WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Nomascus leucogenys ADFV00000000.1 (ADFV01) 169 28 20 33 41 36 5 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Nomascus leucogenys V18 trav ADFV01006260.1 35339 MMTGTIETMGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTMNDTGEYFCIYHTYPDGT
Nomascus leucogenys V159 trbv ADFV01062069.1 9531 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKFEFLVSFYSDKVSDKSEIFDEQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Nomascus leucogenys V160 trbv ADFV01062069.1 17149 SLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDAMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPESPDKAHLNLHVKSLELGDSAVYFCASS
Nomascus leucogenys V161 trbv ADFV01062069.1 21789 PIDTEVTQTPKHLVMGISNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPKSSLLNLHLHALQPEDSALYLCASSQ
Nomascus leucogenys V162 trbv ADFV01062069.1 29960 HTEPEVTQTPSHQVTQMGQEVILQCVPISNHLRFYWYRQILGQKIEFLLYFFDGKISEKSEIVDDRFSAARPDGSPFTLKIQSTKLEDSATYFCASSE
Nomascus leucogenys V163 trbv ADFV01062069.1 35841 HTEPEVTQTPSHQVTQMGQEVILQCVPISNHLHFYWYRQIMGQKIEFLLYFFNGKISEKSEIVDDRFSAARPDGSPFTLKIQSTKLEDSATYFCASSE
Nomascus leucogenys V164 trbv ADFV01062069.1 42335 SLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYRNKEPILNETVPNRFSPDSPDKAHLNLHIKSLELGDSAVYFCASSQ
Nomascus leucogenys V165 trbv ADFV01062069.1 46365 PIDTEVTQTPKHLVMGMTNKKSLECEQHMGHNAMYWYKQKAKKPPELMFVYNYEKLSINESVPSRFSPECPKSSLLNLHLHALQPEDSALYLCASSQ
Nomascus leucogenys V166 trbv ADFV01062069.1 54250 PVEAGVTQTPRYLIKTRGQQVTLSCSPISGHQSVFWYQQTPGQGLQFLFEYFSETQREKGNFPDRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Nomascus leucogenys V167 trbv ADFV01062069.1 61553 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSVGEGTTDKGEVPDGYNVSRLNTQDFSLRLESAAPSQTSVYFCASSE
Nomascus leucogenys V168 trbv ADFV01062071.1 8282 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSAVEGITDKGEVSDGYNVSRLNKQNLLLRLVSAAPSQTSVYFCASSE
Nomascus leucogenys V169 trbv ADFV01062071.1 16303 PLDTAVLQTPKYLVTQTGKKESLKCEQNLGHNAMYWYKQDSKKFLKIMFSYSNKEPILNETVPNRFSPESPDKSHLNLHISSLELGDSAVYFCASSQ
Nomascus leucogenys V170 trbv ADFV01062071.1 19709 PMETGVTQTPRHLVMGMTNKKSLKCEQDLGHNAMYWYKQSAEKPLQLMFVYNLKEQIENNSVPSRFSPECPNSSHLFLHLHALQPEDSVLYLCASSQ
Nomascus leucogenys V171 trbv ADFV01062071.1 27838 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSTGEGTTDKGEVSDGYDVSRSNTQNFLLRLESAAPSQTSVYFCASSE
Nomascus leucogenys V172 trbv ADFV01062073.1 25103 PVMAGITQAPRSQILAVGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLMHYSNTVGTTGKGEVPDGYSVSRANTDDSPLTLASAVPSRTSVYFCASSD
Nomascus leucogenys V173 trbv ADFV01062075.1 639 PVDSGVTQTPKHLITAIGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERERGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSI
Nomascus leucogenys V174 trbv ADFV01062075.1 8447 HRDAEITQSPRYKITETGRQVTLKCHQTWNHNNMFWYRQDLGHGLRLIHYSFGVPDTGKGEVSDGYSVSRSKTEDFPLTLESAASSQTSVYFCASSE
Nomascus leucogenys V175 trbv ADFV01062075.1 33397 HTGAGVSQSPRYKVTKKGQDVALRCDPISGHVSLYWYRQTLRQGPEFLTYFNYEAQQDKSGLLSGRFSAERPEGSVSTLKIQRTEQGDTAVYLCASSL
Nomascus leucogenys V176 trbv ADFV01062075.1 40694 PVETGVTQSPTHLIKTRGQQVTLRCSPMSGHTSVYWYQQVLGQGLQFLLWYNEEAERERGNFPRRFSGRQFPNYSSELNVNASLLEDSALYLCASSL
Nomascus leucogenys V177 trbv ADFV01062075.1 60058 SVETGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQTLGQGPQFIVQYYREEENGRGNFPPRFSGRQFPDYSSELNVNASLLEDSALYLCASSL
Nomascus leucogenys V178 trbv ADFV01062075.1 69336 HADTGVSQDPRHKITKRGRNVTFRCDPISEHNSLYWYQRTLGQGPEFLTDFQNEAQLDKSGLLSDHFSAERPKGSFSTLKIQRTEQGDSAMYLCASSL
Nomascus leucogenys V179 trbv ADFV01062075.1 75855 SVAAGVIQSPRHLVKEKRETATLKCYPIPGHDTVYWYQQGPGQGPQFLISFYEKMQNDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Nomascus leucogenys V180 trbv ADFV01062075.1 83967 HMDAGITQSPRHKVTETGTPVTLRCHQTENHCYMYWYRQDLGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSNTEDFLLTLGSATHSQTSVYFCAISE
Nomascus leucogenys V181 trbv ADFV01062075.1 95776 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Nomascus leucogenys V182 trbv ADFV01062076.1 7832 PVDAGVTQSPTHLIKMRGQQVTLRCSPISGHTSVYWYQQALGQGPQFIIQYYEEEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Nomascus leucogenys V183 trbv ADFV01062078.1 2553 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNQAPLDDSGMPKDRFSAKMPDATLATLKIQPAEPRDSAVYLCASGL
Nomascus leucogenys V184 trbv ADFV01062078.1 10223 HIEAGVTQFPSHRVIEKGQTVTLRCDPIPGHDYLYWYRRVMGKEIKFLICFLKESIQDESGMPNNRFSAKSTGGTYSTLTVQPAELEDSGVYFCASSQ
Nomascus leucogenys V185 trbv ADFV01062079.1 3582 HGDGMVIQNPRYQVTQLGKPVTLSCSQNLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAVYLCATSR
Nomascus leucogenys V186 trbv ADFV01062079.1 8564 SPGEEVTQTPKHLVKGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENIFDETGMPKERFSAKCLLNSPRSLEIQATKLKDSAVYFCASSQ
Nomascus leucogenys V187 trbv ADFV01062079.1 12481 HLEPGVSQTPRHKVAEIGQEVILRCDPSSGHLFVHWYRQNLRQEMKFLISFQYQNIAVDSGMPKERFTAERPNGMSSMLKIHPTEPRDSAVYLCSSG
Nomascus leucogenys V188 trbv ADFV01062081.1 6628 SGLGTVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSTVTYEQGVKKGKFPINHPNLTFSTLTVTSAHPEDSSFYICSAR
Nomascus leucogenys V189 trbv ADFV01062081.1 16585 SMDTKVTQRPRLLVKANEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLVYLQNEEIIQKAEIINERFSAQCPKNSSCTLEIQSTESGDTALYFCASSK
Nomascus leucogenys V190 trbv ADFV01062082.1 9026 LMEADIYQTPRYLVIRTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Nomascus leucogenys V191 trbv ADFV01062084.1 20832 LLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEAVDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Nomascus leucogenys V192 trbv ADFV01062084.1 25537 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVQMKEKGDIPEGYSVSREKKEHFSLILESASTNQTSMYLCASSL
Nomascus leucogenys V193 trbv ADFV01062085.1 303 SVFSAVVSQKPSRDICQRGTSLTIQCQVNSQVTMMFWYRQQPGQSLTMIATANQGSEATYESGFVIDKFPISCPNLSFSTLTVSNMSPEDSSIYLCSVE
Nomascus leucogenys V302 igkv ADFV01106193.1 6406 SRGEIVLTQSPAFLSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLVKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDVATYHCQQSSSL
Nomascus leucogenys V303 igkv ADFV01106193.1 26069 TTREIVLTQSPATLSLSPGEKATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGATNRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQKYGS
Nomascus leucogenys V304 igkv ADFV01106193.1 39462 VRCDIQMTQSPSSLSASVGDRVTITCRASQSISNDLTWYQQKPGKAPTLLIYDATNLHTGVPSRFSGGGSGADYSLTISSLQLEDFATYYCQQEYSYP
Nomascus leucogenys V305 igkv ADFV01106193.1 68382 SRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYDASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYKSYP
Nomascus leucogenys V306 igkv ADFV01106193.1 80549 TTGEIVLTQSPATLSLSTRERATISCTASQSVSSYLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYKSFS
Nomascus leucogenys V307 igkv ADFV01106195.1 6887 SRCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Nomascus leucogenys V308 igkv ADFV01106195.1 36551 VRFDIQMTQSPSFLSASVGDRVSITCRAREGISSDLSWYRQKPGKSPKLFLYDAKDLHPGVSLRYSGMGSGTDFTLTIISLKTEDFATYYCKQEFSYP
