WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cebus capucinus imitator LVWQ00000000.1 (LVWQ01) 195 40 36 30 37 40 8 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cebus capucinus imitator V150 igkv LVWQ01046461.1 986 VRGNTVLTQSPALLSVSLKDTISISCKANQSISDYLTWYQQKPGQAPKILIYDADNLYSGVSSRFSGIQSETDFILTISSVEADDAATYYCQQDYAVP
Cebus capucinus imitator V218 trav LVWQ01064486.1 8796 MCLIIGTAGQNIGQPTEVTAMEGAIVQIKCTYQTTGFNGLSWYQQRDGKAPTFLSYNVLDGLEEKGHFSSFLNRSKRYSYLLVKELQMKDSASYLCAVR
Cebus capucinus imitator V219 trav LVWQ01064494.1 10708 GLRAQSVAQPEDRVTVAEGNPLTVKCTYSVSGLPYLFWYVQYPNQGLQFLLKYVTGDNLVKGSCGFEAEFNKSQTSFHLKKPFALVSDSALYFCAVR
Cebus capucinus imitator V220 trav LVWQ01064496.1 3385 TWSLAKTTQPISMDSYEGQEVNISCSHDNIATSDYIFWYQQFPNQGPRFIIQGYKTNVANEVASLFIPADRKSSTLSLPRVDLSDTAVYYCVVG
Cebus capucinus imitator V221 trav LVWQ01064496.1 11228 MSSGEDVEQSLFLSVREGDSVVINCTYTDSSSSYLYWYKQEPGASLQLLAYILSNMDVKQDQRLTVQLDKKNKHLSLRIAETQTGDSAIYFCAES
Cebus capucinus imitator V222 trav LVWQ01064496.1 20962 DARGQSVSQPDYHVILSEGASLELRCNYSYGGIVYLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAEFMKSRSSFNLRKPSVQWSDTAEYFCAVK
Cebus capucinus imitator V223 trav LVWQ01064496.1 31398 GINGDSVVQTEGEVLLSEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKATKGNDKGRSNKDFEAMYRTETTSFHLEKGSVRESDSAVYFCALS
Cebus capucinus imitator V224 trav LVWQ01064497.1 2325 GNGKNQVEQSPQSLVILQGKNCTLQCNYTVTPFNNLRWYKQDAAKGPVTLIIMTFSENTKSNGRYTATLDANTKQSSLHITASQLSDSASYICVV
Cebus capucinus imitator V225 trav LVWQ01064497.1 14362 VWSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSASQSFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLSRASQYLSLLIRDSQLSDSATYLCAV
Cebus capucinus imitator V226 trav LVWQ01064497.1 20186 GTRAQSVTQLDGQVTVSEGAPVLLKCTYSSSVSAVYLFWYVRHPNQGLQFLLKYVSGSTLVKGIKGFEAEIKKSESSFHLKKSSAHVSDAAEYFCAVS
Cebus capucinus imitator V227 trav LVWQ01064497.1 23506 DARAQSVTQPDLHITVSEGASLELRCNYSYGATAYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFKAEFKRSQSSFNLRKSSVHWSDAAEYFCAVS
Cebus capucinus imitator V228 trav LVWQ01064497.1 39611 VNGENVEQRPSTLSVQVGDSSVINCTYSDSASTYFPWYKQELGKGPRLIIDIRSNADKRKDGRMTVLLNKAAKYFSLHITDTQPGDSALYFCAAG
Cebus capucinus imitator V229 trav LVWQ01064497.1 49567 VNSLHMLEQSPSILSNQEGTHAFLNCTYQERTFFSFHWFWQDPGKGLVSLTLIQSSQKEQRDEHFKELLGKEKFYRVLNISTSHPGDSATYFCAL
Cebus capucinus imitator V230 trav LVWQ01064497.1 59357 VWSQQKVEQNSGPLNIPERVTASLNCTYSDRGSQSFYWYRQYSGKSPELLMSIYSNGDEEDGRFTAQLSRASQYVSLLIRDSQLSDSATYLCAV
Cebus capucinus imitator V231 trav LVWQ01064497.1 63674 GTRAQSVTQLDGQVTVSEGAPVLLKCTYSSSVSVYPFWYVRYPNQGLQFLLKYVSGPTLVKGIKGFEAEIKKSESSFHLKKSSAHVRDAAEYFCAVS
Cebus capucinus imitator V232 trav LVWQ01064497.1 70346 VWSQQKEVEQNPGPLSVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLMLIYSSDKTEDGRFTAQLNKSSQYTSLFIRDSQPSDSATYFCAM
Cebus capucinus imitator V233 trav LVWQ01064497.1 82589 GTRAQSVTQLDSQVPVSEGTAVELRCNYSFSFSLSLFWYVQYPNQGLQLLLKYASGPTLVKGINGFEAEFKKNETSFHLRKPSAHISDAAEYFCAVN
Cebus capucinus imitator V234 trav LVWQ01064498.1 1198 ETRAQRVTQPEKTLSVFEGAPVHLKCNYSYFGSPELSWYVHYPKQRLQLLLRQIPRESVKGFTADLNKGETSFHLEKPFSQEEDSATYYCVLS
Cebus capucinus imitator V235 trav LVWQ01064498.1 9390 VNSQQGEEEPQTLSIQEGKNAIMNCSYKTSIRSLQWYRQDSNRGLTQLILIFSNERKKYSGRLRFMLDTSMKSSSLFIAAAQAADTAAYFCATE
Cebus capucinus imitator V236 trav LVWQ01064498.1 14884 RTYGDSVTQTEGPVTLPEGAALTLNCTYESRYTVFLFWYVQYLNKEPQLFLKSSENQEMDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCALR
Cebus capucinus imitator V237 trdv LVWQ01064499.1 872 SSMAQKVTQAQTEISVVEKEDVTLDCVYETSDTTYYLYWYKQPPTREMIFLIRQSSFNEQNEINGRYSWNFQRSTSSFNLTITASQVIDSAVYFCALSE
Cebus capucinus imitator V238 trav LVWQ01064500.1 4624 LSGEDQVTQSPEALRLQEGDSSSLNCSYTVSNLRGLLWYRQDPGKGPEFLFILYSAGEEKQKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Cebus capucinus imitator V239 trav LVWQ01064500.1 14845 VSSKQEVTQIPAALSVPEGDSLVLNCSFTDSAIYYLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGHSTLYIAASQPGDSATYLCAV
Cebus capucinus imitator V240 trav LVWQ01064501.1 10393 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Cebus capucinus imitator V241 trdv LVWQ01064501.1 27811 SSVAQKVTQAQLPISMPVGKTVTLNCLYETREEFYCIFWYKQLPSRKIVFLIRQCSSHQNAKNDRYSVNFQKARKSIDFTISALQLEDSATYLCALRE
Cebus capucinus imitator V242 trav LVWQ01064501.1 36215 VSSITNVEQSPQSLRVQEGDSTNFTCRFPSSNFYALHWYRWETAKSPKNLFVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGSQPEDSATYLCAI
Cebus capucinus imitator V243 trav LVWQ01064501.1 41545 VNGQQIMQIPHFQHVQEGEDFTIYCNSSTTLNNIQWYKQRPGGHPVFLIRLVKSREVMKQKRLTFQFGEARMNSSLHITAAQTTDVGTYFCA
Cebus capucinus imitator V244 trav LVWQ01064502.1 8268 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSQGPQYVIHGLKNNETNEMASLIIAEDRKSSTLILPHATLSDTAVYYCIVRV
Cebus capucinus imitator V245 trav LVWQ01064502.1 14661 GTRAQSVTQLDGHITVSEGASLKLRCNYSYSGTPYLFWYVQHPSQSLQLLLKDLTGATQVKGIKGFEAEFKKSETSFHLRKPSAHVSDTAVYFCAVS
Cebus capucinus imitator V246 trav LVWQ01064502.1 30605 VSAQQLEQSPWFLSIQEGENVTMYCNSSSVFTNLQWYRQDPGEGPVLLVKLVKAGEVTKQKRLIFHFGDARKDSSLHITAAQPGDTGLYLCAG
Cebus capucinus imitator V247 trav LVWQ01064503.1 34022 IMGDAKTTQPNSMESNEEQPVHLPCNHSTMSGDDYIYWYRQLPSKGPEYVIHGLKSNVNNRMASLTIAEDKKSNTLILHRATLRDAAVYYCILR
Cebus capucinus imitator V248 trav LVWQ01064504.1 1468 ISSQELEQSPQSLIIQEGKNITINCRSSKALYALHWYKQKYGEGLIFLMMLQKGGEEKTHEKITAKLDEKKQQSSLHITASQPSHTGIYLCAAD
Cebus capucinus imitator V249 trav LVWQ01064504.1 12724 VSGQQMNQSPQSMSIQEGEDVSMNCTSSSTFNTLLWYKQDTGEGPVLLIALYKSGELTRNGRLTAQFGITRKDSFMNISASVPGDVGTYFCAG
Cebus capucinus imitator V250 trav LVWQ01064504.1 17507 VSSEDKVVQSPPSLVVHEEDSVTLNCSYEAANFRSLLWYKQEKKAPTFLFILTSSGIEKKSGSLSSILDKTEHFSILNITATQTRDSATYLCAVE
Cebus capucinus imitator V251 trav LVWQ01064505.1 7047 SSMAQTVTQSQPEMSVQEAETVTLNCTYDTSESNYYLFWYKQPPRRQMILIIRQEAFKPQNATENRFSVNFQKAAKFFSLKISDVQLGDTAMYFCAYR
Cebus capucinus imitator V252 trav LVWQ01064505.1 16200 FSIAQRVTQSESEMSVQEAETVTLNCTYDSSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDVQLGDTAMYFCAYR
Cebus capucinus imitator V253 trav LVWQ01064505.1 35008 LRGELKVGQSPLFLSTQEGKNCTIYCNYSTTASDRLHWYRQDPGKSLESLFVLLANGAVIQEGQLTASLDTKARLSTLHITAPVHGLSATYFCAV
Cebus capucinus imitator V254 trav LVWQ01064506.1 6259 GTNSNSVKQTDQVTISEGASVTMNCTYTSTGYPTLFWYVQYPNKPLQFLQEETMENSKNFGARNIKDKNSPIVKHSVQVSDSAMYYCLLRDTVLR
Cebus capucinus imitator V255 trav LVWQ01064506.1 11976 VSAAKNEVQQSPQELTVQEGELITINCSYSVGITTLQWLQQHPGGGIVSLFTLSSENKKNGRLIATINLQEKHSSLHITASQPRDSAIYICAV
Cebus capucinus imitator V256 trdv LVWQ01064509.1 16116 VSLDIILESDTKALTVLAGEAASFRCSVTGGDLKNYQVSWYKKSEDKALILVFKLSNSSKYNLGNNFMGRIDALKNLFMLDIQKATTKDVGTYYCASD
Cebus capucinus imitator V257 trdv LVWQ01064509.1 37303 AMSAIELVPEHQTVTVSLGDPATLRCSMKGEAITNYYISWYRKTQGNTMTFIYREKNIYGPGFKDGFQGEIDPEKDQAVLEILAASERDEGSYYCASD
Cebus capucinus imitator V391 trbv LVWQ01105664.1 43973 ARSQTIHQWPATLVQPVGSPLSLECTVKGTSNPYLYWYRQSADRGLQLLFSSLSVDQINSEVPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Cebus capucinus imitator V392 trbv LVWQ01105678.1 6652 PMDTGVTQTPKHLVMGRTNKKSLKCEQHLGHNAMYWYKQKAKTPPELMFVCSYKEISVNESVPSRFSPDCSDSSHLYLHLHALQPEDPALYLCASSQ
Cebus capucinus imitator V448 ighv LVWQ01126690.1 9373 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMSWVRQAPGQGLEWMGRIDPENGNTRYAQNFQGRVTMTADTSTSTAYMELSSLRSEDTAVYYCAR
Cebus capucinus imitator V449 ighv LVWQ01126690.1 15435 AHSQVQLVQSGAEVKKPGSLVKVSCKASGYTFASYGMQWVRQAPGQGLEWMGWINTNTGATGYAQKFQGRVTMTRDMSTSTTYMELGSLRSGHGTMYYCTR
Cebus capucinus imitator V450 ighv LVWQ01126693.1 5545 VLCEVQLVESGGGWVQPGGSLRLSCAASGFTFSSHDIYWVRQAPGKGLEWVSAINSSGVTYYADSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCG
Cebus capucinus imitator V451 ighv LVWQ01126693.1 12827 AHSQVQLVQSAAEVKKPGSSGKVSCKASGYTFTSYYMHWVQQAPGQGLEWMGRIDPGNGNTNYAQKFQGRVTMTSDTSTSTAYMELSSLRSEDTAVYYCPR
Cebus capucinus imitator V452 ighv LVWQ01126693.1 19631 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVGVIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSSLRAEDTAVYYCAK
Cebus capucinus imitator V453 ighv LVWQ01126695.1 6318 VQCKEQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMYWIRQALGKGLEWVSAIRYDGGNIYYADSVKGRFTISREDAKNTLYLQMNSLRAEDTAVYYCAK
Cebus capucinus imitator V454 ighv LVWQ01126697.1 2274 VQCEVQLVESGGDLIQPGGSQRLSCAASEFTFSDYWMNWVRQAPGKGLEWVASIKYDGSTKYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCVK
Cebus capucinus imitator V455 ighv LVWQ01126697.1 10562 VCAEVQLVQSGAEVKRPGESLKISCKASGFTGNWIGWVRQMPGKGLEWMGMIDLRDSETRYSPSFQGQVTISADKSTSTAYLQWSSLKSSDAATYYCAR
Cebus capucinus imitator V456 ighv LVWQ01126697.1 21434 VLSQVTLKESGPAQVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLAHIYWDDDKCYSSSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Cebus capucinus imitator V457 ighv LVWQ01126698.1 4963 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGVIYPSSGGTNYTQKLQGRVTITRDTSTSTAYMELSSLISEDTAVYYCAK
Cebus capucinus imitator V458 ighv LVWQ01126702.1 2130 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVHQAPGKGLEWVAFISYNGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAK
Cebus capucinus imitator V459 ighv LVWQ01126702.1 7500 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMDWVRQAPGKGLEWVSYISSTGGSTSYADSVKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCTK
Cebus capucinus imitator V460 ighv LVWQ01126703.1 2804 VCAEVQLVQSGAEVKRPGESLKISCKASGYNFNSYWISWVRQMPGKGLEWMGRIYPGDSDTEYSPSFQGQVTISADKSTSTAYLQWSSLKASDAATYYCAR
Cebus capucinus imitator V461 ighv LVWQ01126707.1 1064 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVSAINAGGSSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Cebus capucinus imitator V462 ighv LVWQ01126711.1 1064 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVSAINAGGSSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Cebus capucinus imitator V463 ighv LVWQ01126711.1 13020 VHSQVQLVQSGPELKQPEASVRVSCKASGYTFSSYAINWVRQVPGQGLEWMGWINTNTGKPTYSQGFTGRFVFSMDTSVSTAYLQISSLKAEDTAMYYCAR
Cebus capucinus imitator V464 ighv LVWQ01126711.1 16374 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSDYWWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTLSADPSKNQFSLRLSPVAAADTAVYYCA
Cebus capucinus imitator V465 ighv LVWQ01126711.1 22743 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKKYYADSVKDRFTISRDNSKNMLYLQMNSLRAEDTAVYYCVK
Cebus capucinus imitator V466 ighv LVWQ01126711.1 31462 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAFISYNGGSTSYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAS
Cebus capucinus imitator V467 ighv LVWQ01126715.1 420 VLSQVTLKESGPAQVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALELLAHIYGNDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAQR
Cebus capucinus imitator V468 ighv LVWQ01126716.1 4417 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMSWVRQAPGKGLEWVSYISSGGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V469 ighv LVWQ01126716.1 9746 AHSQVQLVESGAEVKKPGSSVKVSCKASGYTFTSYFMHWVRQAPGQGLEWMGWINPYNGNTKYAQKFQGGVTITRDTSTSTAYMELSSLRSEDTAVYYCAR
Cebus capucinus imitator V471 iglv LVWQ01128435.1 9159 VDSQTVVTQEPSFSVSPGGTVTLTCGLNSGSVSTSYYPSWYQQTPGQAPRMLIYSTNNRPSGVPDRFSGSILGNKAALTITGVQADDESDYYCMLYVGSGI
Cebus capucinus imitator V472 iglv LVWQ01128435.1 33291 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSSNYPHWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCSVYYSGA
Cebus capucinus imitator V473 iglv LVWQ01128435.1 51085 SWAQTVLTQPTSVSGTPGQRVTISCSGSSSNIGSNSVNWYQQLPGTAPKLLIYGTSNRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCLAWDSSLS
Cebus capucinus imitator V474 iglv LVWQ01128436.1 29 CWAQSVLTQPPSVSGNPGQRVTISCSGSSSNIGSYYVYWYQQLPGTAPKLLIYYNNQRPSGVSDRFSGSKSGNSASLTITGLQSANEADYYCQSYESNLN
Cebus capucinus imitator V475 iglv LVWQ01128438.1 44 CWAQSVLTQPPSVSGTPGQRVTISCSGSSSNMGSNYVYWYQQLPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLAITGLRLEDEADYYCAAWDSSLSA
Cebus capucinus imitator V476 iglv LVWQ01128438.1 13323 CWAQSVLTQPPSVSGNPGQRVTISCSGSSSNIGGYDVHWYQQLPGTAPKLLIYGNNQRPSGVSDRFSGSKSGTSASLAITGLQSADEADYYCQSYDSNLDA
Cebus capucinus imitator V477 iglv LVWQ01128438.1 33462 SVVQAGLTQPSSVSEGLRQTATLTCTGNSNNVGNEGAAWLQQHQGHAPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Cebus capucinus imitator V478 iglv LVWQ01128438.1 39042 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSYVHWYQQLPGNAITTVIYEDKQRPSGVPDRFSGSIDSSSNSASLTISGLQPEDEADYYCLSYGDSSN
