFCALR
Pteronotus parnellii V459 ighv AWGZ01182206.1 2134 VHSQVQLVQSGSEVRRPGSTVKVSCKASGYTFSSNYVHWVRQTTSQGLEWIGSVLPFMDMTNYAQKFQGRATITADQSTSTAYLELKSLRTEDTAVYYCAK
Pteronotus parnellii V462 trav AWGZ01184468.1 479 VMGDAKSTQPDAVESTEDEVVRLPCNHSTISTNEYIYWYRQIPCQGPEYVIHGLRDNVTKQTAFLNIAADRKSSTLILPQVTLRDSAVYYCIIIY
Pteronotus parnellii V463 trdv AWGZ01184469.1 7514 FVRTQKVTQAQIAKTVLEGQAVTMDCTYETTWSNYYLYWYKKPPSGQMVFLIYQSSSSSNALEGRYSVNFQKERKFISLTISSLQLADSAKYFCALND
Pteronotus parnellii V464 ighv AWGZ01186630.1 2711 VQCDVQLVESGGGLVKPGGSLRLSCTASGFTFGDYGMNWARQAPGKGLEWVSYINWNSGSIYYANSVKGRFTTSRENSKNTLYLQMDRLRAEDTAVYYCAR
Pteronotus parnellii V467 ighv AWGZ01188576.1 14220 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVQWTRQVPGKGLEWVGTIWSGGSTYHNPRLKSRLSITKDTSKNLVYLTLNSLRAEDTAMYYCAR
Pteronotus parnellii V474 ighv AWGZ01201633.1 2252 AQCEVQLVESGGGLVKPGGSLRISCAASGFTISSHDMSWVRQAPGKGLELVSWISSGGSTYYANSVKGHFTISRDNAKNKLYLEMNNLKDEDTAVYYCTS
Pteronotus parnellii V497 ighv AWGZ01235380.1 17508 VVSQVQLQESGPGLVKPSQTLSLTCAVTGYSITSGSCWSWIRQPPGKGLEWIGYICYDGSTYYSPSLKSRTSITRDTSKNQFSLQMSSVINGDTAVYYCAR
Pteronotus parnellii V511 ighv AWGZ01256491.1 1258 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLSSKGVHWARQPPGKGLEWVGAISSVGNTYYYPGLKSRLSITKDNSKNQVYLTLNSLRTDDTAMYYCAR
Pteronotus parnellii V526 iglv AWGZ01276367.1 920 SWAQSVLTQPPSVSGALGQRVAFSCPGSSSNIRAGKYVSWYQLLPGKVPKLLIYGNSSRPSGVPDRFSGSRLGSSASLTISGLQAEDQADYYCAAWDNGLSA
Pteronotus parnellii V544 iglv AWGZ01292222.1 6671 SWAQFVLTQPRSVSGSLGQKTTISCTRSSGNIGGYYVSWYQQRPGSGPTTVIYKDDERPSGVPDRFSGSIDSSSNAAHLTISGLQPEDEADYYCQSYDGNS
Pteronotus parnellii V551 trav AWGZ01298910.1 1347 GTRAQSVTQPDGHITVSERTPLELRCKYSYGGAFSLFWYVQYPSQSLQLLLKYVTGATQVEGIKGFKAEFRKNETSFHLSKSSAHWSDSAMYFCALS
Pteronotus parnellii V553 ighv AWGZ01300553.1 901 VWSQVQLKELGPGTVKPSQTLSLTCTVSGKSITTSYTDWNWIRQPLGKGLEWIGLINNGGSTYYSPSFKSRASISRDTSKNQFFLQLSSVTTEDTAVYYCAG
Pteronotus parnellii V556 ighv AWGZ01307741.1 3733 VLSQVQLQESGPGLVKSSQSLSLTCMVSGLSLSSYGVHWARQSPGKGLEWVGVIWSGGSTNYNPALKSQLSITRDTSKSQDYLTLNNLRADYTAVYYCA
Pteronotus parnellii V567 trbv AWGZ01315167.1 3482 TVGGGITQTPKFLLRQEGSDVTLECEQDFGHNYMYWYRQDPGQGLRLVYISYGEMDVQKEDLAGGYWASREKKASFPLTVTSTQKNQTALYLCASSS
Pteronotus parnellii V573 ighv AWGZ01318516.1 2945 VWSQVQLQESGPGLVKPLQTLSLTCTVSGYSITSGNAWSWIQQPPGKGLEWIGSIDYSGSTYYRPSFKSRASITRDTSKNQFSLQLSSVSTKDSAVYYCASGGI