Nomascus leucogenys V309 igkv ADFV01106195.1 45399 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKPLIYDASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Nomascus leucogenys V310 igkv ADFV01106195.1 64647 ARCDIQMTQSPTSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Nomascus leucogenys V351 iglv ADFV01126738.1 7861 SLSQSVVTQPASLSASPGASARLTCTLRSGINVGSYRISWYQQKPGSPPQYLLNYYSDSDKGQGSGVPSRFSGSKDASTNAGISLISGLQSEDEADYYCMI
Nomascus leucogenys V352 iglv ADFV01126738.1 12676 SWAQSVLTQPSSVSGTPGQRVTISCSGSSSNIGSNNVYWYQQLPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCEAWDDSLSG
Nomascus leucogenys V353 iglv ADFV01126740.1 9364 SLSQPVLTQPSSLSASPGASARLTCTFSGGIIVGGYHIFWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Nomascus leucogenys V354 iglv ADFV01126741.1 7039 SWAQSALTQPPSVSAAPGQKVTISCSGSRSDIGNYAVSWYQQLPGTAPKLLIYENNKRPSGISDRFSGSKSGTSASLGVTGLQTGDEANYYCLAWDSSLSA
Nomascus leucogenys V355 iglv ADFV01126741.1 12575 SWAQSVLTQPPSVSGSPGQRVTIFCTGSSSNIGEGYYVHWYQQLPGTAPKLLIYENNKRPSGISDRFSGSKSGTSASLAIAGLQTGDEADYYCQSYDSSLSA
Nomascus leucogenys V356 iglv ADFV01126742.1 25245 SWAQSVLTQPPSVSGTPGQRVTISCSGSSSNIGSNNVYWYQQLPGTAPKLLIYYNNQRPSGVPDRFSGSKSGTLASLAITGLRSEDEADYYCEAWDDSLSG
Nomascus leucogenys V357 iglv ADFV01126755.1 18503 SVASYELAQPSSVSVSPGQTARITCSGDVLAKKYAQWFQQKTGQSPVLLIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Nomascus leucogenys V358 iglv ADFV01126756.1 8464 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASD
Nomascus leucogenys V359 iglv ADFV01126759.1 54 SVASYELIQPPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPVLVIYKDSERPPGIPERFSGCTSGNTATLTISRVLTEEEADYYCLSGDEDN
Nomascus leucogenys V360 iglv ADFV01126759.1 7255 SATSYELTQPPSVSVAPGQTAKITCGGNNIGSKNVYWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISAVEAGDEADYYCQVWDSTSDH
Nomascus leucogenys V361 iglv ADFV01126759.1 16007 SVTSYELTQPRPVSVAPGQTARITCGGNDIGNKYVYWYQQKPGQAPVLVIYEDSNRPSGIPERFSGSNSGNTATLTISAVEAGDEADYYCQVWDSSSKH
Nomascus leucogenys V362 iglv ADFV01126760.1 18691 SVASYELTQPPSVSVSPGQTAKITCSGDALPKKYAYWYQQKSGQTPVLIIYEDSKRPSGIPERFSGSSSGTMATLTISGTQVEDEADYYCYSADSSGNH
Nomascus leucogenys V363 iglv ADFV01126760.1 26182 SVASYELTQPLSVSVAPGQTARITCGGNNIGSKAVQWHQQKPGQAPVPVIYGNSNRPSGIPERFSGSNSGNTATLIISGAQAGDEADYYCQVWDSSSK
Nomascus leucogenys V390 ighv ADFV01136575.1 15727 VQCVVQLVESGGGLVQPGGPPRLCCAASGFTFSSYWMHWVRQAPGKGLVWVSHINSDGSSTSYADSVKGRFTISRDNAKNTLYLKMNSLRAEDTAVYYCTR
Nomascus leucogenys V391 ighv ADFV01136793.1 1290 AHSKVQLVQSGTEVKKPGASVKVSCQDSGYTLTDYSKHWVRQTPGKGLQWMGGFDPVDGETVNSQKFQRRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
Nomascus leucogenys V392 ighv ADFV01136793.1 10262 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYDMSWVRQAPGKGLEWVSYISSGGSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Nomascus leucogenys V397 igkv ADFV01138112.1 5362 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISNDLNWYQQKPGKAPKLLIYYASSLQSGIPSRFSGSGSGTTYTLTISSLQPEDFATYYCQQGYSTP
Nomascus leucogenys V485 trav ADFV01192032.1 8213 MYLVLGTTGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHDGEAPTFLSYNVLDGLEEKGHFSSFLSRSKGYSYLLLKKLQMKDSASYLCAVR
Nomascus leucogenys V486 trav ADFV01192035.1 8557 GLRAQLVAQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLQFLLKYIAGDNLVKGSYGFEAEFNKSQTSFYLKKPSALVSDSALYFCAVR