Cebus capucinus imitator V479 iglv LVWQ01128438.1 50726 SWAQSGLTQKASVSGSVGQKVTFSCTGNSNSIGGYTVGWYQQISHGAPKTVMLGSSRPSGIPDRFSGSQSGTTASLTISGLQPEDEADYYCSTGDKSLS
Cebus capucinus imitator V480 iglv LVWQ01128438.1 69089 SLSQPVLTQSPSASAALGASVKLTCTLSSGHSSYAIAWHQQQPGKAPRYVMTLTGSGSYNKGDGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWSSG
Cebus capucinus imitator V481 iglv LVWQ01128438.1 76849 SLSQPVLTQPSSHSEPSGASARLTCTLSSGFSVGDFSIRWYQQKPGNPPRYLLYYHSDSDKGQGSGVPSRFSGSSDASANAGILHISGIQPEDEADYYCSA
Cebus capucinus imitator V482 iglv LVWQ01128438.1 84582 CWAQSVLTQPPSVSGTPGQRVTISCSGSSSNVGSSYVSWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGNSASLAITGLRAEDEADYYCFTWDSSLS
Cebus capucinus imitator V483 iglv LVWQ01128438.1 90264 CWAQSVLTQPPSVSGTPGQRVTISCSGSSSNIGSTYASWYQQFPGTAPKLLIYDNNKRPSWVSDRFSGSKSGNSASLTITGLQAADEADYYCQSYDINLNA
Cebus capucinus imitator V484 iglv LVWQ01128438.1 104569 SLSQPVLTQPAFLSGSPGASARLTCTLRSDVSVGGKVIYWYQQKSESAPRYLLYYHTDSDKHQGAGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCVI
Cebus capucinus imitator V485 iglv LVWQ01128439.1 3705 SWAQSVLTQPHSVSGNPGQRVTISCSGSSSNIGSNYVNWYQQVPGKAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQPEDEADYYCETWDDSLS
Cebus capucinus imitator V486 iglv LVWQ01128447.1 6435 SATSYDLTQPRSVSVAPGQTARITCGGNNIGGSYVHWYQQKSGQVPVLVIYQDSNRPSGIPERFSGSSSGNTATLTISGVEAGDEADYYCQVRDSSSDN
Cebus capucinus imitator V487 iglv LVWQ01128447.1 13652 SWAQSALTQPRSVSGSPGQSVTITCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSSRPSGVPNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Cebus capucinus imitator V488 iglv LVWQ01128448.1 9103 SATSYDLTQPRSVSVAPGQTARITCGGNNIGSKYTYWYQQKSGQAPVLVIYKDSNGPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCEVWDSSSDN
Cebus capucinus imitator V489 iglv LVWQ01128451.1 7961 SAASYELTQPRSVSVAPGQTARITCGGNSIGSKNVHWYQQKSGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCRVWDGSNKY
Cebus capucinus imitator V490 iglv LVWQ01128453.1 953 SVVSSELTQDPAVSVALGQTARITCQGGGIGTYYASWYQQKQGQAPVLVIYANNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCGSWDSSGTH
Cebus capucinus imitator V491 iglv LVWQ01128455.1 5839 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYRVSNRPSGVPNHFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Cebus capucinus imitator V497 ighv LVWQ01131451.1 8932 VHSQVQLVQSGAEVKKPEASVKVSCKASGYDFSTYGISWVRQAPGQGLEWMGGIIPIFGITNYAQKFQGRVTMTADTSTSTAYMELSSLRSEDTAVYYCAR
Cebus capucinus imitator V499 iglv LVWQ01132764.1 3583 SDASYELTQPPSVSASPGQTARITCSGDALPDKYAHWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTISGAQAEDEADYYCFSADSSSTY
Cebus capucinus imitator V500 iglv LVWQ01132767.1 5855 FAASYELTQPRSVSVAPGQTARITCGGNNIGSKYVHWYQQKSGQAPVLVIYYNSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQLWDSSNKH
Cebus capucinus imitator V501 iglv LVWQ01132767.1 9351 SSTSYELTQPHSVSVAPGQTARITCGGNNIGSKYVHWYQQKSGQAPVLVIYDNSNRPSGIPERFSGSNSGNTVTLTISGVEAGDEADYYCQVWDSSSDN
Cebus capucinus imitator V502 ighv LVWQ01132875.1 1725 VQCEVQLVESGGGLVQPGGSLRFSCAASGFTLSSYAMSWVRQAPGKGLEWVSYISGGGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V503 ighv LVWQ01132876.1 6611 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIGTGGSTYYADSMKGRFTISRDNARNSLYLQVSSLRAEDTAVYYCV
Cebus capucinus imitator V504 iglv LVWQ01133761.1 4686 FAASYELTQPRSVSVAPGQTARITCGGNNIGSKYVHWYQQKSGQAPVLVIYYNSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCEVWDGSSKH
Cebus capucinus imitator V572 trav LVWQ01017043.1 32101 THSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Cebus capucinus imitator V656 igkv LVWQ01046461.1 24106 SNREIVLTQSPTSMAVSQGERVTISCTASSSVSTSHLHWYQQKPGSPPRLLIYSTSSLASGVPARFSGSGSGTSYTLTISSMEADDAASYYCQQWSGF
Cebus capucinus imitator V657 igkv LVWQ01046462.1 7721 CIGDIVLTQSPASLAVSPGQRATITCRASESVSFLGMNFIHWYQQKPAQPPKLLIYQASNKDTGVPDRFSGSGSGTNFILTIDPVEADDAANYYCQQSKNVP