Pteronotus parnellii V581 ighv AWGZ01324835.1 8375 VWSQVQLQESGLGLVNPLQTLSLTCTVSGYSITSNYYWMWIRQTPGKGLEWIGDISYGGITNYSPSFKSRASISRDTSKNQFFLQLNSVSIEDTAVYYCAR
Pteronotus parnellii V582 ighv AWGZ01325507.1 740 AQCEVQLVESGGSLMKPGGSLRLSCVASGFTISSYVMTWVHQAPGKGREWLSLISNGGSIYFATSVKDRFTISRDNAKNELYLEMNNLRAEDTAIYYCAG
Pteronotus parnellii V584 iglv AWGZ01326582.1 1254 AWAQSGLTQEASVSGSLDQTVTLTCTGNSNNVGHHGANWYQHLPGAVPRQLIYGSSSRPSGIPARFSGSRSGTTASLTISGLQPEDEADYYCATWDKSLSV
Pteronotus parnellii V585 iglv AWGZ01326583.1 6611 SVFAGSLSQPVLTQPPSLSASPGATARLTCTLSSGLSVGDYYISWYQQTPGSPPRYLLNYKSDSDKGQGSGVPSRFSGSKDASANAGLLLVSGLQPEDEADYYCG
Pteronotus parnellii V588 ighv AWGZ01329053.1 4241 VQCDVQLVESGGGQVQPGRSLRLSCRASGFNFGDYSMHWVRQVPGKRLEWVSYINWDSSSIYYTNSVEGRFTTSRDNSKNTLYLQTNSLRAEDTAVYYCA
Pteronotus parnellii V589 ighv AWGZ01329054.1 15493 VQCDVQLVESGGDLVQPGWSLRLTCTASGYKFDDHGMDWVRQAPGKGLEWVSYISSSSGSIYYADSVKGRFTISRDKSKNELYLQMNSLRAEDTAMYYCTR
Pteronotus parnellii V591 ighv AWGZ01330006.1 10784 VLSEVQLQESGPGFLKPSQTLSLTCTVSGYSITSSSCWHWIRQPTGKGLEWIGRICNSGDIYYNPNLKSRASISRDTSKNQISLQLNSMTTEDTAVYYCAG
Pteronotus parnellii V594 ighv AWGZ01332454.1 9629 VQCEVQLVESGGGLVQPGGSLKLSCVASGFPFSSAGMNWVRQAPGKELEWVAIIWYDGSQKYYADSVKGRFTISRDNAKNTLYLEMNNLRPEDTAIYYCTN
Pteronotus parnellii V600 ighv AWGZ01338302.1 14458 VWSKVQLQESGPGLVKPFQTLSCTVSGYSITSGFEWSWIHRPSGKRLEWIGLIDRGGSSHYSLSFKSHTSIFRDTSKNQFFLQLSSMSTEDSAVYYCAR
Pteronotus parnellii V601 ighv AWGZ01338302.1 11489 VLSQVQLQESGPGLVKPSQTLSLTCTVSDESITTGYTPWSWIRQSPEKGLEWIGYIDYDGYTNYSPSFKSRTSISRNTSENQFSLQLSSMTTEDSAVYYCAV
Pteronotus parnellii V604 ighv AWGZ01341407.1 3877 VQSQVQVMESGPETLKPSQTLSLTCTVSASSNIFSYSDWGWIHQPPRKGLEGIGYISYYGSINYNPSCKSRASISRDTSKKQFSLQLSSVSTEDSAVYYCAR
Pteronotus parnellii V613 ighv AWGZ01351593.1 22630 VLSQVKLQESGLGLVKPSQTLSLTCTVSGFSLTNYDVQWARQAPGKGLEWVGVIWSGGSTYYNPALKSRLSITRDTSKSQVYSPLNSLRADDMTVYYCAR
Pteronotus parnellii V617 ighv AWGZ01352632.1 4921 VWSQVQLQETGPGLVNPSQTLSLTCTVSGHSIATSGYYWSWIRQPPGKGLEWIGYIYSSGSTYYSPSFKSRASISRDTSKNEFSLQLSSVNTEDTAVYYCAR
Pteronotus parnellii V619 trdv AWGZ01353675.1 615 QGFIRTQKVIQAHTAVTGQEEPVAMDCMYETTWSNFYLYWYKQPPSGEMVFLIYQFSPYPNALQDCYTVYFQKSKKFISLTISSLQLGDSAKYFCVLWK
Pteronotus parnellii V622 trav AWGZ01356070.1 4103 VCSDDKVIQSPPSLLVHAGDNATLNCRYEVSYSQSLQWYKQEERSPIFLFRLITSEVDYGRIRGTLDKKERLSTLHITATQPGDSATYLCAVE
Pteronotus parnellii V625 trav AWGZ01356849.1 19130 VTSDAKSTQPDAVESTEGETVHLPCSHSTISGSEYIYWYRQIPLEGPEYVTHGLKDNVTKGIAILNIAADRKSSTLILPQVTLRDSAVYYCIVRD