Nomascus leucogenys V487 trav ADFV01192035.1 21782 TLSLAKTTQPISMDSYEGQEVNITCSHNNIGTSDYIMWYQQFPSQGPRFIIQGYKTNVINEVASLFIPADRKSSTLSLPGVSLSDTAVYYCLVG
Nomascus leucogenys V488 trav ADFV01192035.1 53090 MNRGEDVEQSLFLGVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDLKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Nomascus leucogenys V489 trav ADFV01192035.1 63804 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLLWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Nomascus leucogenys V490 trav ADFV01192035.1 73448 ANGEKQVEHSPHFLGSQQGDVASVSCMYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD
Nomascus leucogenys V491 trav ADFV01192035.1 87831 DARAQSVSQHNHHVILSEAASLELGCNYSYGGTVYLFWYVQYPDQDLQLLLKYFSGDPLVKGIKGFEAEFMKSKFSFNLKKPSVQWSDTAEYFCAVN
Nomascus leucogenys V492 trav ADFV01192035.1 102007 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLLLKAMKANDKGRNKGFEATYHKETTSFHLEKDSVQEADSAVYFCALS
Nomascus leucogenys V493 trav ADFV01192037.1 3181 GSCKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPVSLTIMTLSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVV
Nomascus leucogenys V494 trav ADFV01192037.1 7176 VNRLHTLEQSPSFLNVQEGMHAILNCTYQERTLFNFHWFRQDPRRGLVSLTLIQSSQKEQGDKYFKELLGKEKFYSVWNIPASHPGDSATYFCAL
Nomascus leucogenys V495 trav ADFV01192037.1 20253 VWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSVSQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYIYLLIRDSQLSDSATYLCAV
Nomascus leucogenys V496 trav ADFV01192037.1 26002 GTRAQSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKSSAHVSDAAEYFCAVS
Nomascus leucogenys V497 trav ADFV01192037.1 31701 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGRGLQLLLKYFSGDTLVQGIKGFEAEFQRSQSSFNLRKPSVHWSDAAEYFCAVS
Nomascus leucogenys V498 trav ADFV01192038.1 2364 VNGENVEQHPSTLSVQEGESSVIKCTYSDSASNYFPWYKQELGKGPKLIIDIRSNVGEKKDQRITVTLNKTAKHFSLHITEIQPGDSAVYFCAAS
Nomascus leucogenys V499 trav ADFV01192038.1 22030 VWSQQKEVEQNSGPLSDPEGAIASLNCTYSDRSSQSFFWYRQYSGKSPELITSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCAV
Nomascus leucogenys V500 trav ADFV01192038.1 28542 GTRAQSVTQLDSHVSVSEGTLVLLRCNYSSSVSPNLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKPSAHVSDAAEYFCAVS
Nomascus leucogenys V501 trav ADFV01192038.1 50419 VSRGESVGLHLPTLSVQEGNNSVINCAYSDSASDYFTWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Nomascus leucogenys V502 trav ADFV01192039.1 5011 PGIAQKIIQTQPAMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLISQASYDKQNATEGRYSLNFQKARKSANLVISASQLGDSAKYFCAMRE
Nomascus leucogenys V503 trav ADFV01192039.1 24311 RTHGDSVTQMEGPVTLSEEAFLTINCTYTATGYPTLFWYVQYPGEGPQLLLKATRADDKGSNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Nomascus leucogenys V504 trav ADFV01192039.1 50027 VWCQQKEVEQNPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKCISLFIRNSQPSDSATYLCAMS
Nomascus leucogenys V505 trav ADFV01192039.1 63755 GTRAQSVTQLDSQVPVFEEGPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYTSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDAAEYFCAVS
Nomascus leucogenys V506 trav ADFV01192039.1 75573 GTRAQRVTQPEKLLSVFEGAPVELKCNYSYSGSPELFWYVQYPKQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Nomascus leucogenys V507 trav ADFV01192039.1 82784 VNSQQGEEDPQALTIQEGENATMNCSYKSSTNSLQWYRQESGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCAME
Nomascus leucogenys V508 trav ADFV01192039.1 88349 RTNGDSVTQTEGPVTLPEQAALTLNCTYQSSYSTFLFWYVQYLNKAPELLLKSSENQETDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCALR
Nomascus leucogenys V509 trdv ADFV01192039.1 91531 SSMTQKVTQAQTEISVVEKEDVTLDCVYESRDTTYYLFWYKQLPSGELVFLIRQNSFNEQNEINGRYSWNFQKSTSSFNLTITASQVMDSAVYFCALND
Nomascus leucogenys V510 trav ADFV01192040.1 2623 LSGEDQVTQSPEALRLQEGENSSLICSYTVSNLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKEESFLHITAPKPEDSATYLCAVQ
Nomascus leucogenys V511 trav ADFV01192040.1 15511 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLIIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAV
Nomascus leucogenys V512 trav ADFV01192042.1 5849 VRGIQVEQSPPDLILQEGANSTLRCNFSATVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTTERYSLLYISSSQTTDSGVYFCAVEPQCSP
Nomascus leucogenys V513 trdv ADFV01192042.1 28972 SSVAQEVTQAQSSVSMPVGKAVTLNCLYETSSWSYYIFWYKQLPSKEMILLIRQGSAEQNAKNGRYSVNFKKAANSIALTISALRLEDSAKYFCALGE
Nomascus leucogenys V514 trav ADFV01192042.1 37853 VSSVLNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYKWETAKSPKALFVMNLNGDEKKKGRINATLNTKEGYSYLYIKGSQPEDSATYLCAF
Nomascus leucogenys V515 trav ADFV01192042.1 45519 VNGQQIMQIPQCQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Nomascus leucogenys V516 trav ADFV01192042.1 56529 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNATNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Nomascus leucogenys V517 trav ADFV01192042.1 66294 GTRAQSVTQLDGHIIVSEEAPLELKCNYSYSGVPSLFWYVQYPSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAAG
Nomascus leucogenys V518 trav ADFV01192042.1 88223 VRSQQPVQSPEAVILREGEDAIINCNSSKVLYSVHWYRQKRGEAPVFLMILLKGGEQKSHDKISATFNEKKQQSSLYLVASQLSYSGTYFCGAE
Nomascus leucogenys V519 trdv ADFV01192042.1 97071 SSMSQRVIQSQPAISTQEGETVKLDCSFKTNIVYYILYWYKRPPNEKIIFLIYQQTDADTNATQGQYSVSFQKATETIQLIISSSQPEDSATYFCCLKE
Nomascus leucogenys V520 trav ADFV01192045.1 4924 TMGDAKITQPNSMKSNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYMIHGVTSNVNKRMASLTIAEDRKSSTLILHHATLRDAAVYYCVLR
Nomascus leucogenys V521 trav ADFV01192045.1 9670 VGSQELEQSRQSLIVEEGKNLTIKCMSSKTLYGLYWYKQNYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSMHITASEPSHAGIYLCGAD
Nomascus leucogenys V522 trav ADFV01192045.1 24691 VSGQQLNQSPQSMSIQEGEDVSMNCISSSIFNTWLWYKQDPGEGPVLLMALYKAGELTPNGRLTAQFGITRKDSFLNISASIPSDVGTYFCAG
Nomascus leucogenys V523 trav ADFV01192045.1 29461 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSGILDNRELFSILNITATETRDSAIYLCAVE
Nomascus leucogenys V524 trav ADFV01192049.1 620 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTTESDYYLFWYKLPPSRQMILIIRQEAYKQQNATENHFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Nomascus leucogenys V525 trav ADFV01192049.1 9726 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTTESDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAYR
Nomascus leucogenys V526 trav ADFV01192050.1 14953 LSGELKVGQNPPFLSTQEGKNYTIYCNYSTISDRLYWYRQDPGKSLESLFVLLSSGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAV
Nomascus leucogenys V527 trav ADFV01192052.1 11473 VSDAKNEVEQSPQDLTAQEGEFITINCSYSIGITALQWLQQHQGGGIVSLFMLSSGKKKNGRLMATINIQEKHSSLHITASQPRDSAIYICAV
Nomascus leucogenys V528 trdv ADFV01192054.1 20529 VSLDIILEPDTKALTVIIGEAATFRCSVTGGDPKNYQMSWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Nomascus leucogenys V529 trdv ADFV01192055.1 7710 VMSAIELVPEHQTVTVSVGVPATLRCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGRGFKDNFQGDIDIAKDLAILKILAPSERDEGSYYCASD
Nomascus leucogenys V646 trgv ADFV01046568.1 1542 TSGDNLTTQLVTSVTKKKGNTAFLECQIQSSTFKKNVYIHWYHQKPDRPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Nomascus leucogenys V647 trgv ADFV01046571.1 49474 SQKSSNLEGRTKSVTRPTGSSAEITCDLTVTDTFYIHWYLHQEGKAPQRLLYYDVSDSRDVLESGLSQVKYYTHTPRRWSWILILRNLIENDSGVYYCASWG
Nomascus leucogenys V648 trgv ADFV01046571.1 34818 SQKSFNLEGRTKSVTGPTGSLAVITCDLPVENAVYIHWYLHQEGKAPRRLLYYVFSTSKVVLESGISLGKYHTYASTRRSFKFILENLIEHDSGVYYCATWD
Nomascus leucogenys V649 trgv ADFV01046571.1 20955 HLEQPQISSTKTLSKTARLECVVSGVTISATSIYWYRERPGEVIQFLVSISYDGTVRKELGIPSGKFEVDKIPETSTSTLTIHNVEKQDIGTYYCALWE
Nomascus leucogenys V650 trgv ADFV01046573.1 906 SQKSSNLEGRTKSVTRPTGSSAEITCDLPGASTLYIHWYLHQEGKAPQRLLYYEPYYFRVVLESGITPGKYDTASTRSSWNLRLQNLIEKDSGVYYCATWD
Nomascus leucogenys V692 trbv ADFV01062096.1 5755 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Nomascus leucogenys V790 igkv ADFV01106195.1 112355 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSVLYSSNNKNYLNWYQQKPGQAPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSYSTP
Nomascus leucogenys V791 igkv ADFV01106214.1 15614 TSGDIVMTQTPLSLPVTPGEPTSISCRSSQSLLHSDGCTYLAWYLQKPGQSPQLLIYAVSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQAP
Nomascus leucogenys V792 igkv ADFV01106214.1 6758 ARCDIQMTQSPSSLSASVGDSVTITCRASQGISNWLAWYQQKPGKAPKLLIYKASSLQSGIPSRFSGSGSGTTYTLTISSLQPEDFATYYCQQSYSTP
Nomascus leucogenys V861 ighv ADFV01131933.1 10361 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYNMYWVRQAPGQGLEWMGVINPSSGGTSYAQKFQGRVTMTRDTSISTAYMELSSLRSEDTATYYCAR
Nomascus leucogenys V862 ighv ADFV01131938.1 4158 AHSQVQLVQSGAEVKKPGTSVKVSCKASGYTFTSYAMNWARQAPGQRLEWMGWINTNTGNPTYAQGFKERFVFSMDTSVSTAYLQISSLKAEDTAVYYCAR
Nomascus leucogenys V863 ighv ADFV01131939.1 1326 AHSQVQLVQSGAEVKKPGTSVKVSCKASGYTFTSYAMNWARQAPGQRLEWMGWINTNTGNPTYAQGFKERFVFSMDTSVSTAYLQISSLKAEDTAVYYCAR
Nomascus leucogenys V864 ighv ADFV01131940.1 27855 VQCDVQLVESGGGLAQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSYISGDSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
Nomascus leucogenys V865 ighv ADFV01131940.1 19618 VLSQVTLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLARIDWDDDKYYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Nomascus leucogenys V866 ighv ADFV01131940.1 4200 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQPPGKGLEWIGSIDSSGSKYLNPSLKSRVTMSADTSKNQFSLKLSSVTAADTAVYYCAR
Nomascus leucogenys V867 ighv ADFV01131944.1 775 VQCAVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVAVIRNKANGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAE
Nomascus leucogenys V868 ighv ADFV01131946.1 472 AHSEVQLVQSGAEVKKPGATVKISCKVSGYTFTSYYMHWVQQAPGKGLEWMGGVDPEGGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAR
Nomascus leucogenys V869 ighv ADFV01131948.1 8912 VLSQVTLKESGPALVKPTETLTLTCTVSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDQKSYSTSLKSRLTISKDTSKSQVVLAMTNMDPVDTATYYCARR
Nomascus leucogenys V870 ighv ADFV01131950.1 18435 VQCEVQLVESGGSLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVSEITNSSTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Nomascus leucogenys V871 ighv ADFV01131950.1 7901 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQPPGKGLEWIGYIYSSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAEDTAVYYCAR
Nomascus leucogenys V872 ighv ADFV01131951.1 13253 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWVRQAPGKGLEWVSYISSGGGTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAK
Nomascus leucogenys V873 ighv ADFV01131951.1 4899 VLSQVQLQQWSAGPVKPSETLSLTCAVYGGSISGYYWGWIRQPPGKGLEWIGLIDSSGSTNYNPSLRSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Nomascus leucogenys V874 ighv ADFV01131954.1 962 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSVAYLQMNSLKTEDTAVYYCTR
Nomascus leucogenys V875 ighv ADFV01131956.1 7558 VQCEVQLVESGGGLVQPGASLKLSCAASGFTFSSYGMHWVRQAPGKGLEWVSSISTSSSYIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Nomascus leucogenys V876 ighv ADFV01131956.1 2865 VCAEVQLVQSGAEVKRPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGMIYPSDSDTRYSPSFQGHVTISADKSISTAYLQWSSLKASDTATYYCA
Nomascus leucogenys V877 ighv ADFV01131957.1 4569 VLSQVQLQESGPGLVKLSETLSLTCAVSGGSISGYYWSWIGQPAGKGLEWIGYIHSSGSTNYNPSLKSRVTMSADTSKNQFSLKLSSVTAEDTAVYYCAR
Nomascus leucogenys V878 ighv ADFV01131958.1 11153 AHSQVQLVQSGPEVKKPGASVKVSCKASGYTFTSSAMQWVRQAPGQGLEWMGWIIVGNGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAT
Nomascus leucogenys V879 ighv ADFV01131959.1 1154 AHSEVQLVQSGAEVKKPGATVKISCKASGYTFTSSYMHWVQQAPGKGLEWMGRVDPEDGETKYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Nomascus leucogenys V880 ighv ADFV01131961.1 56710 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHSVRQAPGKGLEWVGRIKNKADGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Nomascus leucogenys V881 ighv ADFV01131961.1 47952 AAVESGGGLVQPGGSLRLSCVASGFTFSNYAMGWVRQAPGKGLEWVSSISGSGSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Nomascus leucogenys V882 ighv ADFV01131961.1 18811 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVSYISSGGGTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
Nomascus leucogenys V883 ighv ADFV01131961.1 7954 VQSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGVIIPAADLTNYAQKFQGRLTITADTSTSTAYMELSSLRSEDTAVYYCAR
Nomascus leucogenys V885 iglv ADFV01132915.1 108165 SWANFMLTQPHSVSGSVGQKVVISCARSSGSIGSYYVQWYQQRSGSAPTTVIYKDNQRPTGAPDRFSGSIDSSSNSASLTISGLETEDEADYYCQSYDSSN
Nomascus leucogenys V886 iglv ADFV01132915.1 88454 SVVQAGLTQAPSVSKGLRQTATLTCTGNSNNVGNEGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLR
Nomascus leucogenys V887 iglv ADFV01132915.1 78737 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIASRYVHWYQQRPGSAPTTVIYDDVPRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSADDSYN
Nomascus leucogenys V888 iglv ADFV01132915.1 69567 SWAQSVLTQEASVSGTVGQKVTLSCTGNSNNVGTYTVGWYKQISHGAPKTVMLGNSRPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCSTWDYSLN
Nomascus leucogenys V889 iglv ADFV01132915.1 64460 SLSQPVLTQSPSASASPGASVKLTCTLSSGHSSYTIAWHQQQPEKAPRYLMKLSSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWGSG
Nomascus leucogenys V890 iglv ADFV01132915.1 35741 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIASNYVHWYQQRPDSAPTTVIYSDDQRPSGVPDPFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSSS
Nomascus leucogenys V891 iglv ADFV01132918.1 64150 SWAQSVLTQPPSVSGTPGQRVTISCSGSSSNIGSNNVHWDQQLPGTAPKLLIYYNDQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDDSLSG
Nomascus leucogenys V892 igkv ADFV01132961.1 261933 ARCDIQMTQSPSSLSVSVGDRVTITCRASQGISNELAWYQQKPGQAPMLLIYAASSLQTGVPSRFSGSGSGTDYTLTISSLQPEDVATYYCLQDYTTP
Nomascus leucogenys V893 igkv ADFV01132961.1 244491 SSENIGMTQIPLSLPVTLGEPASISCRSSQSLMDSDHGFTYLYWYLQKPGQSPQLLIYFVSYRASGVPDRFSGSGSGTDFTLEISRVKAEDVGFYYCMQSRELP
Nomascus leucogenys V894 igkv ADFV01132961.1 226307 ATCDIQMTQSPSSLSASVGDRVTITCRASQGINNELAWYQQKPWKDPKLLIYSASNLLMGVPSQFSGSGPGTDYTLTISSLQPEDAATYYCQWDYNTP
Nomascus leucogenys V895 igkv ADFV01132961.1 219569 SSGDIVMTQTPLSLPFTPGEAASISCRSSQSLLDSDGYTYLDWYLQKPGQSPQLLIYAVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQALQAP
Nomascus leucogenys V896 igkv ADFV01132961.1 212865 TSEDIVMTQTPLCLPVTPGEPASISCRSSQSLLHSDGYTYLDWFLQKPGQPPQLLIYEVSYRVSGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Nomascus leucogenys V897 igkv ADFV01132961.1 187185 STGDIVMTQTPLFLSITLGEPASISCRSSQSLFYSDDQNIYLDWYLQKPGQSPQLLIYFVSYRASGVPDRFSGSGSGTDFILKISRLEAEDVGVYYCMQRIEFP
Nomascus leucogenys V898 igkv ADFV01132961.1 183271 PSGDIVMIQTPLSLPVTTGEPVPISCRSSQSLLPNDGYTYLYWFLQKPGQSPQLLIYFVSYRASGIPDRFSSSGSGTDFALKVSRVGAEDTGVYYCMQA
Nomascus leucogenys V899 igkv ADFV01132961.1 175893 ARCDMQMTQSPSSLSASVGDTVTITCRASQSISSYLNWYQQKPGKIPKLLIYAASTLQSGVPSRFSGSGSGTDFTVTISSVQPEDFATYYCQHGYGTP
Nomascus leucogenys V900 igkv ADFV01132961.1 143834 SSADIVMTQTPLPLPITLGEPASISCKSSQSLLHSNGNTYLYWYLQKPGPSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Nomascus leucogenys V901 igkv ADFV01132961.1 133625 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLRYSDGNTYLYWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDLQAP
Nomascus leucogenys V902 igkv ADFV01132961.1 122833 ARCAIQMTQSPSSLSASVGDRVTITCRTSQGISNWIAWYQQKPGKAPKHLIYGASNLQTGVPSRFSESGSGTDYTLTVSSLQPEDSTTYYCQQYDIFP
Nomascus leucogenys V903 igkv ADFV01132961.1 113295 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYKVSNRASEIPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSTKVS
Nomascus leucogenys V904 igkv ADFV01132961.1 92287 IRCAIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASSLETGVPSRFSGSGSGTDFALTISSLQPEDIATYYCLQYDNLP
Nomascus leucogenys V905 igkv ADFV01132961.1 65412 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGKTYLYWFQQRPGQPPRRLIYQVSNRDSGVPDRFIGSGAGTDFTLKISRVEAEDVGVYYCMQG
Nomascus leucogenys V906 igkv ADFV01132961.1 54882 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLRHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQGIQLP
Nomascus leucogenys V907 igkv ADFV01132961.1 41728 SSGNIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLYWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVKAEDVGVYYCMQTLQTP
Nomascus leucogenys V908 igkv ADFV01132961.1 33433 TRCDIQMTQSPSSLSASVGDRVTITCRASQSISKWLAWYQQKPGKVPKLLIYAASTLQSGVPSRLSGSGSGTDFTLTISSLQPEDVATYYCQKHDSA
Nomascus leucogenys V909 igkv ADFV01132961.1 15063 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLVHSNGNTYLNWIQQRLGQPPRLLIYKVSNRASGVPERFSGSGAGTDFTLKISRVEAEDVGVYYCLQG
Nomascus leucogenys V923 igkv ADFV01141314.1 1403 TSGDIVMTQTPHSLPVTPGEPASISCGSSQSPLHSNGYTYLYWYLQKPGQSPQLLIYAVSNRASGFPDRFSGSGSGTDFTLKMSRVEAEDVGVYYCMQALQAP
Nomascus leucogenys V925 ighv ADFV01143437.1 4092 VQCEVQLVESGGSLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVGRIKNKAGGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Nomascus leucogenys V926 ighv ADFV01143437.1 1030 ATGGVWGRLIKALGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSVISTSGGTILYTDSVKGRFTVSRDNAQNSLYLQMNSLRAEDTAVYYCVK
Nomascus leucogenys V929 igkv ADFV01161864.1 2036 TSEDIVMTQTPLCLPVTPGEPASISCRSSQSLLHSDGYTYLDWFLQKPGQPPQLLIYAVSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQAP
Nomascus leucogenys V997 trdv ADFV01192057.1 9241 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWFRIRPDYSFQFVFYGDDSRSQAADFTQGRFSVKHILTQKAFHLVISPVRIEDSATYYCAL