Cebus capucinus imitator V658 igkv LVWQ01046463.1 23630 ARCDIQMTQSPSSLSASVGDKVTITCRAGQGISRWLAWYQQKPGTVPKLLIYEASKLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSHP
Cebus capucinus imitator V659 igkv LVWQ01046463.1 13611 TTGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISGLEPEDFAVYYCQQYSSRY
Cebus capucinus imitator V752 igkv LVWQ01074848.1 4115 STGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISGLEPEDFAVYYCKQYNSWP
Cebus capucinus imitator V753 igkv LVWQ01074850.1 4054 ARCDIQMTQSPSSLSASVGDKVTITCQAGQDISKWLAWYQQKQGTAPKLLIYEASKLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Cebus capucinus imitator V754 igkv LVWQ01074851.1 11694 ARCDIQMTQSPSSLSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKPLIYYVSSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Cebus capucinus imitator V755 igkv LVWQ01074852.1 2537 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLYSDGNTYLYWYLQKPGRSPQLLIYRVSNRFAGVPDRFSGSGSSTDFTLKISRVEAEDIGVYYCMQALKHP
Cebus capucinus imitator V756 igkv LVWQ01074854.1 6149 SRGDIVMTQSPAFFSGAPGEKVTITCRASQGISNYLHWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQGNNW
Cebus capucinus imitator V757 igkv LVWQ01074856.1 925 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLYSDGKTYLNWYLQKPGRSPQLLIYRVSNRFAGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQTLKHP
Cebus capucinus imitator V758 igkv LVWQ01074858.1 2611 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASKRATGIPDRFSGSGSGTDFTLTISSLEPDDFAVYYCQPRNIWP
Cebus capucinus imitator V759 igkv LVWQ01074859.1 2179 SRSEIVLTQSPAFLSVAPREKVTITCRASQGISNNLHWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSNSW
Cebus capucinus imitator V760 igkv LVWQ01074860.1 20939 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVETEDVGVYYCMQGTKNP
Cebus capucinus imitator V761 igkv LVWQ01074860.1 6540 SSGDIVMTQTPLFLSVTPGEQASISCRSSQSLLHSDGNTYLNWILQKPGQPPRRLIYKVSTRDPGVPDRFSGSGAGTDFTLKISRVEAEDAGVYYCLQG
Cebus capucinus imitator V762 igkv LVWQ01074861.1 21911 STGDIVMTQTPVSLPVTPGEPASISCRSSQNLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLL
Cebus capucinus imitator V763 igkv LVWQ01074861.1 15809 STGDIVMTQTPVSLPVTPGEPASISCRSSQNLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLL
Cebus capucinus imitator V764 igkv LVWQ01074861.1 4703 TRCDIQMTQSPSSLSASVGDRVTITCHASQSISNWLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP
Cebus capucinus imitator V765 igkv LVWQ01074862.1 39886 AKCDIQMTQTPSYLSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGRDFTLTISSLQPEDIATYYCQQYDNLP
Cebus capucinus imitator V766 igkv LVWQ01074862.1 7529 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGRSPQLLIYDASNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQYP
Cebus capucinus imitator V767 igkv LVWQ01074865.1 3484 ARCDIQMTQTPSSLSASVGDKVTITCRASQGISSYLAWYQQKPGKAPKLLIYYASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYDKLP
Cebus capucinus imitator V768 igkv LVWQ01074866.1 2634 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLDSDGNTYLHWYLQKPGQSPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQS
Cebus capucinus imitator V769 igkv LVWQ01074867.1 3788 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHTNGYTYLEWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQS
Cebus capucinus imitator V770 igkv LVWQ01074868.1 15876 TRCDIQMTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKTPRLLIYAASSLQTGIPSRFSGSGSGTEYTLTISSLQPDDFATYYCQQYSSYP
Cebus capucinus imitator V771 igkv LVWQ01074870.1 15053 SSEGIVMTQTPLSLSVTPGEPASISCRSSQSLFDSEDESTYLDWYLQKPGRSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQSIELP
Cebus capucinus imitator V772 igkv LVWQ01074870.1 4200 SSGDIVMTQTPLSLTVTPGELASISCSSSQSLLHSNGNTYLEWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAIQDP
Cebus capucinus imitator V773 igkv LVWQ01074872.1 7500 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNELEWYQQKPGKAPVLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYGYP
Cebus capucinus imitator V774 igkv LVWQ01074873.1 44548 NGDIILTQTPASLSAPQGETVSISCQASEDVHGEISWIRIKLGQRFEPLISHVTTLAPGVPARYSGRGSGTSYVFSISALQPGDSGEYYCMHDYGWP
Cebus capucinus imitator V775 igkv LVWQ01074873.1 17265 SSGDIVMTQTPLSLPVTPGQPASISCRSNQSLLHSNGNTYLSWFLQKPGQSPQLLIYRVSNRASGLPDRFSGSGSVTDFTLKISRVEAEDIGVYYCMQA
Cebus capucinus imitator V776 igkv LVWQ01074873.1 4169 TRCDIQMTQSPSFLSASVGDRVTITCRASQGISSCLAWYQQKPGKTPRLLIYAASSLQTGIPSRFSGSGSGTEYTLTISSLQPDDFATYYCQQAYSTP
Cebus capucinus imitator V838 ighv LVWQ01093291.1 470 VLSQVQLQESGPGLVRPSQTLSLTCAISGDSVSSNSATWNWIRQSPGRGLEWLGRTYYRSKWYYNYATSLQSRITINPDTSKNQFSLQLNSVTLEDTAVYYCAR
Cebus capucinus imitator V884 trbv LVWQ01105665.1 94831 FKDAIVTQFPRHRIIGTGKEFILQCSQNMNHVAMFWYRQDPGFGLKLVYYSPGPGSIEKGDVSEGYHVSRNNITYFPLTLKSASTNQTSVYLCTSSS
Cebus capucinus imitator V885 trbv LVWQ01105665.1 74691 PLEAQVTQNPRYLITVTGKKLTVTCSQDMNHNYMSWYRQDPGLGLRQIYYSNNVELVDEGDVPEGYNVSRKEKRNFPLILERPRPDQTSLYLCASSL
Cebus capucinus imitator V886 trbv LVWQ01105665.1 69338 LVEVKITQNPRYLVKKMGEKVSLECAQDMDHERMFWYRQDPGLGLRLIYFSYDIKNDEKGDVPDGYSVSREKKEQFILILGSARTNQTSVYLCASSP
Cebus capucinus imitator V887 trbv LVWQ01105665.1 50217 SVFGAVVSQKPSRGICQHGTSMTIQCHVDSQVNLMFWYRQLPRQSMTLIATANQGSGATYEKGFAEDKFPISRPSLTFSTLNVSNMSPEDSGIYFCSAG
Cebus capucinus imitator V888 trbv LVWQ01105666.1 22823 SMDAGVTQTPRNRIAKTGKKIMLECSQTRGDNRMYWYRQDPGQGLQLIYYSLGVEDKNEGEISDGYSVSRQEQPKFSLSLESAMPKHTALYFCATSY
Cebus capucinus imitator V889 trbv LVWQ01105666.1 21137 SMDAGVTQTPRNRIAKTGKKIMLECSQTRSDNRMYWYRQDPGQGLRLIYYSLGVEDKNEGEISDGYSVSRQEQSKFSLSLESAMPKHTALYFCATSY
Cebus capucinus imitator V890 trbv LVWQ01105667.1 17696 SLDTKVTQRPRHVVTVKEQKAKMDCVPMKGHSYVYWYRKKLEEELKFLVYLQNGEIIQKAEVINERFSAQCPENSPCALEIQSTESGDAGLYFCASSK
Cebus capucinus imitator V891 trbv LVWQ01105667.1 7467 SFHAKVTQTPGYLVKRKGQKTEMDCTPEKGHTFVYWYQQKQNKDLMFLISFQNEQILEETEMHKKRFLSQCPKNSPCSLAILSSDPGDRALYLCASSQ
Cebus capucinus imitator V892 trbv LVWQ01105668.1 10228 LSNAGVTQNPRHMVRRKGQEARLRCSPVEGHNHVYWYQQLLGEGLKFMIYLQRESIIDESGMPKERFSAKFPKEGPSILRIQQAERGDSAAYFCASSI
Cebus capucinus imitator V893 trbv LVWQ01105668.1 7203 IVDGGITQSPKHLFRKEGQAVTLGCEQNLNHDAIYWYRQDPGQGLRLIYYSQIVDDFQKGDIAEDYSVSRKKKESFPLTVTSAQRNHTAFYLCASSI
Cebus capucinus imitator V894 trbv LVWQ01105668.1 4652 GSGFGAVVSQHPSRVVCKSGTSVKIECRALDFQATTMFWYRQSQKQGLTLMATSNEGSDATYEQGFPDDKFPISHPNLTFSSLTVASAQPEDSSFYLCSGR
Cebus capucinus imitator V895 trbv LVWQ01105669.1 18682 LTDARVTQTPRHKVTEMGQEVTMRCQPIFGHNTVFWYRQTVMQELELLTYFRNQPSLDDSGMPEDRFSAEMPTASLSTLKSQPSEPRDSAVYLCASGL
Cebus capucinus imitator V896 trbv LVWQ01105669.1 11664 HTAAGVTQFPSHRVIEKGQAVTLGCDPISGHEYLHWYRRVMGKEIKFLINFLRDSKQDESGMPNSRFSAERTGGTNSTLKVQPAELEDSGIYFCASSL
Cebus capucinus imitator V897 trbv LVWQ01105669.1 6587 HGDAMVIQNPRYQVTQLGKPVTLSCSQNLNHNAMYWYQQKPSQAPKLLLYYYDKALNNEADTPDNFQSRRPNTSFCFLDIRSSGLRDAAMYLCASSR
Cebus capucinus imitator V898 trbv LVWQ01105669.1 1612 SPGEEVTQTPRHLVKGKGQKAILYCVPIIGHGYVFWYQQVRKEFKFLISFQNENIFDETAMPKKRFSVKCPQNSPCSLEIQATGSQDSAVYFCASSQ
Cebus capucinus imitator V899 trbv LVWQ01105670.1 26884 HMDGRITQSPRHKVTETGTPVTLRCHQTENHRYMFWYRQDLGHGLRLIHYSYGVKDVSKGEVPDGYNVSRSNTEDFPLTLESTTGSQTSVYFCASSD
Cebus capucinus imitator V900 trbv LVWQ01105670.1 11356 HTDAGVIQSPQHKVTEMGQEATLRCEPISGHTQLFWYRQTMMQGLELLIYFNNKDPIDDSGMPKDRFSAQMPNASFSILKIQPSEPRDSAVYFCASSL
Cebus capucinus imitator V901 trbv LVWQ01105672.1 21394 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHSRVSWYQQVLGQGPELILEYYEKEQRNRENFPNRFSGSQFHNYSSGLNVSALEPGDSALYLCASSL
Cebus capucinus imitator V902 trbv LVWQ01105672.1 11671 HACAGVSQDPRHKVTKTGQNVTFRCDPISGHDGLYWYRQTLGQSLEFLTYFWNEAQLDKSGLPSDRFFAERTEGSFSTLKIQRTKQGDSAMYLCASSS
Cebus capucinus imitator V903 trbv LVWQ01105672.1 5185 SVAAGVIQHPRHLIKEKRETATLKCYPIPGHDTVYWYQQGPGQGLQFLISYYEKMQRDKGSIPDRFVARQFSDYHSELNISSLDLGDSALYLCASSL
Cebus capucinus imitator V904 trbv LVWQ01105673.1 57943 PVDSGVTQTPKHLLTAIGQRVALTCSPRSGDLSVYWYRQSLDQSLQLLIQYYNENEREKGNIPERFSGKQFPNMSSELNLSSLELGDSALYFCASSV
Cebus capucinus imitator V905 trbv LVWQ01105673.1 36815 QTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLELLSYFRSRTLVDDSEMRQDRFSAEMPNASFSTLRIEPTEPRDSALYLCA
Cebus capucinus imitator V906 trbv LVWQ01105673.1 21615 HGDAGITQSPRHKVTERGRQVTLKCRQTWNHNYMYWYRQDLGHGLRLIHYSVAADNTEKGEVPDGYVVSRSNPEDFPLTLESATNSQSSVYFCASSD
Cebus capucinus imitator V907 trbv LVWQ01105673.1 13589 LTEAGVAQSPRYKITEKRQAVAFWCDPVSGHAGLYWYQQILGQGPKLLIQYHNEDVVDDSQLLKDRFSAERLKGVDSILKIQPAELGDSAVYLCASSL
Cebus capucinus imitator V908 trbv LVWQ01105673.1 10123 CTDAGIIQSPKHEVTEMGQAVTLRCEPILGHNLLFWYRQTLVQGLELLCYFRSRSIIDDEQMPKDRFSAERPNGSFSTLKIQPTEQEDSAVYICASRL
Cebus capucinus imitator V909 trbv LVWQ01105673.1 715 PVTAGVTQTPKFQVLKTRQSMTLQCTQDMNHDYMYWYRQDPGMGLRLIHYSVDEGTTAKGEVPDGYNVSRPNREGFLLRLESAALNQTSVYFCASSD
Cebus capucinus imitator V910 trbv LVWQ01105674.1 5831 HTGAGVSQSPSNKVTEKGKDVALRCDPISGHTVLYWYRQSPGQGPEFLIYFQGKDIADDSGLPSDRFSAERSRGSVSTLQIQRTEQADSAVYLCASSL
Cebus capucinus imitator V911 trbv LVWQ01105674.1 594 PVQAEVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYVNELKRSEGNFPARFSGFQFSDYHSEMNISTLELGDSALYLCASSL
Cebus capucinus imitator V912 trbv LVWQ01105675.1 27785 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYYNEMPNEKGNFPARFSGLQFSNYSSEMNVSALELGDSALYLCASSL
Cebus capucinus imitator V913 trbv LVWQ01105675.1 18518 PVTAGVTQTPKFQILKTRQSMTLQCAQDMNHDRMYWYRQDPGMGLRLIHYSVGEGTTDKGEVPDDYNVSRPNREDFPLRLKSASPSQTSVYFCASSY
Cebus capucinus imitator V915 trbv LVWQ01105675.1 13971 HTGAGVSQSPSNKVTEKGKDVVLRCDPISGHNALYWYRQSLGKGLEFLIYFQGKDAPDKSGLPSDRFFAERDGGSFSTLQIRRTEQKDSAVYLCASSL
Cebus capucinus imitator V916 trbv LVWQ01105676.1 32441 PSDSAISQTPKYLVTQIGKEESLKCNQNLGHDAMYWYKQDSKKLLKIMFIYNNKELILNETVPNRFSPESPDKTHLNLHIESLELGDSAVYFCASS
Cebus capucinus imitator V917 trbv LVWQ01105676.1 27320 PMDTGVTQTPKHLVMGMTNEKSLKCEQHLGHNAMYWYKQKAKTPPELMFVCSYKETSVNESVPSRFSPDCSDSSQLYLHLHAMQPEDSALYLCASSQ
Cebus capucinus imitator V918 trbv LVWQ01105676.1 21890 LGEAQVTQTPRHLIKMRGQQVTLRCSPISGHNSVYWYQQAPGQGPQFIFEYYNAMPRQQGNFPARFSGLQFSNYSSEMNVSALELGDSALYLCASSL
Cebus capucinus imitator V919 trbv LVWQ01105676.1 16417 PVTAGVTQTPKFQVLKTRQSMTLQCTQDMNHDYMYWYRQDPGMGLRLIHYSAGEDTTAKGEVHDGYSVSRSNTKDFPLRLESAAPSHTSVYFCASSY
Cebus capucinus imitator V920 trbv LVWQ01105676.1 5171 PSDSAISQTPKYLVTQIGKEESLKCNQNLGHNTMYWYKQDSKKLLKIMFIYNNMEPFLNETVPNRFSPESPDKTHLNLHIKSLELGDSAVYFCASSQ
Cebus capucinus imitator V921 trbv LVWQ01105676.1 1688 HMDTGVTQTPKHLVMGRTNKKSLKCEQHLRHNAMYWYKQKAKTPLELMFIYGFQKQTENNSVPSRFSPECPNSSHLYLHLHALQPEDSALYLCASSQ
Cebus capucinus imitator V923 trbv LVWQ01105677.1 3746 HTEPEVTQTPSHQVTRMGQEVILWCVPIPNHLYFFWYRQISGKKVEFLVYFYNDNISEKSEIFDDRFSVERPDGTNFTLKIQPTKPEDSATYFCASS
Cebus capucinus imitator V989 trgv LVWQ01124342.1 88699 IFQLGRMKTATGPTGSSAVITCDLPVENTLYIHWYLHQEGKAPQRLLYYDLSNSNIVSESGISLGMYDTYTSRRRSWKSRLQNLIENDSAVYYCGAWD
Cebus capucinus imitator V990 trgv LVWQ01124342.1 84491 SQISSNLEGRMKSVTGTTGSSAVITCHLPGENTLYIHWYLHQEGKALQCLLYHDRSNPSSGKYNSFPITRRRWKLKLQNLIENDSGVYYCATWD
Cebus capucinus imitator V991 trgv LVWQ01124342.1 80527 SQVSSNLEGRTKLVTGWTGSSDVITCDLPVENARYIHWYFHQEGKALQRLLYYDTHQSKIVLDSGISPGKKDNYLILKGSWKLVLQNLIENDSGVYYCATWD
Cebus capucinus imitator V992 trgv LVWQ01124342.1 77741 SQIFSNLEGRTKSVTGQTGSSAVITCDLPGEGAFYIHWYLHQEGKAPQRLLYHELSNSKVVLESGISPGKYDTYATTRRSWKLRVRNLIENDSGVYYCATWD
Cebus capucinus imitator V993 trgv LVWQ01124342.1 73660 SQVSSNLEGRTKLVTGRTGSSDVITCDLPVENARYIHWYFHQEGKAPQRLLYYDTHQSKIVLDSGISPGKKDNYLILKGSWKLVLQNLIENDSGVYYCAAWD
Cebus capucinus imitator V994 trgv LVWQ01124342.1 59653 HLEQPQISSTKTLSKTARLECVVFGVTISATAIYWYRERPGEAIQLLVYISSDGSVRMESGITSGKFEVDRIPETSTSTLTIHNVEKKDIATYYCAFWE
Cebus capucinus imitator V995 trgv LVWQ01124342.1 42332 EQFQLSISTEIKKSIDIPCKILSTNFETDVIHWYWQKPNQALEHLIYTALMKSSAGGSMGERSNKLEARKDSQTSTSILTIKSIEKEDMAIYYCAAWE
Cebus capucinus imitator V996 trgv LVWQ01124342.1 29698 TSGDNLITQLVTSITKKKGNTAFLECRIKPNTFKKNVCVHWYHQKPDRFLKRILYISSNENIVHEQGFSEERYEARKWQSDLSSSLRIHRVTEEDAGMYYCACW
Cebus capucinus imitator V998 iglv LVWQ01124385.1 5370 SMSSYELTQPRSVSVSPGQTASITCSGDKLGDKYAYWYQQKPGQAPVLVIYEDSKQPSGIPERFSGSNSGNTATLTISGTQAVDEADYYCQV
Cebus capucinus imitator V999 iglv LVWQ01124386.1 4189 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGYYNAVSWYQQHPGTAPKLMIYYVSNRPSGVPNRFSGSKSGNTASLTISGLQAEDEADYYCSSYGGS
Cebus capucinus imitator V1000 iglv LVWQ01124389.1 709 PVVSSAMTQDPAVSVALGQTAMITCQGGGIGTYSASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCGSWDSSGTH
Cebus capucinus imitator V1001 iglv LVWQ01124390.1 468 SATSYELTQPHSVSVAPGQTAKITCGGNNIGGKNVYWYQQKSGQAPVLVIYEDSNRPSGIPERFSGSNSGNTATLTISGVEARDEADYYCQVLDSSSYD
Cebus capucinus imitator V1010 iglv LVWQ01128438.1 54306 LTQPSSLSTSPGESVRPSCTLSSGFSADLYWIYWYQHKPGNPTPSPQHLLSHYQNSFHDQGSRVPSRFSGLMEAWSNKGLLLISELQSEDEAYYYCMIEQSGA
Cebus capucinus imitator V1011 iglv LVWQ01129803.1 6747 CWAQSVLTQPPSVSGNPGQRVTISCSGSSSNIGSYYVYWYQQLPGTAPKLLIYYNNQRPSGVSDRFSGSKSGNSASLTITGLQSANEADYYCQSYESNLN
Cebus capucinus imitator V1012 iglv LVWQ01129804.1 8030 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSSNYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCSVYYSGT
Cebus capucinus imitator V1014 ighv LVWQ01131025.1 1806 VQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVCQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1015 ighv LVWQ01131032.1 3652 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMHWVRQAPGKGLEWVGRIKNKAYGGTAEYAGSVKGQFTISRDDSKNSLYLQMSSLRAEDTAVYYCG
Cebus capucinus imitator V1016 ighv LVWQ01131032.1 1127 VQCEVQLVESGGGLVQPGGSLRLFCAASGFTFSSYAMSWVRQAPGKGLEWVSAIDTGGSTYYADSVKGRFTISRDNAKSSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1017 ighv LVWQ01131034.1 9580 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYWMCWVRQAPGKGLEWVGRINPNGGSTSYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAS
Cebus capucinus imitator V1018 ighv LVWQ01131035.1 12292 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMYWVRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISREDAKNTLYLQMNSLRAEDTAVYYCAK
Cebus capucinus imitator V1019 ighv LVWQ01131035.1 4181 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMSWARQAPGKGLEWVSYISYNGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1020 ighv LVWQ01131037.1 50251 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMDWVRQAPGKGLEWVSFISYNGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1021 ighv LVWQ01131037.1 25089 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWARQAPGKGLEWVGLIRTKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSSLRAEDTAVYYCG
Cebus capucinus imitator V1022 ighv LVWQ01131037.1 19782 AHSQVQLVESGAEVKKPGSSVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGWINPYNGNTKYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAR
Cebus capucinus imitator V1023 ighv LVWQ01131253.1 443 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWVRQAPGKGLEWVGFIKNKADGGTAEYAASVKGRFTISRDDSKNSLYLQMSSLRAEDTAVYYCAK
Cebus capucinus imitator V1024 ighv LVWQ01131257.1 9214 VQCEVQLVESGGGLVRHGGSLRLSCAASGFTLSSYDMDWVRQAPGKGLEWVSAISAGGSTYYGDSVKGRFTISRDNGKNFLYLQMNSLRAEDTAVYYCAKE
Cebus capucinus imitator V1025 ighv LVWQ01131257.1 1188 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMSWVRQAPGKGLQWVSSISYNGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1026 ighv LVWQ01131258.1 10433 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVGLIRTKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSSLRAEDTAVYYCA
Cebus capucinus imitator V1027 ighv LVWQ01131259.1 357 VLSQVTLKESGPAQVKPTQTLTLTCAFSGFSLSTSGMGVGWIRQPPGKALEWLAHIYWDDDKCYSSSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAQR
Cebus capucinus imitator V1028 iglv LVWQ01131918.1 624 SVVSSELTQDPAVSVALGQTARITCQGGGLGTYYASWYQQKQGQAPVLVIYGNNYRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCGSWDSSGTH
Cebus capucinus imitator V1029 iglv LVWQ01131922.1 7627 SWAQSALTQPRSVSESPGQSVTISCTGTSSDVGGYNAVCWYQQHPGTAPKLMICDVSNRPSGVPNRFSGSQSGNTASLTISGLQAEDKADYYCSSYAGS
Cebus capucinus imitator V1030 iglv LVWQ01131922.1 1945 SDASYELTQPPSVSVSPGLTARITCSGDALPKKYAYWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTISGAQAEDEADYYCFSADSSGTY
Cebus capucinus imitator V1031 iglv LVWQ01132486.1 7870 SATSYELTQPHSVSVAPGQTASITCGGNNIGSEYVHWYQQKSGQAPVLVIYRNSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCEVWDGSGKH