WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Melanochromis auratus ABPL00000000.1 (ABPL01) 19 7 1 5 2 3 1 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Melanochromis auratus Vs41 igkv ABPL01054219.1 559 SQMFSSVHQESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGQKPKIISHFFKYNVNNSSNEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVYYL
Melanochromis auratus Vs12 ighv ABPL01016882.1 135 VYSIDLIQPESRSVQPGQSLTITCQVSGYSMTDDSYATGWIRQREGKVMDWISHQWGTSGLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Melanochromis auratus Vs4 igkv ABPL01003114.1 616 SRGQYTVTQPGAVSSAVGGTVSIKCRTSQNVGVWKNNHLLAWYQQKDGGVPKRLIYLASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Melanochromis auratus Vs5 igkv ABPL01003534.1 852 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVHSNNHILAWYQQKDGGVPKLLIKYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Melanochromis auratus Vs6 trbv ABPL01003620.1 163 GSSFSDQVHQTPPNIYTKEDAKIYCSHSISGYYTILWYKQSEKQLQFLGYMLNDEGNPETGVNVTMDGDARQHKNCTLTIKDVKVSSSGVYFCAAR
Melanochromis auratus Vs26 ighv ABPL01001352.1 560 LNGQAMESIPSTPVVKKPGDTLSLSCRGSGFSFGCCVMIWVREPXGKPLEWIGVGHIPSSSNRYVSSLIGRIEVSRDDSNSMVHLRLSNLKPEDSAVYYCA
Melanochromis auratus Vs8 trbv ABPL01005385.1 47 GSSLSDQVDQTPADIYTKGEDVEIHCSHSISSYETILWYKQTEKKLQLLGYMLNDRGYPETGVNVMMDGDARQHKSCILTIKDIKVSSSGVYFCAAR
Melanochromis auratus Vs38 ighv ABPL01033474.1 600 VKCEQLTQPASVTVRPGQHLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGDAHYGHNTYYKDSLKNKFTSNLDTSSKTVTLNGQNMQPEDTAVYYCARI
Melanochromis auratus Vs33 ighv ABPL01017731.1 914 LHGQTLTESGPVVKRPGESHRLTCTASGFTFSSYEMGWIRQVPGKGLEWIAQIWESGNRAFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Melanochromis auratus Vs36 igkv ABPL01031245.1 675 SQMFSSVHQESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGQKPKIISHFFKYNVNNSSNEELKNNPRFTLDTQDGKYHLTIKDLQVSDSASYYCVYYL
Melanochromis auratus Vs27 trgv ABPL01002005.1 463 EQLIQDDLTLTRRVGESVSFSCGGINKCDGDWIYWYQKKENETFKVILDIHKTNGVIDKTYDHPQKDDFSAENKQNSCELKIEKIKLDHSATYYCSCYKLG
Melanochromis auratus Vs10 iglv ABPL01006342.1 808 VSGVTVLTQKPPVLSVRKGETATVDCNLGTVTGSNARWYKQIPGEVPQFVLRFYHSWGSPTYGSGFSAPKFTSTHQSTTDYRLIISKVEEGDSAVYYCK
Melanochromis auratus Vs31 ighv ABPL01009181.1 1101 TEGQTLTESGPVVKRPGDSHRLTCTYSGFSGNIYAVWIRQAAGKGLEWIARISDDSNYISYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Melanochromis auratus Vs21 igkv ABPL01059871.1 500 TAITDIIQVPQSGPLHPGNPVTLQCSVLSNPENSACPGNDSVFWFSTRSDNSHPNLIYADGNSDKCERSPEASSTQKCVYSFSKNVSSSDAGSYYCAV
Melanochromis auratus Vs20 ighv ABPL01058344.1 380 VDCQTLTQSEPAVKRPGESHRLTCTGSGFTFSSYWIHFIRQAPGKGLEWIALIYTDSSKAFYSPSVQGQFIISRDNSREQLYLQMNSLKTEDCAVYYCARD
Melanochromis auratus Vs18 trav ABPL01043514.1 610 LTEGDEDPFQSSITVTKLGDNVTLTCKIPRDDVGLSYWYKLNFGNLIETIASGSFDQISRKGPFNNSRFNATKVGDIYSLTITNASQEDEATYFCQ
Melanochromis auratus Vs19 trbv ABPL01044224.1 28 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYDTILWYKQSEETLQLLGYLRFGKGYPEPGVNVTIDGGANVKEKCRLTIKEFELSSSAVYFCAAS
Melanochromis auratus Vs25 trav ABPL01000253.1 661 CKGEDKVIQEQGDVIAAEGDTVTLYCKYETTSTFPYLFWYKQDVNDYLKYVLRRDASGTENAQEFPKDRFDAELNKTSVSLEIQKLQLSDSAVYYCALQ
Melanochromis auratus Vs44 ighv ABPL01080036.1 366 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVHSYWTHWNRQAPGKGLEWIGRAAFGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQIEESAVYYCARD