WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Microcebus murinus ABDC00000000.2 (ABDC02) 265 49 66 45 50 36 5 14
Microcebus murinus ABDC00000000.3 (ABDC03) 272 51 68 46 51 37 5 14
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Microcebus murinus V8 igkv ABDC02000848.1 2392 CRGEIVLTQSPAFLSGTPGEKATLTCRASQSIGTNLHWYQQKPGQAPKLLVKYASQSVSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQGNTFP
Microcebus murinus V9 igkv ABDC02000848.1 14927 TRCDIQVTQSPSSVSASPGETVTISCRVSQDISNHLSWYQQKPGKPPKPLIYAASNSHSGVSSRFSGSGSGTDYSLTIRGLETDDAATYFCRQYKIS
Microcebus murinus V10 igkv ABDC02000848.1 29645 SSGDVVMTQTPLSLPVTPGESASISCRASQSLLYSDGNTYLNWFLQKPGQPPKLLIYKISNRDSGVSDRFSGSGSGTDFTLKISKVEAEDVGVYYCNQGSYYP
Microcebus murinus V11 igkv ABDC02000848.1 42235 SRGEIVLTQSPAFLSGTPGEKATLTCRASQGISNYLHWYQQKPGQAPKLLVKYASQSVSSRFSGSGSGTDFTLIISSLKAEDAATYYCQQGYNYP
Microcebus murinus V12 igkv ABDC02000848.1 47462 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQFP
Microcebus murinus V13 igkv ABDC02000851.1 2578 SSGDVVMTQTPLSLPVTPGEPASISCRASESILHSNGNTYLSWYLQKPGQPPKRLIYKISNRDTGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQATKL
Microcebus murinus V15 igkv ABDC02000886.1 1627 ARCDIQMTQSPSSLAASVGDTVTISCRASQGISSWLSWHQQKPGKPPKTLINKASNLESGVPSRFSGSGSGTDFTLTIKGLQPEDFATYYCQQYDSSP
Microcebus murinus V16 igkv ABDC02000887.1 6493 ARCDIQMTQSPSSLAASVGDTVTITCRASQGISKYLSWYQQKQGKSPKRLIYYASTLDSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCLQYASYP
Microcebus murinus V17 igkv ABDC02000887.1 11498 SSGDIVMTQTPLSLPVTPGESASISCRSSQSLLHSDGNTNLYWFLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQTIQFP
Microcebus murinus V18 igkv ABDC02000887.1 17872 SSGDVVMTQTPLSLPVTPGEPASISCRASESLLHSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQSTKI
Microcebus murinus V19 igkv ABDC02000887.1 28665 SNGEIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGKTYLHWYLQKPGQSPQLLIYLVSTLFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDLQTP
Microcebus murinus V20 igkv ABDC02000889.1 7560 TRCDIQVTQSPSSVSASPGDTVTISCRASQDISNRLSWYQQKPGKPPKALIYVASNLHSGVSSRFSGSGSGTDYSLTIRGLETDDAGTYFCRQYKNN
Microcebus murinus V21 igkv ABDC02000889.1 11655 SSGDVVMTQTPVSLPVTPGEPASISCRSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQALQPP
Microcebus murinus V22 igkv ABDC02000890.1 6363 SSGDIVMTQTPLSLPVTPGEPASISCRASESLLDSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCAQATKLP
Microcebus murinus V23 igkv ABDC02000890.1 20416 SRGEIVLTQSPAFLSGTPGEKVTLTCRASQGISNYLHWYQQKPGQPPKLLVKYATQSMSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQSNNFS
Microcebus murinus V24 igkv ABDC02000890.1 25282 SSGEIVMTQSPLSLPITLGEPASISCRSSQSLLHSNGKTYLYWYLQKPGQSPQPLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAIQFP
Microcebus murinus V25 igkv ABDC02000890.1 32925 TRCDIQVTQSPSSMSVSPGDTVTISCRASQDISNRLSWYQQKPGKPPKALIYVASNLHSGVSSRFSGSGSGTDYSLTIRSLETDDAATYFCRQYKNN
Microcebus murinus V26 igkv ABDC02000890.1 37071 SSGDVVMTQTPLSLSVTPGESASISCRASQSIQDSDGNTYLNWFLQKPGQPPRRLIHKVSNRDSGVSDGFSGSGSGTDFTLKISRVEAEDVGVYYCMQASYFP
Microcebus murinus V27 igkv ABDC02000892.1 5408 SRGEIVLTQSPAFLSGTPGEKATLTCRASQSIGTSLHWYQQKPGQPPKLLVKYASQSVSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQNNYYP
Microcebus murinus V28 igkv ABDC02000893.1 2086 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQYP
Microcebus murinus V31 iglv ABDC02001191.1 15186 TWAEVVFTQPHSVSGSPGESVTLSCTRSSGNIGDNYVSWYQQRPGSAPTTLIYKYDQRPSGVPDRFSGSKDTSSNSASLTISGLQSEDEADYYCLSGYGNYY
Microcebus murinus V32 iglv ABDC02001191.1 48621 SWAQSALTQPPSVSGAPGQSVTISCLGSNSNIGGNYANWYQQLPGTAPKTLIYANSNRPSGVPARFSGSKSGSSASLTITELQAEDEADYYCSAWDDSLS
Microcebus murinus V33 iglv ABDC02001191.1 62402 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSGYTIAWHQQQPGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGADRYLTISNVQPEDEADYYCQTGDSSGV
Microcebus murinus V34 iglv ABDC02001191.1 71811 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGSYYVQWYQQRPGSAPSTVIYKHNKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V35 iglv ABDC02001191.1 80834 SWAQSGLTQEASLSGSVGHKVTLSCAGNSNNVGHTGAVGWYQQVPRGAPKTVMLGTTPPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTWDRTLS
Microcebus murinus V36 iglv ABDC02001191.1 105496 SLSQPAVTQLPSLSASPGASARLTCTLRSDISVGGKYVYWHQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGSKDTSANAGILHVSGLQPEDEADYYCAM
Microcebus murinus V37 iglv ABDC02001191.1 110430 SLANFFLTQPSSVSGSPGQKVTISCTRSSGNIGSNYVHWYQQRPGSAPSTVIYEYNKRPSGVPDRFSGSMDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V38 iglv ABDC02001191.1 119415 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDRSLS
Microcebus murinus V39 iglv ABDC02001191.1 130170 SWAQSALTQPPSVSGAPGQSVTISCSGSGSNIGGNYVYWYQQLPGTAPKTLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCSSWDSSLS
Microcebus murinus V40 iglv ABDC02001191.1 136771 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVDNYVIYWHQQKPGSPPRYLLYYYSDSIKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V41 iglv ABDC02001191.1 141614 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGGYYVHWHQQRPGSAPTTVIYEDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V42 iglv ABDC02001192.1 9910 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSGYTIAWLQQQPGKAPRYLMWLNSDGRHSKGDGVPDRFSGSSSRAERYLTISNVQPEDEADYYCQTWDSSGV
Microcebus murinus V43 iglv ABDC02001193.1 3599 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGNYVHWHQQLPGTAPKLLIYGNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCSSWDSSLS
Microcebus murinus V44 iglv ABDC02001195.1 887 SWAQSALTQPPSVSGAPGQSVTISCSNIKGSYAHWYQQLPGTAPKLLIYYNSDRASGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V45 iglv ABDC02001195.1 4821 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYAIAWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V46 iglv ABDC02001197.1 204 SWAQSGLSQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDKSLSA
Microcebus murinus V47 iglv ABDC02001198.1 679 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSDYTIAWLQQQPGKAPRYLMDIYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQPEDEADYHCHTWDGAV
Microcebus murinus V48 iglv ABDC02001198.1 9874 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIESSYVHWYQQRPGSAPTTVIYDDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDASA
Microcebus murinus V49 iglv ABDC02001198.1 18838 SWAQSGLTQEALVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNMASLTISGLQPEDEADYYCSTRDKSLS
Microcebus murinus V50 iglv ABDC02001199.1 4342 SWAQSALTQPPSVSGAPGETVTISCSGSSSNIGGYDANWYQQLPGTAPKLLIYYDSDRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCQSYDSSLDA
Microcebus murinus V51 iglv ABDC02001199.1 11001 SLSQPVLTQPSSLSASPGASARLTCTLSSGSSVGSYWINWYQQKPGSPPRYLLSYYSDSYKHQVSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V52 iglv ABDC02001200.1 1444 SLSQPVLTQPPSASASPGASAKLTCTLSSGYSNYGIAWHQQQPGKAPRYLMDVYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQSEDEADYHCQTWDGAV
Microcebus murinus V53 iglv ABDC02001202.1 7387 SLANIVLTQPSSVSGSPGQKVTISCTRSSGNIGSRYVSWYQQRPGSAPTTVIYRDNKRPSGVPDRFSGSIDSSSNSASLTISALQSEDEADYYCQSYDDSC
Microcebus murinus V54 iglv ABDC02001202.1 23292 SLSQPVVIQPPSLSASPGASARLTCTLRSDISVGGKNMYWYQQKPGSPPPYLLRYYSDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V55 iglv ABDC02001202.1 27397 SLANLVLTQPSSVSGSPGQKVTLSCTRSSGNIGSYYVHWYQQRPGSAPSTVIYEDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V56 iglv ABDC02001202.1 37731 SLSQPVLTQPPSASASPGASAKLTCTLSSGHSNYGITWHQQHPEKAPRYLMYVYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQPEDEADYHCQTWDSGV
Microcebus murinus V66 iglv ABDC02003013.1 5258 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGGGYVVHWYQQLPGTAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V67 iglv ABDC02003013.1 11152 SLSQPVVTQPPSLSASPGASARLTCTLSSGFSVGSYAISWHQQKPGSPPRYLLYYHTDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V68 iglv ABDC02003013.1 16092 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGSNYVHWYQQRPGSAPTTVIYRDDKRPSGVPDRFSGSSDSSSNSASLTISGLQSEDEADYYCQSYDASA
Microcebus murinus V69 iglv ABDC02003017.1 3678 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGGYYAHWYQQLPGTAPKLLIYRNSGRPSGVPARFSGSKSGSSASLTIVGLQAEDEADYYCQSYDSSLN
Microcebus murinus V76 iglv ABDC02003656.1 3673 SVASQVTQVPAVSVALGQTARITCQGDSLSSYYPGWYQQKPSQAPVLVVYGNNERTSGIPERFSGSKSGNTATLTISGAQVEDEADYYCGSYAGS
Microcebus murinus V77 iglv ABDC02003657.1 262 SVASQLTQVPAVSVALGQTASITCQGDGIRSYYANWYQQKPGQAPVLVMYVDNNRPSGIPERFSGSKSGNTATLTISRAQADDEADYHCQSFDSSGTL
Microcebus murinus V78 iglv ABDC02003658.1 7161 AVSPYELTQPPSVSVTPGQTARIPCSGDKLGEKYVYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCHVWDSSSDH
Microcebus murinus V79 iglv ABDC02003659.1 859 SVAFQLTQVPAVSVALGQTASITCQGEGLSSYYVNWYQQKPGQAPVLIIYTDIFSNSNRPSGIPERFSSSVSGDTATLTISGAQAQDEADYYCQVWVSENNK
Microcebus murinus V80 iglv ABDC02003660.1 13105 AVSPYELTQPPSVSVTPGQTARIPCSGDQLGERYVHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCQCGTAVVII
Microcebus murinus V81 iglv ABDC02003660.1 19357 SVASQLTQVPAVSVALGQTARITCQGDSLSSYYPNWYQQKPGQAPVLLIYGENQRPSGIPERFSSSVSGDTATLTISGAQAGDEADYYCQVWDSENNK
Microcebus murinus V83 igkv ABDC02004105.1 969 SSGDVVMTQTPLSLPVTPGELASISCRASESIQDSDGNTYLNWVLQKPGQPPKRLIYKVSNGDNGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQSTKI
Microcebus murinus V84 igkv ABDC02004105.1 13432 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLQWYLQKPGQSPQPLIYRVSNRFSGVPDRFSGSGAGTDFTLKISRVEAADVGVYYCMQGIQFP
Microcebus murinus V85 igkv ABDC02004106.1 4569 IRCDIQMTQSPSSLAASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYGASNLHSGVSSRFSGSGSGTDYSLTIRGLETDDAATYYCQQGHSY
Microcebus murinus V86 igkv ABDC02004106.1 18636 NGDIVLTQTPASLSAHPGETVSISCKASADVHGEMSWVRIKLGQRLEPLISHVTTLAPGVPARYSSRGSGTSYVFSISGLEPGDSGVYYCMHDYGWP
Microcebus murinus V87 igkv ABDC02004106.1 23719 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSDGNSYMCWYLQKPGQSLQPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Microcebus murinus V88 igkv ABDC02004106.1 32404 ACGDIVMTQSPGSLAASPGESVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSYP
Microcebus murinus V90 igkv ABDC02004107.1 30047 TRAETTLTQTPAFVSVAPGDKVTITCKASQDIDDDIHWYQQKPGASPKFIIKYTTTLVSGVPSRFSGSGYGTDFALTINNVESEDAAYYFCQQDDNLP
Microcebus murinus V91 igkv ABDC02004107.1 32625 TTGNTALIQFPEHLTASLGDSVSINCRAGQSISDYLSWYQQKPGQAPKLLIYDADNLYSGVSSRFTGLQSGTEFILTITNVKADDAATYYCQQD
Microcebus murinus V101 ighv ABDC02005913.1 7012 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRKAPGKGLEWISLINPNGGSTYYADAVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V134 trbv ABDC02011023.1 215364 PVDTGITQTPKYLVAVVGSKRSLTCEQHLGHNSMYWYRQDAEKSPKLMFFYNYKELIENGTVPIRFTPDYPDSSHLYLHVDALEPHDTAMYLCASSK
Microcebus murinus V135 trbv ABDC02011023.1 217229 HTEPGVIQTPSHQVTKKGQEVILRCDPISGHLYFYWYRQISGQKLEFLVSFYNDNISEKSELFTDQFSLKRPKGSYLALKIQSTELEDSAMYFCASSK
Microcebus murinus V136 trbv ABDC02011023.1 222817 PLDTAVFQTPKYLLTQMGNNVALKCGQTLGHDYMYWYKQDSTKLLKIMFTYNNQELMLNETASNRFSPESPDKAHLNLHINSPEPGDSAVYFCASSD
Microcebus murinus V137 trbv ABDC02011023.1 225654 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V138 trbv ABDC02011023.1 237684 PLDTAVFQTPKYLLTQTGNDVSLKCEQTLGHNSMYWYKQDSTKLLKIMFSYNNQEKILNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSD
Microcebus murinus V139 trbv ABDC02011024.1 14768 PLDTAVFQTPKYLLTQTGNDVSLKCEQTLGYDTMYWYKQDSTKLLKIMFIYSNKEKILNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSY
Microcebus murinus V140 trbv ABDC02011024.1 19067 PMDTGVTQTPRHLVMGMTDKKSLKCQQNLGHSTMYWYKQSAKKPPELMFYCYYEALRENMSVPSRFLPECSDKSLLYLHLDALQPEDSATYLCASIE
Microcebus murinus V141 trbv ABDC02011024.1 30471 PLDTAVFQTPKYLLTQTGNNVSLKCGQTLGHDNMYWYKQDATKLLKIMFSYNNQELMVNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSD
Microcebus murinus V142 trbv ABDC02011024.1 33634 PMDTGVTQTPRHLVMGMTDKKSLECGQNLEHNAMYWYKQSAKKALEPLFIFNYKKLYENVTVPSRFTPEYQDNAHFYLHLDALQPEDSATYLCASSQ
Microcebus murinus V143 trbv ABDC02011024.1 40516 PAEAGVTQTPGHLITARGQQVTLKCSPVSGHPSVFWYKQALGEGPQFLIQYYEEKESDKGNFPARFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V144 trbv ABDC02011024.1 45646 SVTAGVTQTPRFQILKTGQNTTLTCTQDTNHEEMYWYRQDPGLGLRLIYYSVGVGITEKGQVYNGYNVSRSSTETFPLTLESATPSQTSGYFCASSE
Microcebus murinus V145 trbv ABDC02011024.1 51111 HAGAGVSQSPRHKVTERGQNVTLSCDPISGHNVLYWYRQTLGQGPQYLVYFQGREATDKSGLRSERISAERPEGSFSTLKIQLAEQGDSAVYLCASSL
Microcebus murinus V146 trbv ABDC02011024.1 58982 LAEAGVTQTPRHLITARGQQVTLKCFPVSGHNQVSWYQQALGQGLQFLIQYFEGEEREKGNFPARFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V147 trbv ABDC02011024.1 65360 HTDAGVYQNPRYKVTKTGKQVTLRCRQTNSQNCMYWYRQDLGHGLRLIYYSYRVQSTDKGEVSEGYNVSRSKLEDFPLFLESATRSQTSVYFCASSE
Microcebus murinus V148 trbv ABDC02011024.1 77875 HAGAGVSQSPRHKVTERGQNVTLSCDPISGHISLYWYRQTPEKGLEFLIYFQREEEGDKSGLRSDRFSAERPEGSFSTLKIHPAEQEDSATYLCASSL
Microcebus murinus V149 trbv ABDC02011024.1 85685 PAEAGVTQTPGHLIKARGQQVTLKCFPVSGHDQVSWYQQALGQGPQFLIQYYGGQELEKGNFPARFSGHQFRDYRSELNLSALELGDSALYLCASS
Microcebus murinus V150 trbv ABDC02011024.1 90472 SVTAGVTQTPRFQILKTGQNMTLMCTQDTNHDSMYWYRQDPGLGLRLIHYSVAAGTTARGDIPEGYNVSRSSTETFSLTMESATPSQTSAYFCASSE
Microcebus murinus V151 trbv ABDC02011024.1 94437 HAGAGVSQSPRHKVAEKGQNVTLRCDPISGHDFLYWYRHTLGQGPQFLIYFQDKGVAEQSKLIGERISAERPEGSFSTLKIRPAEQGDSAVYLCTSSL
Microcebus murinus V152 trbv ABDC02011024.1 102417 LAEAGVTQTPGHLIRARGQQMTLKCFPVSGHNRVYWYQQTPGQGLQFLIEYYNGEQGQKENISPRFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V153 trbv ABDC02011024.1 106532 PGDAGVIQSPRHLIKGKQETAILKCYPLSGHDTVYWYQQAPGQGLQFLISYYEKEESQKGNIPPRFLGQQFADYHSELNLSSLELGDSALYLCASSL
Microcebus murinus V154 trbv ABDC02011024.1 109924 HTDAGITQNPRHKITEIGKQVTLSCHQNDNHFYMYWYRQDLGHGLRLIYYSVDAQSTDKEEVAEGYKVSRSNKEDFLLFLESATRSQTSVYFCASSE
Microcebus murinus V155 trbv ABDC02011024.1 113994 LTEEAGVTQSPRHKITEKRQSVAFWCDPISGHITLSWYRQTLGKGLEFLIQYQNEAVADDSGLAKDRFSAERPKGANFTLRIQQAELGDSATYLCASSP
Microcebus murinus V156 trbv ABDC02011024.1 118125 HTDAGVIQTPRHEVTEMGQAVTLKCEPISGHDTLLWYKQTLVQGLELLTYFRSQSQIDDAGMPKGRFSAEMPNASFSTLKIQPTELRDSAVYLCASSS
Microcebus murinus V157 trbv ABDC02011024.1 126797 HAAAGVTQFPSSEVVEKGQAVTLRCDPISGHEYLFWYRRTVGKEMEFLISFLKDNIQDESGMPKDRFSAKWTEGTSSTLKIQPAELEDSGVYFCASSL
Microcebus murinus V158 trbv ABDC02011024.1 132424 HVGAMVMQNPRYQVTRVGKTVTLSCSQNMNHDTMYWYQQKLSQAPKLLFYYYDTEFNNETDTSYNFQPSRPNTSFSSVDIRSPGLGDSAVYLCASSR
Microcebus murinus V159 trbv ABDC02011024.1 139720 SAGEDVTQTPGHLLKGKGQKVKMYCVPMKGHRYVHWYQQILEKEFKFLFSFQDRKVFEETKMVKQRFSAECPQNSAWSLEIQTAEPQDSAVYLCASSK
Microcebus murinus V161 trbv ABDC02011024.1 159752 SMDTEVTQSPRYLVKGKEQKTKMDCVPKKGHSYVYWYQKKLEEGLKFLVYLQDEDIIEKEEIINNRFSAQCPKNSPCILEIQSTESGDSALYFCASSQ
Microcebus murinus V162 trbv ABDC02011024.1 165703 SYDAKVTQTPGHLIKEKGQKASMDCTPQQGHNSLYWYQQSQNKELEFLVYFENKELFDQTEMHKKRFSSKCPPDSPCRLEILSSEPGDSALYFCASSP
Microcebus murinus V163 trbv ABDC02011024.1 170434 STDAGVTQTPRNRIANSGQSILLECSQTQDHDRMYWYRRDPGLGLRLIYYSLGVNSTDKGEVSKGYSVSRKEQAKFSLSLETAFPNQTALYFCASSY
Microcebus murinus V164 trbv ABDC02011024.1 201157 LVDAEVTQTPGHLIKRTGEKVLLECSQDMDHERMFWYRQDPGLGLRLIYFSFDVGSEEKGDVWEAYSASRKQKDRFPLVLESAGTNQTSVYLCASR
Microcebus murinus V165 trbv ABDC02011024.1 208628 SVLAVLVSQTPSRVICKHGTSVTIQCRVDSQVTLMLWYRQLPGQNLMLMATANEGSEATYESGFTKDKFPISRPTLTFSNMTVSNVSPEDSSLYFCSAG
Microcebus murinus V204 trav ABDC02015322.1 10723 AHAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSHLELEDEGVYICEF
Microcebus murinus V213 iglv ABDC02016173.1 8142 SLPQPVLTQPPSASASPGASAKLTCTLSSAHGGYGIAWHQQQPGKAPRYLMWLKSDGSHSKGDGVPDRFSGSSSAADRYLTISNVQPEDEADYYCQTWETGV
Microcebus murinus V214 iglv ABDC02016175.1 7478 SLSQPVLTQPPSASASPGASAKLTCTLSSGYSNYGIAWHQQHPEKSPRYLMYVYSDGSQSKGDGIPDRFSGSSSGADRYLTISNVQPEDEADYYCQTWDGGV
Microcebus murinus V215 iglv ABDC02016175.1 13753 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGGYAVHWYQQLPGTAPKLLIYGNSDRPSGVPARFSGSKSGSSASLTIAGLQAEEEGDYYCQSYDGSLDA
Microcebus murinus V216 iglv ABDC02016175.1 20080 SLANFVLTQPSSVSGSPGQKVTVSCTRSSGNIGSNYVYWYQQRPGSAPTTVIYRDDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSA
Microcebus murinus V217 iglv ABDC02016175.1 23698 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDGSLS
Microcebus murinus V218 iglv ABDC02016176.1 1875 SWAQSALTQPPSASGAPGQSVTISCSGSSSNIGGNYANWYQQLPGTAPKLLIYGNSDRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCSSWDDSLS
Microcebus murinus V309 igkv ABDC02025388.1 109 SSGDVVMTQTPLSLPVTPGETASISCRASESIQHSDGNTYLSWFLQKPGQPPRLLIYKISNRDTGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCTQVSFVP
Microcebus murinus V419 trdv ABDC02041100.1 768 STVAQKVTQAETARSTTVGRAVTLNCRYKISVTQYYIYWYKQLPSKEMIFLLGQYSGSPNEKDGRYSVNFWKHAKSIDLTISALQLEDSAKYFCALWD
Microcebus murinus V420 trav ABDC02041100.1 3462 MSGQQVKQIPQFLHIQEGDDFSTYCNSTSTLNGMQWYKQRPGGSPVLLIILVKGGEVKKEKRLTAQFGEARKGSFLHITAAQTADVGTYFCAV
Microcebus murinus V425 ighv ABDC02042007.1 4498 ALSQVQLVQSGAEMRSPGASVKVSCKASGYTFTSSYMHWVRQAPGQGLEWMGRVDPEDGSTRYSQKFQGRVTMTATTSTNTAFMELNSLRPEDTAVYYCA
Microcebus murinus V426 ighv ABDC02042016.1 709 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAFIRTKAYGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V427 ighv ABDC02042018.1 3859 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISNGGGSTYYTDAVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAR
Microcebus murinus V428 ighv ABDC02042019.1 160 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISSGGSTYYTDVVKGRFTISRDNGKNSLYLQMNSLRAEDTAVYYCAR
Microcebus murinus V429 ighv ABDC02042019.1 9354 AHSQVQLVQSGAEVKPPGASVKVSCKASGYTFTSYYMHWVRQTPGQGLEWMGEINPNSGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPDDTAVYYCA
Microcebus murinus V430 ighv ABDC02042019.1 30252 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTLTSYGMNWVRQAPGKGLEWISYIYSSSTSYADSVKGRFTISTDNGKNSLYLQMNSLRAEDTAMYYCA
Microcebus murinus V431 ighv ABDC02042019.1 40921 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSSYYMYWVRQAPGKGLEWVGFVRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V433 ighv ABDC02042019.1 55907 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSNYYMYWVRQAPGKGLEWISTISNSGSSTGYADSVKGRFTTSRDNSKNMLYLQMNSLKAEDTALYYCAR
Microcebus murinus V434 ighv ABDC02042020.1 12880 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYAMSWVRQAPGKGLEWMAVLWSGGSTNYADAVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCAR
Microcebus murinus V435 ighv ABDC02042020.1 19451 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYDMHWVRQAPGKGLEWVSVIGIGGSTYYADAMKGRFTISRDNGKNMLYLQMSSVQAEDTAVYYCTR
Microcebus murinus V436 ighv ABDC02042020.1 27897 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSRINPDGGSTNYADAVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V437 ighv ABDC02042021.1 4000 AHSEVQLVQSGAEVKPPGASVKVSCKASGYTFTNYAMHWVRQAPGQGLEWMGWIYTNTGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V438 ighv ABDC02042021.1 15330 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSFDDYVMHWIRQAPGKGLEWISYIYSSSTSYADSVKGRFTISSDNGKNMLYLQMNSLRAEDTAMYYCAR
Microcebus murinus V439 ighv ABDC02042021.1 25484 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINGDGGNTNYADAMKGRFTISRDNSKNTLYLQMNSLRAKDTAVYYCGR
Microcebus murinus V440 ighv ABDC02042021.1 64125 VQCEVQLVESGGGLVQPGGSLRLSCEASGFTFSSYYMSWVRQAPGKALEWVSYITGDGSSTSYADAVKGRFTTPRDNSKNMLYLQMNNLRAEDTAIYYCAR
Microcebus murinus V441 ighv ABDC02042022.1 810 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTVSSYDINWVCQVPGKGLEWVSRISGGGSTYYTDAMKGRFIISRDNGKNSLYLQMNSLRAEDMALYYCAS
Microcebus murinus V442 ighv ABDC02042036.1 5656 IAGGVWGRLGPAWGYLKLSCAASGFTFSSYWMSWVRWVHQGRGWSGVSYINNDGDSTSYADAMRGRFTISRNNSKNSLHLQCNSVRAEDTAVYYCAR
Microcebus murinus V443 ighv ABDC02042036.1 13422 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWCDGSKQYYADAVKGRFTISRDNSKNMLYLQMNSLRTEDTALYYCAK
Microcebus murinus V444 ighv ABDC02042040.1 13298 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYYMHWVRQAPGKGLEWVSYIDYDGDSTSYTDSVRGRFTISRDNGKNMLYLQMNSVRAEDTAMYYCAR
Microcebus murinus V445 ighv ABDC02042040.1 32221 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVADINGDGGSTNYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAT
Microcebus murinus V446 ighv ABDC02042040.1 40572 VQCEVQLVESGGGLVQPGGSLKLSCVASGFTFSDYYMHWVRQAPGKGLEWVAFIRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRTEDTAVYYCER
Microcebus murinus V447 ighv ABDC02042040.1 54713 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVSSIYSSSSTYYADAVKGRFTTSRDNGKNSLYLQMNSLRAEDTAVYYCAR
Microcebus murinus V448 ighv ABDC02042040.1 62737 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVAHIRYDGSKQYYADAVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAR
Microcebus murinus V468 ighv ABDC02045475.1 64 AHSQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMHWVKQAPGQGLEWMGRVDPEDGSTSYAKKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCAR
Microcebus murinus V469 ighv ABDC02045475.1 9296 VQCEVQLLESGGGLVLPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSYITTGGGSTYYADAVKGRFTISRDNSKNLLYLQMNSLKAEDTAMYYCAR
Microcebus murinus V470 ighv ABDC02045475.1 27874 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSTTYLQMNSLRAEDTALYYCAR
Microcebus murinus V471 ighv ABDC02045479.1 8103 VQCNVQLVESGGGLVQPGGSLTLSCAASRFTFSSYAMSWFRQAPGKGMEWVALIRNDGSTYYADAVKSEFTISRDNAKNKLYLQMNSLRAEDTALYYCAR
Microcebus murinus V472 ighv ABDC02045482.1 4818 RDAAGGVWRRLSPAWGGSLRLSCAASGFTFSSYGMNWVCQAPGKGLEWVSYIYSSSSIYYADAVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCARDTVRG
Microcebus murinus V473 ighv ABDC02045482.1 13544 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSFAMSWVRQAPGKGLEWVSAISGNGGSTYYADAVKGRFTISRDNGKNSLYLQMNSLRVEDTAMYYCAR
Microcebus murinus V474 ighv ABDC02045485.1 18 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTLTSYGMNWVRQAPGKGLEWISYIYSSSTSYADSVKGRFTISTDNGKNTLYLQMNSLRAEDTAMYYCARHTVRG
Microcebus murinus V475 ighv ABDC02045485.1 10694 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVSRINPDGGSTIYADAVKGRFTISRDNSKNSLYLQMNSLKAEDTAVYYCA
Microcebus murinus V476 ighv ABDC02045485.1 16948 VLSELTLQESGPGLVTPSQTLSLICSVSGGSVTTSYYWHWIRQRPGRALEWMGYWIGSTSYNPAFQGRISITADTSKNQFSLQLSSLTAEDTAMYYCAR
Microcebus murinus V498 trav ABDC02048336.1 46678 TAGQSIEQPSELTAVEGAFMQVDCTYRTSGFNGLSWYQQRDRGAPIFLSYSVLDGLEGRGRFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Microcebus murinus V499 trav ABDC02048339.1 22499 GLRAQSVTQPEDQVTVGEGNPLTVKCTYSYSGSPYLFWYVQYPNQGLQFLLKYIRGDNLVKGSYGFEAELNKSQTSFHLKKASALGSDSALYFCAVS
Microcebus murinus V500 trav ABDC02048339.1 32162 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATDEYIFWYKQFTNQGPQFIIRGFKTNVTNEVASLFMPADRKSSTLSLPRAALSDSAVYYCILA
Microcebus murinus V501 trav ABDC02048342.1 3497 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATSESIFWYQQFPNQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLSRAALSDSAVYYCILD
Microcebus murinus V502 trav ABDC02048342.1 13592 TLSLAKTTQPIAMESYEGQEVNIPCSHTDIATSENIFWYQQLPNQGPRFIIQGYKTNVTDEVASLFIPADRKLSTLRLPRAALSDSAVYYCILA
Microcebus murinus V503 trav ABDC02048342.1 23626 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATNEYIVWYQQFPNQGPRFIIQGFKTNVTNEVASLFIPADRKSSTLRLPRAALSDSAVYYCILD
Microcebus murinus V504 trav ABDC02048343.1 5073 GTRAQSVTQPDGHISVSEQDPLELRCNYSSSVPPYLFWYVQYPNQGLELLLKYTSGNSLVTGIKSFKAEFNKAETSFHLKKASAHLSDSAQYFCAVS
Microcebus murinus V505 trav ABDC02048343.1 14851 MSRGEKLEQSPFLSVQEGDSSVINCTYTETTSTYFYWYKQGPREGLQLIMTIFSYEDKKQERRLSVLLNKMEKHLSLHISDTQPADSAVYFCAVS
Microcebus murinus V506 trav ABDC02048343.1 22247 VHSQKIEQNPRALSIQEGETAAVTCNYTSYSPAFFQWYRQDPEKGLVFLLLIRENEGEKQEGRLKVTFDTKLKQSSFYIADSQPADSAAYLCAA
Microcebus murinus V507 trav ABDC02048343.1 29276 DAGAQSVTQPDGHVTVSEEYSLELRCNYSYGGAFYLFWYVQYPGQGLQLLLQYYSGNTLVKGIKGFEAEVRKDESSFTLRKPRVHWSDTAEYFCALS
Microcebus murinus V508 trav ABDC02048343.1 33799 GSHGDSVTQTEGQMLLTERDSLIVNCSYETSQYPSLFWYVQYPGEGPQLLLKAMKANDKGINKGFEATYNRETTSFHLQKASVHESDSAVYYCALS
Microcebus murinus V509 trav ABDC02048343.1 39504 DARAQSATQPDLSITVSEGASLELRCNYSYRGGSPYLFWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEVRKDESSFTLRKPRVHWSDTAEYFCALS
Microcebus murinus V510 trav ABDC02048343.1 54183 GVRGLDVQQSPSVLSVQEGASPTLRCNFSATVYSMQWFRQNPGGGLINLFFMTSGTKQNGRLNSTMNSKELYGTLHITATQLEDSGTYLCAVPD
Microcebus murinus V511 trav ABDC02048344.1 8162 VTRGENVEQHPSTLHVQEGDTSVINCTYTDSASNYFPWYKQQLGKGPQLFINIRSNMDNKKEGRFTLLLSKTAKHFSLHIAATQPGDSAVYFCAAG
Microcebus murinus V512 trdv ABDC02048344.1 14982 SGMAQKVTQSQPAMWVQEKEAVTLDCAYDTSVSRFSLFWYKQPSSGELIFLIRQDSYNEQNATEGRYSLNFQKARKSIHLTISASQLEDSAMYFCALKD
Microcebus murinus V513 trav ABDC02048345.1 4532 VSGQNQVEQSPQSLIVLEGENCTLQCNHTVSPFNNLRWYKQETGKGPVSLIIMTYSKNKESKGRYTATLDANTKQSSLHVTASQLSDSASYICVVS
Microcebus murinus V514 trav ABDC02048345.1 18192 VRSQQVVEQTPESLVVSEGTTASLSCTYSDTASQSFLWYRQYSGKGLELLMFIYSTGDKEEGRFTAQLNKASRNVSLLIRDSQPSDSATYLCAVS
Microcebus murinus V515 trav ABDC02048345.1 22014 GTRAQTVTQPDLHVTVTEGASLELKCSYTASFTPTVWWYVQYPNQGLQLLLKYISGSTLVKGIQGFEAEFRKNETSFHLKKHSAHLSDSAQYFCAVR
Microcebus murinus V516 trav ABDC02048345.1 34725 GVRGLDVQQSPSVLSVQEGASPTLRCNFSATVYNMQWFQQKPGGGLINLFFMSSGTKQNGRLNSTMNSKELYSTLHIMATQLEDSGTYLCAARE
Microcebus murinus V517 trav ABDC02048345.1 40539 VRGGENVGLHPPTLSVQEGDTSVINCSYSDSASSYLLWYKQKLGKSPQSIIDIRSNMGKKQKGRFTVFLSKTAKHLSLHIAATQPGDSAVYFCAES
Microcebus murinus V518 trav ABDC02048345.1 46353 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTSVSRFSLFWYKQPSSGEMIFLIRQDSYKQQNATEGRYSLNFQKANKSIKLVISALQLGDSAIYFCALSE
Microcebus murinus V519 trav ABDC02048345.1 53114 RTHGDSVTQTEGQVTLSEKAFLHINCTYTARGYPFLFWYVQYPGEGPQLLLKAATANDKGMNKGFEATYKKETTSFHLEKASVHESDSAVYYCAMS
Microcebus murinus V520 trav ABDC02048345.1 56460 VRSQQKEVDQTPEFLSVSEGAMASLNCTYSNTASQYFFWYRQYSGKGPELLVYIFSTGDKQEGRFTAQLNKASRYVSLLIRDSQPSDSATYLCAL
Microcebus murinus V521 trav ABDC02048345.1 66555 GVRGLDVQQSPSVLSVQEGASPTLRCNFSAAVRSMQWFLQKPGGSLISLFFMASGIKQNGRLNSTMNSKELYGILHITATELEDSGTYLCAAEE
Microcebus murinus V522 trav ABDC02048345.1 72726 VRGGENVGLHSPTLSVQEGDTSVINCSYSNSNSDYFPWYKQELGKGPQFIIDIRSNRDEKEDQRFTVLLNKTAKHLSLHIAGTQPGDSAVYFCAES
Microcebus murinus V523 trav ABDC02048345.1 80055 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTRDSTYYLFWYKQPSSGEMILLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQVGDSAIYFCALSE
Microcebus murinus V524 trav ABDC02048346.1 10083 GVRGLEVRQSPSVLSVQEGASPTLRCNFSATVTSMQWFLQKSGGSLISLFYMASGTKQNGRLNSTMNNKELYSTLHITATQLEDSGTYLCAAEE
Microcebus murinus V525 trav ABDC02048346.1 15668 VRGGENVGLHPPTLSVQEGDTSVINCSYSNSASIYFSWYKKELGKGPQFIIDIRSNRDKKEEQRFTIFVNKTVKHLSLHIAGTQPGDSAVYFCAES
Microcebus murinus V526 trdv ABDC02048346.1 25150 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTSTSVASYALLWYKQPSSGEMILLIHQDSYKEQNATDGRYALNFQKASKSIKLVISASQVGDSAIYFCALNQ
Microcebus murinus V527 trav ABDC02048347.1 10530 VRSQQKEVEQTPKSLSVSEGSTASLNCTYSNIASQYFFWYRQYSGKGPEVLMSIFSTGDKEEGRFIAQLNTASRYVSLLIRDSQPSDSATYLCAVS
Microcebus murinus V528 trav ABDC02048347.1 15792 GTWAQRVTQPDGHITVSEGDPLELRCNYSSSVSPYLFWYVQYPNQGLELLLKYTSGNSLVTGIKSFKAEFNKGETSFHLKKASAHLSDSAQYFCAVS
Microcebus murinus V529 trav ABDC02048347.1 24051 GTRAQTVTQPEECLSVFKGAPVQLKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISRDSVKGFTAVLNKGEATFHLEKTSVQEEDSAMYYCALS
Microcebus murinus V530 trav ABDC02048347.1 28050 VNSQQGEENLQALSIQEGENATINCSYTSNINNLQWYRQDAGRGPTLLILIRANKREERHGRLTATLNPSIKSSSLIITASCAADTATYFCATD
Microcebus murinus V531 trav ABDC02048347.1 32395 GTDGDSVTQTEGPVTLPEGEALTLNCTYQSNYAAFLFWYVQFQNKEPELLLKSSSETQETDGRGFQANNNKSDSSFHLKKPSVQLSDSAVYFCAMR
Microcebus murinus V532 trdv ABDC02048347.1 39204 PSMAQKVTQAQPEISVVEKESVTLDCVYETRHMTYYLFWYKQPPSGEMIFLIHHDSFNEKNETKDRYFLNFQKSINSISLTITASELTDSAAYFCALRE
Microcebus murinus V533 trav ABDC02048347.1 48120 RSNGDSVTQTEGTVTLSEGAPVTLNCTYQTTYSVAYLFWYVQYLNQSPQLLLKSSTENQKSENQGFQANLVKSDRSFHLEKASLRMSDSAVYYCALR
Microcebus murinus V534 trav ABDC02048347.1 50477 SSVSQKITQAPAAISMLERKAVTLDCVYEATAFSYYLFWYKQPSNGEMILLIDHESFNERNATKGRYSLTFQKSASSISLTITALQLGDSAMYFCALRE
Microcebus murinus V535 trav ABDC02048347.1 65972 VSSKQEVMQTPETLSVPEGESLALNCSFTDSAIYFLQWFRQDSGKGLTSLLLIQSNQREQTSGRFKASLDKSSRQSTLNIAASQPGDSATYLCAV
Microcebus murinus V536 trav ABDC02048347.1 74385 VRGMKVEQSPPALSLHEGASSMLWCNFSAASSTVQWFRQNPGGRLINLFYIPSGTKQIGRLTATTVAKERHSSLYISSSQTTDSAIYFCAVEP
Microcebus murinus V537 trav ABDC02048347.1 83832 KTESDRKQVKQSPESLIVHEGSISILKCTYENSAFDYFPWYRQFPGKAPALLIAIRSFDSEKEDGRFTAFLNKSAKHFSLHITPSQPGDSATYFCAA
Microcebus murinus V538 trdv ABDC02048347.1 91384 STVAQKVTQAQTATSMIMGWTVTLNCQYEASWTAFSIYWYKQLPSKEMIFLLRQVSGSDNAKNGRYSVNFQKEAKSIDLIISALRLEDSAKYFCALWD
Microcebus murinus V539 trdv ABDC02048347.1 98672 STVAQKVIQTQTATSMTVGQSVTLKCRYETSSITYYIFWYKQLSSKEIILILRQDSSRENAKNVRYSVNFRKAANSIDLTISALRLKDSAKYFCALWD
Microcebus murinus V540 trdv ABDC02048347.1 114644 STVAQKVTQAQPATSMTVGQAVILNCQYETSWPQYYIYWYKQIPSKEMIFLLRQGSTRPSEKSGRYSLNFEKEDKSINLTISALRLEDSAKYYCALQE
Microcebus murinus V541 trdv ABDC02048347.1 123021 STVAQKVTQAETARSTTVGRAVTLNCRYKISVTQYYIYWYKQLPSKEMIFLLGQYSGSPNVKDGRYSVNFWKHAKSIDLTISALQLEDSAKYFCALWD
Microcebus murinus V542 trdv ABDC02048349.1 1382 STVAQKVTQAETSRSSTVGRAVTLNCQYEIGWSAYIIFWYKQLPSKEMIFLLRWSSGDGNTKNGRYSVSFQTQANSIDLTISALRPEDSAKYFCALWD
Microcebus murinus V543 trav ABDC02048349.1 16589 LNGQQVKQIPEFLHIQEGEDFSTYCNSTSTLNIVHWYKQRPGQSPVFLMLLVKGGEVKKEKRLTAQFGEARKGSSLHITAAQTADVGTYFCAV
Microcebus murinus V544 trdv ABDC02048349.1 24093 STVAQKVTQAETSRSSTVGRAVTLNCRYKTSWSAYYIFWYMQLPSKEMIFLLRQYSGERNANNGRYSVIFQKRANSIYLIISALRLEDSAKYFCALWD
Microcebus murinus V545 trdv ABDC02048350.1 10539 STVAQKVTQAQSATTMTVGQAVTLNCRYKTSWTAYYIFWYKQLPSKEMIFLLSQDSDMQSEKSGPYSLNFRKEDKSIDLTISSLRLEDSAKYYCALQE
Microcebus murinus V546 trdv ABDC02048352.1 9356 STVAQKVTQVETARSTTVGAVVTLNCQYETSGGAYFFIFWYKQLPSKEMIFLLRQGSDLYNAKDDQRYSVNFQEEANSIDLTISALRLEDSAKYFCALAE
Microcebus murinus V547 trav ABDC02048352.1 16738 LNGQQVKQIPEFLHIQEGEDFSIYCNSTSTLTTAQWYKQRPGGSPVLLMILVKDGEVKEKRLTAQFVETRKGSSLHITAAQTADVGTYFCAVAQCSP
Microcebus murinus V548 trav ABDC02048352.1 26723 TIIAAETTQPDSMDCAEGEAVNLACNHSTISGNEYIHWYRQNPSQSPQYIIHGLKNAVTNDMASLTIAADRKSSTLTLPHVTLRDAGMYYCILR
Microcebus murinus V549 trav ABDC02048352.1 36645 RTGAQSVTQPDIHVTVSERDSLKLRCNYSTGGGASYLFWYVQYPGQSLQFLLKYVSGDTLVKGMKGFEAELRKNETSFHLKKHSAHLSDSAQYFCALS
Microcebus murinus V550 trdv ABDC02048352.1 70025 SSMSQQIIQPQLAISKQEGETVELECSYDTSVPYHILYWYKRPPSGEIIYLIHHRIDADTNATTQGRYSVSFQKATKTIRLIISSSQPEDSATYFCCLRQ
Microcebus murinus V551 trav ABDC02048352.1 79580 IMGDAKTTQPNSVECTEEEPVYLPCNHSTISGSEYVYWYRQILLQGPEYVIHGLKGNVTNSMATLAISADRKSSTLILPRVTLGDTAVYHCIVR
Microcebus murinus V552 trav ABDC02048352.1 88298 VSSQELEQSPRSLIIQEGEDLTINCNSSKTLYGIQWYRQKYGEGGLSFLMLLLKSVEEKSHEKITARLDEKKQQSSLHITASDPSHSGIYLCGAE
Microcebus murinus V553 trav ABDC02048353.1 7625 VSSEDKVVQSPPSMAVHEGDSATLTCNYVVSYFRSLQWCKQEKNAPVFLFTLTSSGIEKKSGRFSSILDNKELSTLNITATQTGDSAIYFCAVE
Microcebus murinus V554 trav ABDC02048354.1 25128 SSVAQTVTQSQPEMSVQEAETVTLDCTYATSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Microcebus murinus V555 trav ABDC02048354.1 43999 LRGEVEVQQSPLSLSTQEGEDCTIYCNYSSSASDRLAWYRQDPGKSLEFLFVLLSNGAVKREGPLTASLDTKARLSTLHVGAPQPGLSATYFCAV
Microcebus murinus V556 trdv ABDC02048355.1 72988 VMPAIVLVPENQAVTVPAGGSTTLRCSMEGAPIDHYYINWYRKTQDNTLTFIYRESNIYGPGFQGGFQGGNDFDKKQAFLRILKASESDEGFYYCACD
Microcebus murinus V559 trbv ABDC02048415.1 3510 PMDTGVTQTPRHLVMGMTDKKSLECEQNLGHNAMYWYKQSAKKAPELMFLCRLQKLTDNLTVPSRFTPECRDSSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V597 ighv ABDC02054401.1 5726 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSRINTNGGSTYYADSVKGRFTISRDNGKNMLYLQMNSLKAEDTALYYCAR
Microcebus murinus V598 ighv ABDC02054402.1 8923 AHSQVQLVQSGAEVKPPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGRINPNSGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V599 ighv ABDC02054404.1 1779 AHCQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMYWMKQAPGQGLEWMRRIDPEDGSTRYAQKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCA
Microcebus murinus V616 trbv ABDC02000620.1 315 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V619 ighv ABDC02001288.1 1144 AHSQVQLVQSGAEVRPPGASVKVSCRASGYTFTSYYMDWVKQAPGQGLEWMGGVDPEDGSTSYAQKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCAR
Microcebus murinus V620 iglv ABDC02001458.1 14897 SLSQPVLTQPPSLSASLGASAGLTCTLSSGTVVGGYHISWYQQKPGGPPRYLLRYYSDSDKHQGSGVPSHFSGSKDASANAGILHVSRLQPEDEADYYCM
Microcebus murinus V621 iglv ABDC02001458.1 1145 CADPAPSLSASPGASARLTCTLSSGFSVDSYAIAWHQQKLGSPPRYLLTYHTDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCMTGDGSSKS
Microcebus murinus V622 iglv ABDC02001459.1 40943 SLANLVLTQPSSVSGSPGQKVTISCTRSSGSIGDYYVHWYQQRPGSAPTTVIYGDDKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSN
Microcebus murinus V623 iglv ABDC02001459.1 25486 SWAQSALTQPPSVSGAPGQSVTISCSNIKGSYANWYQQLPGTAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLRA
Microcebus murinus V624 iglv ABDC02001459.1 21492 CANPAPSLSASPGASARLTCTLSSGFSVGSYGIFWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCMT
Microcebus murinus V625 iglv ABDC02001461.1 24992 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGGGYVVHWYQQLPGTAPKLLIYGGSGRPSGVPARFSGSKSGSSASLTIAGLQAKDEADYYCQSYDSSLRA
Microcebus murinus V626 iglv ABDC02001461.1 16153 SLSQPVVTQPPSLSASPGASARLTCTLRSDISVGGKDMYWYQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V627 iglv ABDC02001461.1 11229 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGDAYVTWYQQRPGSAPTTVIIGDDQRPSRVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYGIRNS
Microcebus murinus V628 iglv ABDC02001461.1 7854 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEEEADYYCSTWDRTLS
Microcebus murinus V629 iglv ABDC02001463.1 24738 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGYDAHWYQQLPGTAPKLLIYDNSKRPSGVPARFSGSKSGSSASLAIAGLQAEDEADYYCSAWDSSLS
Microcebus murinus V630 iglv ABDC02001464.1 4357 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGDAYVNWYQQRPGSAPTTVIYGDDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYGIRNS
Microcebus murinus V631 iglv ABDC02001464.1 970 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDRSLSA
Microcebus murinus V632 iglv ABDC02001466.1 11123 SWAQSALTQPPSVSGAPGQSVTISCSNIKGNYAHWYQQLPGTAPKLLIYDNSKRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V633 iglv ABDC02001466.1 5189 SLSQPVVTQPPSLSASPGASARLTCTLSSGFSVGSYAISWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDALANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V634 iglv ABDC02001467.1 19627 SLANFFLTQPSSVSGSPGQKVTLSCTRSSGNIGSYYVSWYQQRPGSAPTTVIYRDDKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V635 iglv ABDC02001467.1 2603 SWAQSALTQPPSVSGAPGETVTISCSGSGSNIGGGYAAHWYQQLPGTAPKLLIYSNSGRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYFCQSYDSSLRA
Microcebus murinus V640 ighv ABDC02002127.1 503 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSRINTDGGSTYYADAVKGRFTISRENGKNTLYLQMNSLKAEDTAVYYCVR
Microcebus murinus V641 ighv ABDC02002132.1 16207 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYGMNWVRQAPGKGLEWVSYISWNGGSTYYADAVKGRFTISRDNSKNMLYLQMNSLRAQDTAVYYCAR
Microcebus murinus V644 ighv ABDC02002572.1 9722 AHSEVQLVQSGAEVKPPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMRLINPNNGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V645 ighv ABDC02002578.1 475 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVGEINGDGGSTNYADAVKGRFTISRDNGKNTLYLQMNSMKAEDTAVYYCAR
Microcebus murinus V646 ighv ABDC02002581.1 3777 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRKAPGKGLEWVSYINGDGGYTIYADAVKGRFTISRDNSKNLLYLQMNNLKAEDTAMYYCAR
Microcebus murinus V649 igkv ABDC02002837.1 27396 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Microcebus murinus V650 igkv ABDC02002837.1 19892 IRCDIQMTQSPSSVSASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYAASNLYPGVSSRFSGSGSGTDFSLTIRGLETDDAATYYCHQGYST
Microcebus murinus V651 igkv ABDC02002837.1 15759 SRGDVVMTQTPLSLPVTPGELASISCRASQSILHSDGNTYLNWFLQKPGQPPKRLIYKVSNRDSGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQASYYP
Microcebus murinus V652 igkv ABDC02002837.1 3259 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQLLIYRVSNRASGVPDSFSGSGSGTDFTLKISRVEAEDVGVYYCVQG
Microcebus murinus V653 igkv ABDC02002838.1 11430 TRCDILMTQSPSSVSASPGETVTISCRASQGIYNSLAWYQNKPGKPPKPLIYGASNLYPGVSSRFSGSGSGTDYSLTIRGLETDDAATYYCHQGYSF
Microcebus murinus V654 igkv ABDC02002839.1 15139 SSGEIVMTQSPLSLPVTPGELASISCRSSQSLLHSNGNTYLYWFLQKPGQSPQPLIYLVSNWFSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDLQTP
Microcebus murinus V655 igkv ABDC02002839.1 8459 TRCDIQMTQSPSSVSASPGETVTISCRASQGINNNLVWYQHKPGKPPKSLIYGASNLYPGVLSRFSGSGSGTDYSLTIRGLETDDAATYYCQQYNSF
Microcebus murinus V656 igkv ABDC02002839.1 4342 SSGDVVMTQTPLSLPVTPGESVSITCRASQSLQDSDGNTYLNWFLQKQGQPPRRLIHKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQASYFP
Microcebus murinus V657 igkv ABDC02002844.1 1752 SSGDIVMTQTPLSLSVTPGEPASISCRASESITTSKGNIFLHWLLQKPGQPPKRLIYTISNRDTGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQASYYP
Microcebus murinus V670 igkv ABDC02004108.1 44558 ACGDIVMTQSLRSLVASAGERVTINCKSSQSLLSNNKNYLAWHQQKPGQAPKLLISWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYHSAP
Microcebus murinus V671 ighv ABDC02004123.1 6471 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYDMHWVRQAPGKGLEWVAVISYDGSNQYYADTVKGRFTISRDNSKNSLYLQMNSLKVEDTAMYYCAR
Microcebus murinus V679 iglv ABDC02004798.1 20914 SVASQPNQVPAVSVALGQTASITCQGDGLRSYYPGWYQQKPGQAPVLVFYGNNKRPSGIPERFSGSKSGNTAMLTISGAQADDEADYYCQTWD
Microcebus murinus V680 iglv ABDC02004798.1 10384 SVASQLTQVPAVSVALGQTARITCQGDSLRSYYANWYQQKPGQAPVLLIYGDNQRPSGIPERFSGSKSGNTATLTVSGAQVEDEADYYCGSYAGS
Microcebus murinus V681 iglv ABDC02004798.1 3409 AVSPYELTQPPSVSVTPGQTARIPCSGDKLDERYVHWYQQKPGKAPVLVIYEDSKRPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCHVWDGSSNH
Microcebus murinus V682 iglv ABDC02004800.1 25957 ATSQEVVTQETSLLTTPGGTVTLTCGSSTGAVTTSNYASWVQQKSNEVPRGLIGGTSNRYPGVPARFSGSLLGDKAALTITGAQAEDEAKYYCALWFSNH
Microcebus murinus V683 iglv ABDC02004800.1 11108 ATSQEVVTQETSLLTTPGGTVTLTCGSSTGAVTTSNYANWVQQGSNEVPRGLIYGTSNRYPGVPARFSGSLLGDKAALTITGAQAEDEAEYYCALWFSNH
Microcebus murinus V684 iglv ABDC02004802.1 20418 SLTNLVLTQPNSVSGSPGQKVTISCTRSTGSIGGYFVHWYQQRPGSAPTTVIYADDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V685 iglv ABDC02004802.1 3952 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGDGYNAHWYQQLPGMAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTITGLQAEDEGDYYCQSYDSSLDA
Microcebus murinus V688 ighv ABDC02005629.1 642 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSGSWMHWVRQAPGKGLEWVSYINGDGGSTNYADAVKGRFTISRDNSKNSLYLQMNSLKAEDTAMYYCAR
Microcebus murinus V711 trbv ABDC02011024.1 250693 ARAQTIHQWPAIKVQPVGSPLSLECTVKGTSSPTLFWYRQAAGGPLQLLFYSVGVGQITPEEPQNLSASRLQDGQFTLSSEKLLLSHSGFYLCAWS
Microcebus murinus V714 ighv ABDC02011276.1 592 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHHMHWVRQAPGKGLEWVGLIRNKAYGGTAEYAASVKGRFTILRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V773 trgv ABDC02019437.1 182092 SQISCNLEGRTMVIIKKTGSSIIIPCDIPESTNYIHWYLLQEGKALRRLLYYDLFQFRLTVESGFSSEKYFAYASTGKNSRFVLQYLEASDSGVYYCAT
Microcebus murinus V774 trgv ABDC02019437.1 171353 HLEQPQLSSTKALSKTARLECVVSEGTVSASSIYWYQERPGEVIQLLAYVLSNDTVRTAPGIAPNKFEVDKIPEASTCTLTIHNVEKQDSATYYCASWE
Microcebus murinus V775 trgv ABDC02019437.1 159242 GLGLSEVEQSHKSISTEVTKNINIHCKISSTHFETEVVHWYQQKPNQVLKHLIQVTSTKSSVQVSSEGRKDKVVAKKYPQNSTSVLTINSVQKEDTAIYYCAGW
Microcebus murinus V776 trgv ABDC02019437.1 151669 GLGNLEQPKISVSAATAKSAHIPCKVALPNFNSQVIHWYRQKPNQGLEHLKYVLSVTSSQDRKSSKIEASKDSQTSTSTLTINFLEKEDEGVYYCAYW
Microcebus murinus V777 trgv ABDC02019438.1 1253 SQVSCNLEGRIKSIFRKTGSTVEISCDIKEGARYIHWYFFPEHMVPRRLLYYDTSSSSKYLDSETKADKYDGSKITDKSFKLHLKHLEASDSGVYYCAVWV
Microcebus murinus V830 trav ABDC02026133.1 3232 GTRAQTVTQPDLHVTVTEGASLELKCSYTASFTPTVWWYVQYPNQGLQLLLKYISGSTLVKGIQGFEAEFRKNETSFHLKKHSAHLSDSAQYFCAVR
Microcebus murinus V844 iglv ABDC02028531.1 3018 AVSPYELTQPPSVSVTPGQTARIPCSGDKLGERYVHWYQQKPGQAPVLVIYGDSNRPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCQVWDSSSDH
Microcebus murinus V976 trbv ABDC02044282.1 315 PMDTGVTQTPRHLVMGMTDKKSLECEQNLGHNAMYWYKQSAKKAPELMFLCRLQKLTDNLTVPSRFTPECRDSSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1006 trav ABDC02047942.1 1988 TPNLAKTTQPITMESYEGQEVNIPCSHTDIATNEYIFWYKQFTNQGPRFIIRGFKTNVTNEVASLFMPADRKSSTLRLPQAALSDSAVYYCILA
Microcebus murinus V1037 trbv ABDC02050268.1 315 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1041 ighv ABDC02050564.1 353 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSTISNGGGNTYYADAVKGRFTISRDNGKSSLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V1042 ighv ABDC02050578.1 771 AHSQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMHWVKRAPGQGLEWMGRINPEYGSTSYAKKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCAR
Microcebus murinus V1044 ighv ABDC02051657.1 496 VQCEVQLLESRGGLAQPGGSLRLSCVASGFAFSSYGMDWVRQAPGKGLEWVSYINVGGGYTNYTDAVKGQFTISRDNSKNLLYLQMNNLKAEDTAMYYCTR
Microcebus murinus V1045 ighv ABDC02051663.1 1023 AHCQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMYWMKQAPGQGLEWMGRIDPEDGSTRYTQKFQGRVTITATTSTNTAFMELNNLRPEDTAVYYCA
Microcebus murinus V1094 igkv ABDC02056183.1 7391 SSGDIVMTQTPLSLPVTPGETASISCRASESITTSKGNIFLHWLLQKPGQPPKLLIYKISNRDTGVSDRFSGSGSGTDFTLTISKVEAEDVGVYYCMQGSYY
Microcebus murinus V1095 igkv ABDC02056190.1 1235 SSGEIVMTQTPVSLPVTPGEPASISCRSSQSLLHSNGKTYLQWFLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQAIQLP
Microcebus murinus V1096 igkv ABDC02056191.1 3109 IRCDIQMTQSPSSLAASPGETVTISCRASQGINKNLAWYQQKPGNAPKHLIYGASNLQSGVSSRFSGSGSGTDYSLTIKSLETDDAGTYYCQQYNNI
Microcebus murinus V1097 igkv ABDC02056192.1 21867 IRCDIQMTQSPSSVSASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYGASNLYPGVSSKFSGSGSGTDYSLTIRGLETDDAATYFCHQYRSN
Microcebus murinus V1098 igkv ABDC02056192.1 17752 SSGDVVMTQTPLSLPVTPGELASISCRASESLLYSDGNTYLNWFVQKPGQPPKRLIYKVSNRDNGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCVQGTKLP
Microcebus murinus V1099 igkv ABDC02056192.1 4894 SFGEIVMTQSPLSLPVTPREPASISCRSSQSLLHSDRNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQS
Microcebus murinus V42 ighv ABDC03003584.1 7305 VQCDVQLLKSGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWISLINPNGGSTYYADAVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V43 ighv ABDC03003596.1 5789 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSRINTNGGSTYYADSVKGRFTISRDNGKNMLYLQMNSLKAEDTALYYCAR
Microcebus murinus V44 ighv ABDC03003596.1 21779 AHSQVQLVQSGAEVKPPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGRINPSSGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V45 ighv ABDC03003598.1 2143 AHCQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMYWMKQAPGQGLEWMRRIDPEDGSTRYAQKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCA
Microcebus murinus V46 ighv ABDC03003630.1 849 AHCQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMYWMKQAPGQGLEWMGRIDPEDGSTRYTQKFQGRVTITATTSTNTAFMELNNLRPEDTAVYYCA
Microcebus murinus V47 ighv ABDC03003634.1 1651 VQCEVQLLESRGGLAQPGGSLRLSCVASGFAFSSYGMDWVRQAPGKGLEWVSYINVGGGYTNYTDAVKGQFTISRDNSKNLLYLQMNNLKAEDTAMYYCTR
Microcebus murinus V48 ighv ABDC03003672.1 8005 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSGSWMHWVRQAPGKGLEWVSYINGDGGSTNYADAVKGRFTISRDNSKNSLYLQMNSLKAEDTAMYYCAR
Microcebus murinus V56 trdv ABDC03004349.1 768 STVAQKVTQAETARSTTVGRAVTLNCRYKISMTQYYIYWYKQLPSKEMIFLLGQYSGSPNEKDGRYSVNFWKHAKSIDLTISALQLEDSAKYFCALWD
Microcebus murinus V57 trav ABDC03004349.1 3462 MSGQQVKQIPQFLHIQEGDDFSTYCNSTSTLNGMQWYKQRPGGSPVLLIILVKGGEVKKEKRLTAQFGEARKGSFLHITAAQTADVGTYFCAV
Microcebus murinus V79 igkv ABDC03005264.1 30036 ACGDIVMTQSLRSLVASAGERVTINCKSSQSLLSNNKNYLAWHQQKPGQAPKLLISWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYHSAP
Microcebus murinus V80 igkv ABDC03005270.1 2441 SSGDIVMTQTPLSLSVTPGEPASISCRASESITTSKGNIFLHWLLQKPGQPPKRLIYTISNRDTGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQASYYP
Microcebus murinus V81 igkv ABDC03005274.1 4301 SSGEIVMTQSPLSLPVTPGELASISCRSSQSLLHSNGNTYLYWFLQKPGQSPQPLIYLVSNWFSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDLQTP
Microcebus murinus V82 igkv ABDC03005274.1 10981 TRCDIQMTQSPSSVSASPGETVTISCRASQGINNNLVWYQHKPGKPPKSLIYGASNLYPGVLSRFSGSGSGTDYSLTIRGLETDDAATYYCQQYNSF
Microcebus murinus V83 igkv ABDC03005274.1 15098 SSGDVVMTQTPLSLPVTPGESVSITCRASQSLQDSDGNTYLNWFLQKQGQPPRRLIHKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQASYFP
Microcebus murinus V84 igkv ABDC03005275.1 8163 TRCDILMTQSPSSVSASPGETVTISCRASQGIYNSLAWYQNKPGKPPKPLIYGASNLYPGVSSRFSGSGSGTDYSLTIRGLETDDAATYYCHQGYSF
Microcebus murinus V85 igkv ABDC03005276.1 2062 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Microcebus murinus V86 igkv ABDC03005276.1 9566 IRCDIQMTQSPSSVSASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYAASNLYPGVSSRFSGSGSGTDFSLTIRGLETDDAATYYCHQGYST
Microcebus murinus V87 igkv ABDC03005276.1 13699 SRGDVVMTQTPLSLPVTPGELASISCRASQSILHSDGNTYLNWFLQKPGQPPKRLIYKVSNRDSGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCMQASYYP
Microcebus murinus V88 igkv ABDC03005276.1 26191 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPQLLIYRVSNRASGVPDSFSGSGSGTDFTLKISRVEAEDVGVYYCVQG
Microcebus murinus V89 igkv ABDC03005280.1 4962 IRCDIQMTQSPSSVSASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYGASNLYPGVSSKFSGSGSGTDYSLTIRGLETDDAATYFCHQYRSN
Microcebus murinus V90 igkv ABDC03005280.1 9077 SSGDVVMTQTPLSLPVTPGELASISCRASESLLYSDGNTYLNWFVQKPGQPPKRLIYKVSNRDNGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCVQGTKLP
Microcebus murinus V91 igkv ABDC03005280.1 21935 SFGEIVMTQSPLSLPVTPREPASISCRSSQSLLHSDRNTYLHWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQS
Microcebus murinus V92 igkv ABDC03005280.1 29597 IRCDIQMTQSPSSLAASPGETVTISCRASQGINKNLAWYQQKPGNAPKHLIYGASNLQSGVSSRFSGSGSGTDYSLTIKSLETDDAGTYYCQQYNNI
Microcebus murinus V93 igkv ABDC03005281.1 1751 SSGEIVMTQTPVSLPVTPGEPASISCRSSQSLLHSNGKTYLQWFLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQAIQLP
Microcebus murinus V94 igkv ABDC03005286.1 3059 SSGDIVMTQTPLSLPVTPGETASISCRASESITTSKGNIFLHWLLQKPGQPPKLLIYKISNRDTGVSDRFSGSGSGTDFTLTISKVEAEDVGVYYCMQGSYY
Microcebus murinus V221 trbv ABDC03015146.1 731648 ARAQTIHQWPAIKVQPVGSPLSLECTVKGTSSPTLFWYRQAAGGPLQLLFYSVGVGQITPEEPQNLSASRLQDGQFTLSSEKLLLSHSGFYLCAWS
Microcebus murinus V368 iglv ABDC03024675.1 15197 TWAEVVFTQPHSVSGSPGESVTLSCTRSSGNIGDNYVSWYQQRPGSAPTTLIYKYDQRPSGVPDRFSGSKDTSSNSASLTISGLQSEDEADYYCLSGYGNYY
Microcebus murinus V369 iglv ABDC03024675.1 48632 SWAQSALTQPPSVSGAPGQSVTISCLGSNSNIGGNYANWYQQLPGTAPKTLIYANSNRPSGVPARFSGSKSGSSASLTITELQAEDEADYYCSAWDDSLS
Microcebus murinus V370 iglv ABDC03024675.1 62415 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSGYTIAWHQQQPGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGADRYLTISNVQPEDEADYYCQTGDSSGV
Microcebus murinus V371 iglv ABDC03024675.1 71824 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGSYYVQWYQQRPGSAPSTVIYKHNKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V372 iglv ABDC03024675.1 80847 SWAQSGLTQEASLSGSVGHKVTLSCAGNSNNVGHTGAVGWYQQVPRGAPKTVMLGTTPPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTWDRTLS
Microcebus murinus V373 iglv ABDC03024675.1 105511 SLSQPAVTQLPSLSASPGASARLTCTLRSDISVGGKYVYWHQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGSKDTSANAGILHVSGLQPEDEADYYCAM
Microcebus murinus V374 iglv ABDC03024675.1 110445 SLANFFLTQPSSVSGSPGQKVTISCTRSSGNIGSNYVHWYQQRPGSAPSTVIYEYNKRPSGVPDRFSGSMDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V375 iglv ABDC03024675.1 119430 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDRSLS
Microcebus murinus V376 iglv ABDC03024675.1 130185 SWAQSALTQPPSVSGAPGQSVTISCSGSGSNIGGNYVYWYQQLPGTAPKTLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCSSWDSSLS
Microcebus murinus V377 iglv ABDC03024675.1 136806 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVDNYVIYWHQQKPGSPPRYLLYYYSDSIKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V378 iglv ABDC03024675.1 141649 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGGYYVHWHQQRPGSAPTTVIYEDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V379 iglv ABDC03024676.1 9910 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSGYTIAWLQQQPGKAPRYLMWLNSDGRHSKGDGVPDRFSGSSSRAERYLTISNVQPEDEADYYCQTWDSSGV
Microcebus murinus V380 iglv ABDC03024677.1 3599 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGNYVHWHQQLPGTAPKLLIYGNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCSSWDSSLS
Microcebus murinus V381 iglv ABDC03024679.1 1267 SWAQSALTQPPSVSGAPGQSVTISCSNIKGSYAHWYQQLPGTAPKLLIYYNSDRASGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V382 iglv ABDC03024679.1 5200 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYAIAWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V383 iglv ABDC03024681.1 479 SWAQSGLSQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDKSLSA
Microcebus murinus V384 iglv ABDC03024682.1 724 SLSQPVLTQPPSASASPGASAKLTCTLSSAHSDYTIAWLQQQPGKAPRYLMDIYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQPEDEADYHCHTWDGAV
Microcebus murinus V385 iglv ABDC03024682.1 9918 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIESSYVHWYQQRPGSAPTTVIYDDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDASA
Microcebus murinus V386 iglv ABDC03024682.1 18879 SWAQSGLTQEALVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNMASLTISGLQPEDEADYYCSTRDKSLS
Microcebus murinus V387 iglv ABDC03024683.1 4423 SWAQSALTQPPSVSGAPGETVTISCSGSSSNIGGYDANWYQQLPGTAPKLLIYYDSDRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCQSYDSSLDA
Microcebus murinus V388 iglv ABDC03024683.1 11082 SLSQPVLTQPSSLSASPGASARLTCTLSSGSSVGSYWINWYQQKPGSPPRYLLSYYSDSYKHQVSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V389 iglv ABDC03024684.1 1444 SLSQPVLTQPPSASASPGASAKLTCTLSSGYSNYGIAWHQQQPGKAPRYLMDVYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQSEDEADYHCQTWDGAV
Microcebus murinus V390 iglv ABDC03024686.1 7467 SLANIVLTQPSSVSGSPGQKVTISCTRSSGNIGSRYVSWYQQRPGSAPTTVIYRDNKRPSGVPDRFSGSIDSSSNSASLTISALQSEDEADYYCQSYDDSC
Microcebus murinus V391 iglv ABDC03024686.1 23358 SLSQPVVIQPPSLSASPGASARLTCTLRSDISVGGKNMYWYQQKPGSPPPYLLRYYSDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V392 iglv ABDC03024686.1 27463 SLANLVLTQPSSVSGSPGQKVTLSCTRSSGNIGSYYVHWYQQRPGSAPSTVIYEDNERPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V393 iglv ABDC03024686.1 37797 SLSQPVLTQPPSASASPGASAKLTCTLSSGYSNYGITWHQQHPEKSPRYLMYVYSDGSQSKGDGVPDRFSGSSSGADRYLTISNVQPEDEADYHCQTWDSGV
Microcebus murinus V394 iglv ABDC03024687.1 7979 SLTNLVLTQPNSVSGSPGQKVTISCTRSTGSIGGYFVHWYQQRPGSAPTTVIYADDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSY
Microcebus murinus V395 iglv ABDC03024687.1 24444 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGDGYNAHWYQQLPGMAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTITGLQAEDEGDYYCQSYDSSLDA
Microcebus murinus V396 iglv ABDC03024689.1 10207 ATSQEVVTQETSLLTTPGGTVTLTCGSSTGAVTTSNYASWVQQKSNEVPRGLIGGTSNRYPGVPARFSGSLLGDKAALTITGAQAEDEAKYYCALWFSNH
Microcebus murinus V397 iglv ABDC03024689.1 25056 ATSQEVVTQETSLLTTPGGTVTLTCGSSTGAVTTSNYANWVQQGSNEVPRGLIYGTSNRYPGVPARFSGSLLGDKAALTITGAQAEDEAEYYCALWFSNH
Microcebus murinus V398 iglv ABDC03024690.1 89600 SVASQPNQVPAVSVALGQTASITCQGDGLRSYYPGWYQQKPGQAPVLVFYGNNKRPSGIPERFSGSKSGNTAMLTISGAQADDEADYYCQTWD
Microcebus murinus V399 iglv ABDC03024690.1 100130 SVASQLTQVPAVSVALGQTARITCQGDSLRSYYANWYQQKPGQAPVLLIYGDNQRPSGIPERFSGSKSGNTATLTVSGAQVEDEADYYCGSYAGS
Microcebus murinus V400 iglv ABDC03024690.1 107104 AVSPYELTQPPSVSVTPGQTARIPCSGDKLDERYVHWYQQKPGKAPVLVIYEDSKRPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCHVWDGSSNH
Microcebus murinus V401 iglv ABDC03024730.1 7996 SLANFFLTQPSSVSGSPGQKVTLSCTRSSGNIGSYYVSWYQQRPGSAPTTVIYRDDKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSY
Microcebus murinus V402 iglv ABDC03024730.1 25020 SWAQSALTQPPSVSGAPGETVTISCSGSGSNIGGGYAAHWYQQLPGTAPKLLIYSNSGRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYFCQSYDSSLRA
Microcebus murinus V403 iglv ABDC03024731.1 687 SWAQSALTQPPSVSGAPGQSVTISCSNIKGNYAHWYQQLPGTAPKLLIYDNSKRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V404 iglv ABDC03024731.1 6621 SLSQPVVTQPPSLSASPGASARLTCTLSSGFSVGSYAISWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDALANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V405 iglv ABDC03024733.1 226 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGDAYVNWYQQRPGSAPTTVIYGDDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYGIRNS
Microcebus murinus V406 iglv ABDC03024733.1 3613 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGTYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGFRSGNTASLTISGLQPEDEADYYCSTRDRSLSA
Microcebus murinus V407 iglv ABDC03024734.1 3035 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGYDAHWYQQLPGTAPKLLIYDNSKRPSGVPARFSGSKSGSSASLAIAGLQAEDEADYYCSAWDSSLS
Microcebus murinus V408 iglv ABDC03024736.1 1546 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGGGYVVHWYQQLPGTAPKLLIYGGSGRPSGVPARFSGSKSGSSASLTIAGLQAKDEADYYCQSYDSSLRA
Microcebus murinus V409 iglv ABDC03024736.1 10385 SLSQPVVTQPPSLSASPGASARLTCTLRSDISVGGKDMYWYQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V410 iglv ABDC03024736.1 15309 SLANLVLTQPSSVSGSPGQKVTISCTRSSGDIGDAYVTWYQQRPGSAPTTVIIGDDQRPSRVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYGIRNS
Microcebus murinus V411 iglv ABDC03024736.1 18684 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEEEADYYCSTWDRTLS
Microcebus murinus V412 iglv ABDC03024738.1 7461 SLANLVLTQPSSVSGSPGQKVTISCTRSSGSIGDYYVHWYQQRPGSAPTTVIYGDDKRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDDSN
Microcebus murinus V413 iglv ABDC03024738.1 22918 SWAQSALTQPPSVSGAPGQSVTISCSNIKGSYANWYQQLPGTAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLRA
Microcebus murinus V414 iglv ABDC03024738.1 26912 CANPAPSLSASPGASARLTCTLSSGFSVGSYGIFWHQQKPGSPPRYLLYYHTDSDKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCMT
Microcebus murinus V415 iglv ABDC03024738.1 43444 SLANIVLTQPSSVSGSPGQKVTLSCTRSSGDIGSRYVNWYQQRPGSAPSTVIYADDERPSGVPDRFSGSIDSSSNSASLTISALQSEDEADYYCQSYDDSY
Microcebus murinus V416 iglv ABDC03024738.1 50703 SLSQPVLTQPPSLSASLGASAGLTCTLSSGTVVGGYHISWYQQKPGGPPRYLLRYYSDSDKHQGSGVPSHFSGSKDASANAGILHVSRLQPEDEADYYCM
Microcebus murinus V417 iglv ABDC03024738.1 64456 CADPAPSLSASPGASARLTCTLSSGFSVDSYAIAWHQQKLGSPPRYLLTYHTDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCMTGDGSSKS
Microcebus murinus V418 iglv ABDC03024740.1 9403 AVSPYELTQPPSVSVTPGQTARIPCSGDKLGERYVHWYQQKPGQAPVLVIYGDSNRPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCQVWDSSSDH
Microcebus murinus V419 iglv ABDC03024745.1 4092 SVASQVTQVPAVSVALGQTARITCQGDSLSSYYPGWYQQKPSQAPVLVVYGNNERPSGIPERFSGSKSGNTATLTISGAQVEDEADYYCGSYAGS
Microcebus murinus V420 iglv ABDC03024746.1 625 SVASQLTQVPAVSVALGQTASITCQGDGIRSYYANWYQQKPGQAPVLVMYVDNNRPSGIPERFSGSKSGNTATLTISRAQADDEADYHCQSFDSSGTL
Microcebus murinus V421 iglv ABDC03024747.1 7161 AVSPYELTQPPSVSVTPGQTARIPCSGDKLGEKYVYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCHVWDSSSDH
Microcebus murinus V422 iglv ABDC03024748.1 884 SVAFQLTQVPAVSVALGQTASITCQGEGLSSYYVNWYQQKPGQAPVLIIYTDIFSNSNRPSGIPERFSSSVSGDTATLTISGAQAQDEADYYCQVWVSENNK
Microcebus murinus V423 iglv ABDC03024749.1 13291 AVSPYELTQPPSVSVTPGQTARIPCSGDKLGERYVHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGNTAALTISGAQAGDEADYYCQCGTAVVII
Microcebus murinus V424 iglv ABDC03024749.1 19543 SVASQLTQVPAVSVALGQTARITCQGDSLSSYYPNWYQQKPGQAPVLLIYGENQRPSGIPERFSSSVSGDTATLTISGAQAGDEADYYCQVWDSENNK
Microcebus murinus V497 ighv ABDC03038307.1 10 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDHHMHWVRQAPGKGLEWVGLIRNKAYGGTAEYAASVKGRFTILRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V499 trav ABDC03039925.1 704 GTRAQTVTQPDLHVTVTEGASLELKCSYTASFTPTVWWYVQYPNQGLQLLLKYISGSTLVKGIQGFEAEFRKNETSFHLKKHSAHLSDSAQYFCAVR
Microcebus murinus V547 ighv ABDC03003576.1 503 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSRINTDGGSTYYADAVKGRFTISRENGKNTLYLQMNSLKAEDTAVYYCVR
Microcebus murinus V548 ighv ABDC03003580.1 16207 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYGMNWVRQAPGKGLEWVSYISWNGGSTYYADAVKGRFTISRDNSKNMLYLQMNSLRAQDTAVYYCAR
Microcebus murinus V549 ighv ABDC03003611.1 353 VQCDVQLLESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSTISNGGGNTYYADAVKGRFTISRDNGKSSLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V550 ighv ABDC03003624.1 839 AHSQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMHWVKRAPGQGLEWMGRINPEYGSTSYAKKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCAR
Microcebus murinus V551 ighv ABDC03003651.1 5523 VLSELTLQESGPGLVTPSQTLSLTCSVSGGSVTSSYYWNWIRQRPGRALEWMGYWSGGTSYNPAFQGRISIAADTSKNQFSLKLSSVTPDDTAMYYCAR
Microcebus murinus V552 ighv ABDC03003663.1 9726 AHSEVQLVQSGAQVKPPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMRLINPNNGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V553 ighv ABDC03003667.1 1812 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVGEINGDGGSTNYADAVKGRFTISRDNGKNTLYLQMNSMKAEDTAVYYCAR
Microcebus murinus V554 ighv ABDC03003670.1 3781 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRKAPGKGLEWVSYINGDGGYTIYADAVKGRFTISRDNSKNLLYLQMNNLKAEDTAMYYCAR
Microcebus murinus V556 ighv ABDC03003754.1 91500 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYYMHWVRQAPGKGLEWVSYIDYDGDSTSYTDSVRGRFTISRDNGKNMLYLQMNSVRAEDTAMYYCAR
Microcebus murinus V557 ighv ABDC03003754.1 72575 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVADINGDGGSTNYADAVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAT
Microcebus murinus V558 ighv ABDC03003754.1 64224 VQCEVQLVESGGGLVQPGGSLKLSCVASGFTFSDYYMHWVRQAPGKGLEWVAFIRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRTEDTAVYYCER
Microcebus murinus V559 ighv ABDC03003754.1 50083 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVSSIYSSSSTYYADAVKGRFTTSRDNGKNSLYLQMNSLRAEDTAVYYCAR
Microcebus murinus V560 ighv ABDC03003754.1 42059 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVAHIRYDGSKQYYADAVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAR
Microcebus murinus V561 ighv ABDC03003756.1 14454 IAGGVWGRLGPAWGYLKLSCAASGFTFSSYWMSWVRWVHQGRGWSGVSYINNDGDSTSYADAMRGRFTISRNNSKNSLHLQCNSVRAEDTAVYYCAR
Microcebus murinus V562 ighv ABDC03003756.1 6688 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWCDGSKQYYADAVKGRFTISRDNSKNMLYLQMNSLRTEDTALYYCAK
Microcebus murinus V563 ighv ABDC03003766.1 4706 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTVSSYDINWVCQVPGKGLEWVSRISGGGSTYYTDAMKGRFIISRDNGKNSLYLQMNSLRAEDVALYYCAS
Microcebus murinus V564 ighv ABDC03003767.1 70867 AHSEVQLVQSGAEVKPPGASVKVSCKASGYTFTNYAMHWVRQAPGQGLEWMGWIYTNTGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Microcebus murinus V565 ighv ABDC03003767.1 59551 VQCEVQLVESGGGLVQPGGSLRLSCAASGFSFDDYVMHWIRQAPGKGLEWISYIYSSSTSYADSVKGRFTISSDNGKNMLYLQMNSLRAEDTAMYYCAR
Microcebus murinus V566 ighv ABDC03003767.1 49408 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINGDGGNTNYADAMKGRFTISRDNSKNTLYLQMNSLRAKDTAVYYCGR
Microcebus murinus V567 ighv ABDC03003767.1 10764 VQCEVQLVESGGGLVQPGGSLRLSCEASGFTFSSYYMSWVRQAPGKALEWVSYITGDGSSTSYADAVKGRFTTPRDNSKNMLYLQMNNLRAEDTAIYYCAR
Microcebus murinus V568 ighv ABDC03003768.1 122778 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTLTSYGMNWVRQAPGKGLEWISYIYSSSTSYADSVKGRFTISTDNGKNSLYLQMNSLRAEDTAMYYCA
Microcebus murinus V569 ighv ABDC03003768.1 112109 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSSYYMYWVRQAPGKGLEWVGFVRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V571 ighv ABDC03003768.1 97123 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSNYYMYWVRQAPGKGLEWISTISNSGSSTGYADSVKGRFTTSRDNSKNMLYLQMNSLKAEDTALYYCAR
Microcebus murinus V572 ighv ABDC03003768.1 39251 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYAMSWVRQAPGKGLEWMAVLWSGGSTNYADAVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCAR
Microcebus murinus V573 ighv ABDC03003768.1 32710 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYDMHWVRQAPGKGLEWVSVIGIGGSTYYADAMKGRFTISRDNGKNMLYLQMSSVQAEDTAVYYCTR
Microcebus murinus V574 ighv ABDC03003768.1 24260 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSRINPDGGSTNYADAVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAR
Microcebus murinus V575 ighv ABDC03003769.1 17989 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISSGGSTYYTDVVKGRFTISRDNGKNSLYLQMNSLRAEDTAVYYCAR
Microcebus murinus V576 ighv ABDC03003769.1 8813 AHSQVQLVQSGAEVKPPGASVKVSCKASGYTFTSYYMHWVRQTPGQGLEWMGEINPNSGGTSYAQKFQGRVTMTRDTSTSTAYMELSSLRPDDTAVYYCA
Microcebus murinus V577 ighv ABDC03003770.1 8288 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDYYMNWVRQAPGKGLEWVGVIRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V578 ighv ABDC03003770.1 2199 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISNGGGSTYYTDAVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAR
Microcebus murinus V579 ighv ABDC03003771.1 2489 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAFIRTKAYGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V580 ighv ABDC03003773.1 327 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDYYMNWVRQAPGKGLEWVGVIRNKANGGTAEYAASVKGRFTISRDDSKSTAYLQMNSLRAEDTALYYCAR
Microcebus murinus V581 ighv ABDC03003780.1 10637 ALSQVQLVQSGAEMRSPGASVKVSCKASGYTFTSSYMHWVRQAPGQGLEWMGRVDPEDGSTRYSQKFQGRVTMTATTSTNTAFMELNSLRPEDTAVYYCA
Microcebus murinus V582 ighv ABDC03003788.1 6488 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYDMHWVRQAPGKGLEWVAVISYDGSNQYYADTVKGRFTISRDNSKNSLYLQMNSLKVEDTAMYYCAR
Microcebus murinus V583 ighv ABDC03003814.1 24605 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTLTSYGMNWVRQAPGKGLEWISYIYSSSTSYADSVKGRFTISTDNGKNTLYLQMNSLRAEDTAMYYCARHTVRG
Microcebus murinus V584 ighv ABDC03003814.1 13926 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVSRINPDGGSTIYADAVKGRFTISRDNSKNSLYLQMNSLKAEDTAVYYCA
Microcebus murinus V585 ighv ABDC03003814.1 7672 VLSELTLQESGPGLVTPSQTLSLICSVSGGSVTTSYYWHWIRQRPGRALEWMGYWIGSTSYNPAFQGRISITADTSKNQFSLQLSSLTAEDTAMYYCAR
Microcebus murinus V586 ighv ABDC03003817.1 38384 RDAAGGVWRRLSPAWGGSLRLSCAASGFTFSSYGMNWVCQAPGKGLEWVSYIYSSSSIYYADAVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCARDTVRG
Microcebus murinus V587 ighv ABDC03003817.1 29655 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSFAMSWVRQAPGKGLEWVSAISGNGGSTYYADAVKGRFTISRDNGKNSLYLQMNSLRVEDTAMYYCAR
Microcebus murinus V588 ighv ABDC03003819.1 9834 VQCNVQLVESGGGLVQPGGSLTLSCAASRFTFSSYAMSWFRQAPGKGMEWVALIRNDGSTYYADAVKSEFTISRDNAKNKLYLQMNSLRAEDTALYYCAR
Microcebus murinus V589 ighv ABDC03003823.1 30176 AHSQVQLVQSGAEVRPPGASVKVSCKASGYTFTSYYMHWVKQAPGQGLEWMGRVDPEDGSTSYAKKFQGRVTMTATTSTNTAFMELSNLRPEDTAVYYCAR
Microcebus murinus V590 ighv ABDC03003823.1 20944 VQCEVQLLESGGGLVLPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSYITTGGGSTYYADAVKGRFTISRDNSKNLLYLQMNSLKAEDTAMYYCAR
Microcebus murinus V591 ighv ABDC03003823.1 2357 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSTTYLQMNSLRAEDTALYYCAR
Microcebus murinus V597 trdv ABDC03004395.1 153634 VMPAIVLVPENQAVTVPAGGSTTLRCSMEGAPIDHYYINWYRKTQDNTLTFIYRESNIYGPGFQGGFQGGNDFDKKQAFLRILKASESDEGFYYCACD
Microcebus murinus V598 trav ABDC03004396.1 54429 SSVAQTVTQSQPEMSVQEAETVTLDCTYATSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Microcebus murinus V599 trav ABDC03004396.1 35558 LRGEVEVQQSPLSLSTQEGEDCTIYCNYSSSASDRLAWYRQDPGKSLEFLFVLLSNGAVKREGPLTASLDTKARLSTLHVGAPQPGLSATYFCAV
Microcebus murinus V600 trav ABDC03004397.1 19316 VSSEDKVVQSPPSMAVHEGDSATLTCNYVVSYFRSLQWCKQEKNAPVFLFTLTSSGIEKKSGRFSSILDNKELSTLNITATQTGDSAIYFCAVE
Microcebus murinus V601 trdv ABDC03004398.1 85044 STVAQKVTQVETARSTTVGAVVTLNCQYETSGGAYFFIFWYKQLPSKEMIFLLRQGSDLYNAKDDQRYSVNFQEEANSIDLTISALRLEDSAKYFCALAE
Microcebus murinus V602 trav ABDC03004398.1 77662 LNGQQVKQIPEFLHIQEGEDFSIYCNSTSTLTTAQWYKQRPGGSPVLLMILVKDGEVKEKRLTAQFVETRKGSSLHITAAQTADVGTYFCAVAQCSP
Microcebus murinus V603 trav ABDC03004398.1 67677 TIIAAETTQPDSMDCAEGEAVNLACNHSTISGNEYIHWYRQNPSQSPQYIIHGLKNAVTNDMASLTIAADRKSSTLTLPHVTLRDAGMYYCILR
Microcebus murinus V604 trav ABDC03004398.1 57755 RTGAQSVTQPDIHVTVSERDSLKLRCNYSTGGGASYLFWYVQYPGQSLQFLLKYVSGDTLVKGMKGFEAELRKNETSFHLKKHSAHLSDSAQYFCALS
Microcebus murinus V605 trdv ABDC03004398.1 24313 SSMSQQIIQPQLAISKQEGETVELECSYDTSVPYHILYWYKRPPSGEIIYLIHHRIDADTNATTQGRYSVSFQKATKTIRLIISSSQPEDSATYFCCLRQ
Microcebus murinus V606 trav ABDC03004398.1 14755 IMGDAKTTQPNSVECTEEEPVYLPCNHSTISGSEYVYWYRQILLQGPEYVIHGLKGNVTNSMATLAISADRKSSTLILPRVTLGDTAVYHCIVR
Microcebus murinus V607 trav ABDC03004398.1 6021 VSSQELEQSPRSLIIQEGEDLTINCNSSKTLYGIQWYRQKYGEGGLSFLMLLLKSVEEKSHEKITARLDEKKQQSSLHITASDPSHSGIYLCGAE
Microcebus murinus V608 trdv ABDC03004400.1 2019 STVAQKVTQAQSATTMTVGQAVTLNCRYKTSWTAYYIFWYKQLPSKEMIFLLSQDSDMQSEKSGPYSLNFRKEDKSIDLTISSLRLEDSAKYYCALQE
Microcebus murinus V609 trdv ABDC03004401.1 29449 STVAQKVTQAETSRSSTVGRAVTLNCQYEIGWSAYIIFWYKQLPSKEMIFLLRWSSGDGNTKNGRYSVSFQTQANSIDLTISALRPEDSAKYFCALWD
Microcebus murinus V610 trav ABDC03004401.1 14242 LNGQQVKQIPEFLHIQEGEDFSTYCNSTSTLNIVHWYKQRPGQSPVFLMLLVKGGEVKKEKRLTAQFGEARKGSSLHITAAQTADVGTYFCAV
Microcebus murinus V611 trdv ABDC03004401.1 6738 STVAQKVTQAETSRSSTVGRAVTLNCRYKTSWSAYYIFWYMQLPSKEMIFLLRQYSGERNANNGRYSVIFQKRANSIYLIISALRLEDSAKYFCALWD
Microcebus murinus V612 trav ABDC03004402.1 159097 GVRGLEVRQSPSVLSVQEGASPTLRCNFSATVTSMQWFLQKSGGSLISLFYMASGTKQNGRLNSTMNNKELYSTLHITATQLEDSGTYLCAAEE
Microcebus murinus V613 trav ABDC03004402.1 153512 VRGGENVGLHPPTLSVQEGDTSVINCSYSNSASIYFSWYKKELGKGPQFIIDIRSNRDKKEEQRFTIFVNKTVKHLSLHIAGTQPGDSAVYFCAES
Microcebus murinus V614 trdv ABDC03004402.1 144030 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTSTSVASYALLWYKQPSSGEMILLIHQDSYKEQNATDGRYALNFQKASKSIKLVISASQVGDSAIYFCALNQ
Microcebus murinus V615 trav ABDC03004402.1 125091 VRSQQKEVEQTPKSLSVSEGSTASLNCTYSNIASQYFFWYRQYSGKGPEVLMSIFSTGDKEEGRFIAQLNTASRYVSLLIRDSQPSDSATYLCAVS
Microcebus murinus V616 trav ABDC03004402.1 119829 GTWAQRVTQPDGHITVSEGDPLELRCNYSSSVSPYLFWYVQYPNQGLELLLKYTSGNSLVTGIKSFKAEFNKGETSFHLKKASAHLSDSAQYFCAVS
Microcebus murinus V617 trav ABDC03004402.1 111567 GTRAQTVTQPEECLSVFKGAPVQLKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISRDSVKGFTAVLNKGEATFHLEKTSVQEEDSAMYYCALS
Microcebus murinus V618 trav ABDC03004402.1 107568 VNSQQGEENLQALSIQEGENATINCSYTSNINNLQWYRQDAGRGPTLLILIRANKREERHGRLTATLNPSIKSSSLIITASCAADTATYFCATD
Microcebus murinus V619 trav ABDC03004402.1 103223 GTDGDSVTQTEGPVTLPEGEALTLNCTYQSNYAAFLFWYVQFQNKEPELLLKSSSETQETDGRGFQANNNKSDSSFHLKKPSVQLSDSAVYFCAMR
Microcebus murinus V620 trdv ABDC03004402.1 96414 PSMAQKVTQAQPEISVVEKESVTLDCVYETRHMTYYLFWYKQPPSGEMIFLIHHDSFNEKNETKDRYFLNFQKSINSISLTITASELTDSAAYFCALRE
Microcebus murinus V621 trav ABDC03004402.1 87476 RSNGDSVTQTEGTVTLSEGAPVTLNCTYQTTYSVAYLFWYVQYLNQSPQLLLKSSTENQKSENQGFQANLVKSDRSFHLEKASLRMSDSAVYYCALR
Microcebus murinus V622 trav ABDC03004402.1 85119 SSVSQKITQAPAAISMLERKAVTLDCVYEATAFSYYLFWYKQPSNGEMILLIDHESFNERNATKGRYSLTFQKSASSISLTITALQLGDSAMYFCALRE
Microcebus murinus V623 trav ABDC03004402.1 69598 VSSKQEVMQTPETLSVPEGESLALNCSFTDSAIYFLQWFRQDSGKGLTSLLLIQSNQREQTSGRFKASLDKSSRQSTLNIAASQPGDSATYLCAV
Microcebus murinus V624 trav ABDC03004402.1 61184 VRGMKVEQSPPALSLHEGASSMLWCNFSAASSTVQWFRQNPGGRLINLFYIPSGTKQIGRLTATTVAKERHSSLYISSSQTTDSAIYFCAVEP
Microcebus murinus V625 trav ABDC03004402.1 51737 KTESDRKQVKQSPESLIVHEGSISILKCTYENSAFDYFPWYRQFPGKAPALLIAIRSFDSEKEDGRFTAFLNKSAKHFSLHITPSQPGDSATYFCAA
Microcebus murinus V626 trdv ABDC03004402.1 44185 STVAQKVTQAQTATSMIMGWTVTLNCQYEASWTAFSIYWYKQLPSKEMIFLLRQVSGSDNAKNGRYSVNFQKEAKSIDLIISALRLEDSAKYFCALWD
Microcebus murinus V627 trdv ABDC03004402.1 36897 STVAQKVIQTQTATSMTVGQSVTLKCRYETSSITYYIFWYKQLSSKEIILILRQDSSRENAKNVRYSVNFRKAANSIDLTISALRLKDSAKYFCALWD
Microcebus murinus V628 trdv ABDC03004402.1 20886 STVAQKVTQAQPATSMTVGQAVILNCQYETSWPQYYIYWYKQIPSKEMIFLLRQGSTRPSEKSGRYSLNFEKEDKSINLTISALRLEDSAKYYCALQE
Microcebus murinus V629 trdv ABDC03004402.1 12509 STVAQKVTQAETARSTTVGRAVTLNCRYKISVTQYYIYWYKQLPSKEMIFLLGQYSGSPNVKDGRYSVNFWKNAKSINLTISALQLEDSAKYFCALWD
Microcebus murinus V630 trav ABDC03004403.1 105170 VTRGENVEQHPSTLHVQEGDTSVINCTYTDSASNYFPWYKQQLGKGPQLFINIRSNMDNKKEGRFTLLLSKTAKHFSLHIAATQPGDSAVYFCAAG
Microcebus murinus V631 trdv ABDC03004403.1 98350 SGMAQKVTQSQPAMWVQEKEAVTLDCAYDTSVSRFSLFWYKQPSSGELIFLIRQDSYNEQNATEGRYSLNFQKARKSIHLTISASQLEDSAMYFCALKD
Microcebus murinus V632 trav ABDC03004403.1 88148 RTHGDSVTQTEGQVTLSEKAFLHINCTYTSTRYPSLFWYVQYPGEGPQLLLKAATANDKGINKGFEATYKKETTSFHLEKASVHESDSAVYYCAMS
Microcebus murinus V633 trav ABDC03004403.1 79378 VSGQNQVEQSPQSLIVLEGENCTLQCNHTVSPFNNLRWYKQETGKGPVSLIIMTYSKNKESKGRYTATLDANTKQSSLHVTASQLSDSASYICVVS
Microcebus murinus V634 trav ABDC03004403.1 65722 VRSQQVVEQTPESLVVSEGTTASLSCTYSDTASQSFLWYRQYSGKGLELLMFIYSTGDKEEGRFTAQLNKASRNVSLLIRDSQPSDSATYLCAVS
Microcebus murinus V635 trav ABDC03004403.1 61901 GTRAQTVTQPDLHVTVTEGASLELKCSYTASFTPTVWWYVQYPNQGLQLLLKYISGSTLVKGIQGFEAEFRKNETSFHLKKHSAHLSDSAQYFCAVR
Microcebus murinus V636 trav ABDC03004403.1 49190 GVRGLDVQQSPSVLSVQEGASPTLRCNFSATVYNMQWFQQKPGGGLINLFFMSSGTKQNGRLNSTMNSKELYSTLHIMATQLEDSGTYLCAARE
Microcebus murinus V637 trav ABDC03004403.1 43376 VRGGENVGLHPPTLSVQEGDTSVINCSYSDSASSYLLWYKQKLGKSPQSIIDIRSNMGKKQKGRFTVFLSKTAKHLSLHIAATQPGDSAVYFCAES
Microcebus murinus V638 trav ABDC03004403.1 37562 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTSVSRFSLFWYKQPSSGEMIFLIRQDSYKQQNATEGRYSLNFQKANKSIKLVISALQLGDSAIYFCALSE
Microcebus murinus V639 trav ABDC03004403.1 30789 RTHGDSVTQTEGQVTLSEKAFLHINCTYTARGYPFLFWYVQYPGEGPQLLLKAATANDKGMNKGFEATYKKETTSFHLEKASVHESDSAVYYCAMS
Microcebus murinus V640 trav ABDC03004403.1 27444 VRSQQKEVDQTPEFLSVSEGAMASLNCTYSNTASQYFFWYRQYSGKGPELLVYIFSTGDKQEGRFTAQLNKASRYVSLLIRDSQPSDSATYLCAL
Microcebus murinus V641 trav ABDC03004403.1 17349 GVRGLDVQQSPSVLSVQEGASPTLRCNFSAAVRSMQWFLQKPGGSLISLFFMASGIKQNGRLNSTMNSKELYGILHITATELEDSGTYLCAAEE
Microcebus murinus V642 trav ABDC03004403.1 11178 VRGGENVGLHSPTLSVQEGDTSVINCSYSNSNSDYFPWYKQELGKGPQFIIDIRSNRDEKEDQRFTVLLNKTAKHLSLHIAGTQPGDSAVYFCAES
Microcebus murinus V643 trav ABDC03004403.1 3849 SGMAQKVTQSQPAMWVQEKEAVTLDCTYDTRDSTYYLFWYKQPSSGEMILLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQVGDSAIYFCALSE
Microcebus murinus V644 trav ABDC03004404.1 79848 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATSETIFWYQQFPNQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLSRAALSDSAVYYCILD
Microcebus murinus V645 trav ABDC03004404.1 69753 TLSLAKTTQPIAMESYEGQEVNIPCSHTDIATSENIFWYQQLPNQGPRFIIQGYKTNVTDEVASLFIPADRKLSTLRLPRAALSDSAVYYCILA
Microcebus murinus V646 trav ABDC03004404.1 59719 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATNEYIVWYQQFPNQGPRFIIQGFKTNVTNEVASLFIPADRKSSTLRLPRAALSDSAVYYCILD
Microcebus murinus V647 trav ABDC03004404.1 52344 GTRAQSVTQPDGHISVSEQDPLELRCNYSSSVPPYLFWYVQYPNQGLELLLKYTSGNSLVTGIKSFKAEFNKAETSFHLKKASAHLSDSAQYFCAVS
Microcebus murinus V648 trav ABDC03004404.1 42579 MSRGEKLEQSPFLSVQEGDSSVINCTYTETTSTYFYWYKQGPREGLQLIMTIFSYEDKKQERRLSVLLNKMEKHLSLHISDTQPADSAVYFCAVS
Microcebus murinus V649 trav ABDC03004404.1 35176 VHSQKIEQNPRALSIQEGETAAVTCNYTSYSPAFFQWYRQDPEKGLVFLLLIRENEGEKQEGRLKVTFDTKLKQSSFYIADSQPADSAAYLCAA
Microcebus murinus V650 trav ABDC03004404.1 28147 DAGAQSVTQPDGHVTVSEEYSLELRCNYSYGGAFYLFWYVQYPGQGLQLLLQYYSGNTLVKGIKGFEAEVRKDESSFTLRKPRVHWSDTAEYFCALS
Microcebus murinus V651 trav ABDC03004404.1 23624 GSHGDSVTQTEGQMLLTERDSLIVNCSYETSQYPSLFWYVQYPGEGPQLLLKAMKANDKGINKGFEATYNRETTSFHLQKASVHESDSAVYYCALS
Microcebus murinus V652 trav ABDC03004404.1 17920 DARAQSATQPDLSITVSEGASLELRCNYSYRGGSPYLFWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEVRKDESSFTLRKPRVHWSDTAEYFCALS
Microcebus murinus V653 trav ABDC03004404.1 3183 GVRGLDVQQSPSVLSVQEGASPTLRCNFSATVYSMQWFRQNPGGGLINLFFMTSGTKQNGRLNSTMNSKELYGTLHITATQLEDSGTYLCAVPD
Microcebus murinus V654 trav ABDC03004406.1 16773 GLRAQSVTQPEDQVTVGEGNPLTVKCTYSYSGSPYLFWYVQYPNQGLQFLLKYIRGDNLVKGSYGFEAELNKSQTSFHLKKASALGSDSALYFCAVS
Microcebus murinus V655 trav ABDC03004406.1 7110 SLSLAKTTQPIAMESYEGQEVNIPCSHTDIATDEYIFWYKQFTNQGPQFIIRGFKTNVTNEVASLFMPADRKSSTLSLPRAALSDSAVYYCILA
Microcebus murinus V656 trav ABDC03004409.1 40469 TAGQSIEQPSELTAVEGAFMQVDCTYRTSGFNGLSWYQQRDRGAPIFLSYSVLDGLEGRGRFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Microcebus murinus V667 igkv ABDC03005265.1 86751 IRCDIQMTQSPSSLAASPGETVTISCRASQGISNYLSWYQQKPGKPPKSLIYGASNLHSGVSSRFSGSGSGTDYSLTIRGLETDDAATYYCQQGHSY
Microcebus murinus V668 igkv ABDC03005265.1 72684 NGDIVLTQTPASLSAHPGETVSISCKASADVHGEMSWVRIKLGQRLEPLISHVTTLAPGVPARYSSRGSGTSYVFSISGLEPGDSGVYYCMHDYGWP
Microcebus murinus V669 igkv ABDC03005265.1 67601 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSDGNSYMCWYLQKPGQSLQPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Microcebus murinus V670 igkv ABDC03005265.1 58907 ACGDIVMTQSPGSLAASPGESVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSYP
Microcebus murinus V672 igkv ABDC03005265.1 19590 TRAETTLTQTPAFVSVAPGDKVTITCKASQDIDDDIHWYQQKPGASPKFIIKYTTTLVSGVPSRFSGSGYGTDFALTINNVESEDAAYYFCQQDDNLP
Microcebus murinus V673 igkv ABDC03005265.1 17012 TTGNTALIQFPEHLTASLGDSVSINCRAGQSISDYLSWYQQKPGQAPKLLIYDADNLYSGVSSRFTGLQSGTEFILTITNVKADDAATYYCQQD
Microcebus murinus V674 igkv ABDC03005266.1 16833 SSGDVVMTQTPLSLPVTPGELASISCRASESIQDSDGNTYLNWVLQKPGQPPKRLIYKVSNGDNGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQSTKI
Microcebus murinus V675 igkv ABDC03005266.1 4374 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLQWYLQKPGQSPQPLIYRVSNRFSGVPDRFSGSGAGTDFTLKISRVEAADVGVYYCMQGIQFP
Microcebus murinus V676 igkv ABDC03005297.1 1402 SSGDVVMTQTPLSLPVTPGEPASISCRASESILHSNGNTYLSWYLQKPGQPPKRLIYKISNRDTGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQGTKL
Microcebus murinus V677 igkv ABDC03005300.1 53495 CRGEIVLTQSPAFLSGTPGEKATLTCRASQSIGTNLHWYQQKPGQAPKLLVKYASQSVSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQGNTFP
Microcebus murinus V678 igkv ABDC03005300.1 40960 TRCDIQVTQSPSSVSASPGETVTISCRVSQDISNHLSWYQQKPGKPPKPLIYAASNSHSGVSSRFSGSGSGTDYSLTIRGLETDDAATYFCRQYKIS
Microcebus murinus V679 igkv ABDC03005300.1 36862 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGKTYLHWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQTIQLP
Microcebus murinus V680 igkv ABDC03005300.1 26226 SSGDVVMTQTPLSLPVTPGESASISCRASQSLLYSDGNTYLNWFLQKPGQPPKLLIYKISNRDSGVSDRFSGSGSGTDFTLKISKVEAEDVGVYYCNQGSYYP
Microcebus murinus V681 igkv ABDC03005300.1 13636 SRGEIVLTQSPAFLSGTPGEKATLTCRASQGISNYLHWYQQKPGQAPKLLVKYASQSVSSRFSGSGSGTDFTLIISSLKAEDAATYYCQQGYNYP
Microcebus murinus V682 igkv ABDC03005300.1 8407 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQSPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQFP
Microcebus murinus V683 igkv ABDC03005306.1 7503 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQYP
Microcebus murinus V684 igkv ABDC03005307.1 4508 SRGEIVLTQSPAFLSGTPGEKATLTCRASQSIGTSLHWYQQKPGQPPKLLVKYASQSVSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQNNYYP
Microcebus murinus V685 igkv ABDC03005309.1 33026 SSGDIVMTQTPLSLPVTPGEPASISCRASESLLDSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCAQATKLP
Microcebus murinus V686 igkv ABDC03005309.1 18973 SRGEIVLTQSPAFLSGTPGEKVTLTCRASQGISNYLHWYQQKPGQPPKLLVKYATQSMSSGFSGSGSGTDFTLTISSLKAEDAATYYCQQSNNFS
Microcebus murinus V687 igkv ABDC03005309.1 14112 SSGEIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGKTYLYWYLQKPGQSPQPLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAIQFP
Microcebus murinus V688 igkv ABDC03005309.1 6469 TRCDIQVTQSPSSMSVSPGDTVTISCRASQDISNRLSWYQQKPGKPPKPLIYVASNLHSGVSSRFSGSGSGTDYSLTIRSLETDDAATYFCRQYKNN
Microcebus murinus V689 igkv ABDC03005309.1 2323 SSGDVVMTQTPLSLSVTPGESASISCRASQSIQDSDGNTYLNWFLQKPGQPPRRLIHKVSNRDSGVSDGFSGSGSGTDFTLKISRVEAEDVGVYYCMQASYFP
Microcebus murinus V690 igkv ABDC03005310.1 11419 TRCDIQVTQSPSSVSASPGDTVTISCRASQDISNRLSWYQQKPGKPPKALIYVASNLHSGVSSRFSGSGSGTDYSLTIRGLETDDAGTYFCRQYKNN
Microcebus murinus V691 igkv ABDC03005310.1 7324 SSGDVVMTQTPVSLPVTPGEPASISCRSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQALQPP
Microcebus murinus V692 igkv ABDC03005312.1 26375 ARCDIQMTQSPSSLAASVGDTVTITCRASQGISKYLSWYQQKQGKSPKRLIYYASTLDSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCLQYASYP
Microcebus murinus V693 igkv ABDC03005312.1 21371 SSGDIVMTQTPLSLPVTPGESASISCRSSQSLLHSDGNTNLYWFLQKPGQSPQLLIYLGFTRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQTIQFP
Microcebus murinus V694 igkv ABDC03005312.1 15013 SSGDVVMTQTPLSLPVTPGEPASISCRASESLLHSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQSTKI
Microcebus murinus V695 igkv ABDC03005312.1 4231 SNGEIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGKTYLHWYLQKPGQSPQLLIYLVSTLFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDLQTP
Microcebus murinus V696 igkv ABDC03005313.1 2380 ARCDIQMTQSPSSLAASVGDTVTISCRASQGISSWLSWHQQKPGKPPKTLINKASNLESGVPSRFSGSGSGTDFTLTIKGLQPEDFATYYCQQYDSSP
Microcebus murinus V714 trav ABDC03007052.1 141902 AHAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSHLELEDEGVYICEF
Microcebus murinus V820 trbv ABDC03015146.1 982545 PMDTGVTQTPRHLVMGMTDKKSLECEQNLGHNAMYWYKQSAKKAPELMFLCRLQKLTDNLTVPSRFTPECRDSSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V821 trbv ABDC03015146.1 967557 PLDTAVFQTPKYLLTQTGNDVSLKCEQTLGYDTMYWYKQDSTKLLKIMFIYSNKEKILNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSY
Microcebus murinus V822 trbv ABDC03015146.1 963258 PMDTGVTQTPRHLVMGMTDKKSLKCQQNLGHSTMYWYKQSAKKPPELMFYCYYEALRENMSVPSRFLPECSDKSLLYLHLDALQPEDSATYLCASIE
Microcebus murinus V823 trbv ABDC03015146.1 951854 PLDTAVFQTPKYLLTQTGNNVSLKCGQTLGHDNMYWYKQDATKLLKIMFSYNNQELMVNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSD
Microcebus murinus V824 trbv ABDC03015146.1 948691 PMDTGVTQTPRHLVMGMTDKKSLECGQNLEHNAMYWYKQSAKKALEPLFIFNYKKLYENVTVPSRFTPEYQDNAHFYLHLDALQPEDSATYLCASSQ
Microcebus murinus V825 trbv ABDC03015146.1 941809 PAEAGVTQTPGHLITARGQQVTLKCSPVSGHPSVFWYKQALGEGPQFLIQYYEEKESDKGNFPARFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V826 trbv ABDC03015146.1 936679 SVTAGVTQTPRFQILKTGQNTTLTCTQDTNHEEMYWYRQDPGLGLRLIYYSVGVGITEKGQVYNGYNVSRSSTETFPLTLESATPSQTSGYFCASSE
Microcebus murinus V827 trbv ABDC03015146.1 931214 HAGAGVSQSPRHKVTERGQNVTLSCDPISGHNVLYWYRQTLGQGPQYLVYFQGREATDKSGLRSERISAERPEGSFSTLKIQLAEQGDSAVYLCASSL
Microcebus murinus V828 trbv ABDC03015146.1 923343 LAEAGVTQTPRHLITARGQQVTLKCFPVSGHNQVSWYQQALGQGLQFLIQYFEGEEREKGNFPARFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V829 trbv ABDC03015146.1 916965 HTDAGVYQNPRYKVTKTGKQVTLRCRQTNSQNCMYWYRQDLGHGLRLIYYSYRVQSTDKGEVSEGYNVSRSKLEDFPLFLESATRSQTSVYFCASSE
Microcebus murinus V830 trbv ABDC03015146.1 904448 HAGAGVSQSPRHKVTERGQNVTLSCDPISGHISLYWYRQTPEKGLEFLIYFQREEEGDKSGLRSDRFSAERPEGSFSTLKIHPAEQEDSATYLCASSL
Microcebus murinus V831 trbv ABDC03015146.1 896634 PAEAGVTQTPGHLIKARGQQVTLKCFPVSGHDQVSWYQQALGQGPQFLIQYYGGQELEKGNFPARFSGHQFRDYRSELNLSALELGDSALYLCASS
Microcebus murinus V832 trbv ABDC03015146.1 891847 SVTAGVTQTPRFQILKTGQNMTLMCTQDTNHDSMYWYRQDPGLGLRLIHYSVAAGTTARGDIPEGYNVSRSSTETFSLTMESATPSQTSAYFCASSE
Microcebus murinus V833 trbv ABDC03015146.1 887882 HAGAGVSQSPRHKVAEKGQNVTLRCDPISGHDFLYWYRHTLGQGPQFLIYFQDKGVAEQSKLIGERISAERPEGSFSTLKIRPAEQGDSAVYLCTSSL
Microcebus murinus V834 trbv ABDC03015146.1 879902 LAEAGVTQTPGHLIRARGQQMTLKCFPVSGHNRVYWYQQTPGQGLQFLIEYYNGEQGQKENISPRFSGHQFSDYRSELNLSALELGDSALYLCASS
Microcebus murinus V835 trbv ABDC03015146.1 875787 PGDAGVIQSPRHLIKGKQETAILKCYPLSGHDTVYWYQQAPGQGLQFLISYYEKEESQKGNIPPRFLGQQFADYHSELNLSSLELGDSALYLCASSL
Microcebus murinus V836 trbv ABDC03015146.1 872395 HTDAGITQNPRHKITEIGKQVTLSCHQNDNHFYMYWYRQDLGHGLRLIYYSVDAQSTDKEEVAEGYKVSRSNKEDFLLFLESATRSQTSVYFCASSE
Microcebus murinus V837 trbv ABDC03015146.1 868325 LTEEAGVTQSPRHKITEKRQSVAFWCDPISGHITLSWYRQTLGKGLEFLIQYQNEAVADDSGLAKDRFSAERPKGANFTLRIQQAELGDSATYLCASSP
Microcebus murinus V838 trbv ABDC03015146.1 864194 HTDAGVIQTPRHEVTEMGQAVTLKCEPISGHDTLLWYKQTLVQGLELLTYFRSQSQIDDAGMPKGRFSAEMPNASFSTLKIQPTELRDSAVYLCASSS
Microcebus murinus V839 trbv ABDC03015146.1 855522 HAAAGVTQFPSSEVVEKGQAVTLRCDPISGHEYLFWYRRTVGKEMEFLISFLKDNIQDESGMPKDRFSAKWTEGTSSTLKIQPAELEDSGVYFCASSL
Microcebus murinus V840 trbv ABDC03015146.1 849895 HVGAMVMQNPRYQVTRVGKTVTLSCSQNMNHDTMYWYQQKLSQAPKLLFYYYDTEFNNETDTSYNFQPSRPNTSFSSVDIRSPGLGDSAVYLCASSR
Microcebus murinus V841 trbv ABDC03015146.1 842599 SAGEDVTQTPGHLLKGKGQKVKMYCVPMKGHRYVHWYQQILEKEFKFLFSFQDRKVFEETKMVKQRFSAECPQNSAWSLEIQTAEPQDSAVYLCASSK
Microcebus murinus V843 trbv ABDC03015146.1 822597 SMDTEVTQSPRYLVKGKEQKTKMDCVPKKGHSYVYWYQKKLEEGLKFLVYLQDEDIIEKEEIINNRFSAQCPKNSPCILEIQSTESGDSALYFCASSQ
Microcebus murinus V844 trbv ABDC03015146.1 816646 SYDAKVTQTPGHLIKEKGQKASMDCTPQQGHNSLYWYQQSQNKELEFLVYFENKELFDQTEMHKKRFSSKCPPDSPCRLEILSSEPGDSALYFCASSP
Microcebus murinus V845 trbv ABDC03015146.1 811915 STDAGVTQTPRNRIANSGQSILLECSQTQDHDRMYWYRRDPGLGLRLIYYSLGVNSTDKGEVSKGYSVSRKEQAKFSLSLETAFPNQTALYFCASSY
Microcebus murinus V846 trbv ABDC03015146.1 781192 LVDAEVTQTPGHLIKRTGEKVLLECSQDMDHERMFWYRQDPGLGLRLIYFSFDVGSEEKGDVWEAYSASRKQKDRFPLVLESAGTNQTSVYLCASR
Microcebus murinus V847 trbv ABDC03015146.1 773721 SVLAVLVSQTPSRVICKHGTSVTIQCRVDSQVTLMLWYRQLPGQNLMLMATANEGSEATYESGFTKDKFPISRPTLTFSNMTVSNVSPEDSSLYFCSAG
Microcebus murinus V848 trbv ABDC03015147.1 23215 PVDTGITQTPKYLVAVVGSKRSLTCEQHLGHNSMYWYRQDAEKSPKLMFFYNYKELIENGTVPIRFTPDYPDSSHLYLHVDALEPHDTAMYLCASSK
Microcebus murinus V849 trbv ABDC03015147.1 21350 HTEPGVIQTPSHQVTKKGQEVILRCDPISGHLYFYWYRQISGQKLEFLVSFYNDNISEKSELFTDQFSLKRPKGSYLALKIQSTELEDSAMYFCASSK
Microcebus murinus V850 trbv ABDC03015147.1 15762 PLDTAVFQTPKYLLTQMGNNVALKCGQTLGHDYMYWYKQDSTKLLKIMFTYNNQELMLNETASNRFSPESPDKAHLNLHINSPEPGDSAVYFCASSD
Microcebus murinus V851 trbv ABDC03015147.1 12925 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V852 trbv ABDC03015147.1 895 PLDTAVFQTPKYLLTQTGNDVSLKCEQTLGHNSMYWYKQDSTKLLKIMFSYNNQEKILNETASNRFSPESPDKAHLNLHINSPEPGDSAVYLCASSD
Microcebus murinus V866 trgv ABDC03015733.1 182134 SQISCNLEGRTMVIIKKTGSSIIIPCDIPESTNYIHWYLLQEGKALRRLLYYDLFQFRLTVESGFSSEKYFAYASTGKNSRFVLQYLEASDSGVYYCAT
Microcebus murinus V867 trgv ABDC03015733.1 171395 HLEQPQLSSTKALSKTARLECVVSEGTVSASSIYWYQERPGEVIQLLAYVLSNDTVRTAPGIAPNKFEVDKIPEASTCTLTIHNVEKQDSATYYCASWE
Microcebus murinus V868 trgv ABDC03015733.1 159284 GLGLSEVEQSHKSISTEVTKNINIHCKISSTHFETEVVHWYQQKPNQVLKHLIQVTSTKSSVQVSSEGRKDKVVAKKYPQNSTSVLTINSVQKEDTAIYYCAGW
Microcebus murinus V869 trgv ABDC03015733.1 151711 GLGNLEQPKISVSAATAKSAHIPCKVALPNFNSQVIHWYRQKPNQGLEHLKYVLSVTSSQDRKSSKIEASKDSQTSTSTLTINFLEKEDEGVYYCAYW
Microcebus murinus V870 trgv ABDC03015734.1 1253 SQVSCNLEGRIKSIFRKTGSTVEISCDIKEGARYIHWYFFPEHMVPRRLLYYDTSSSSKYLDSETKADKYDGSKITDKSFKLHLKHLEASDSGVYYCAVWV
Microcebus murinus V1024 iglv ABDC03024718.1 4251 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGGYYAHWYQQLPGTAPKLLIYRNSGRPSGVPARFSGSKSGSSASLTIVGLQAEDEADYYCQSYDSSLN
Microcebus murinus V1025 iglv ABDC03024720.1 23280 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTWPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTGDKSLS
Microcebus murinus V1026 iglv ABDC03024721.1 17506 SWAQSALTQPPSVSGAPGQSVTISCLGSSSNIGAGYAVHWYQQLPGTAPKLLIYDNSNRPSGVPARFSGSKSGSSASLTIAGLQAEDEADYYCQSYDSSLDA
Microcebus murinus V1027 iglv ABDC03024721.1 11612 SLSQPVVTQPPSLSASPGASARLTCTLSSGFSVGSYAISWHQQKPGSPPRYLLYYHTDSNKHQGSGVPSRFSGSKDASANAGILHVSGLQPEDEADYYCAV
Microcebus murinus V1028 iglv ABDC03024721.1 6672 SLANFVLTQPSSVSGSPGQKVTISCTRSSGNIGSNYVHWYQQRPGSAPTTVIYRDDKRPSGVPDRFSGSSDSSSNSASLTISGLQSEDEADYYCQSYDASA
Microcebus murinus V1029 iglv ABDC03024724.1 6360 SWAQSALTQPPSASGAPGQSVTISCSGSSSNIGGNYANWYQQLPGTAPKLLIYGNSDRPSGVPARFSGSKSGSSASLTIAGLQAEDEGDYYCSSWDDSLS
Microcebus murinus V1030 iglv ABDC03024725.1 26413 SLSQPVLTQPPSASASPGASAKLTCTLSSGYSNYGIAWHQQHPEKSPRYLMYVYSDGSQSKGDGIPDRFSGSSSGADRYLTISNVQPEDEADYYCQTWDGGV
Microcebus murinus V1031 iglv ABDC03024725.1 20138 SWAQSALTQPPSVSGAPGQSVTISCSGSSSNIGGGYAVHWYQQLPGTAPKLLIYGNSDRPSGVPARFSGSKSGSSASLTIAGLQAEEEADYYCQSYDGSLDA
Microcebus murinus V1032 iglv ABDC03024725.1 13811 SLANFVLTQPSSVSGSPGQKVTVSCTRSSGNIGSNYVYWYQQRPGSAPTTVIYRDDQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDGSA
Microcebus murinus V1033 iglv ABDC03024725.1 10193 SWAQSGLTQEASVSGSVGHKVTLSCAGNSNNVGSYGVGWYQQVPRGAPKTVMLGTTRPSGIPDRFSGSRSGNTASLTISGLQPEDEADYYCSTRDGSLS
Microcebus murinus V1034 iglv ABDC03024726.1 5017 SLPQPVLTQPPSASASPGASAKLTCTLSSAHGGYGIAWHQQQPGKAPRYLMWLKSDGSHSKGDGVPDRFSGSSSAADRYLTISNVQPEDEADYYCQTWETGV
Microcebus murinus V1110 igkv ABDC03041636.1 592 SSGDVVMTQTPLSLPVTPGETASISCRASESIQHSDGNTYLSWFLQKPGQPPRLLIYKISNRDTGVSDRFSGSGSGTDFTLTISRVEAEDVGVYYCTQVSFVP
Microcebus murinus V1112 trbv ABDC03045655.1 315 PMDTGVTQTPRHLVMGMTDKKSLECEQNLGHNAMYWYKQSAKKAPELMFLCRLQKLTDNLTVPSRFTPECRDSSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1113 trbv ABDC03045809.1 315 PMDTGVTQTPRHLVMGMTDKKSLECEQNLGHNAMYWYKQSAKKAPELMFLCRLQKLTDNLTVPSRFTPECRDSSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1114 trbv ABDC03047444.1 315 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1115 trbv ABDC03047592.1 315 PTDTGVTQTPRHLVMGMTDKKSLKCHQNLGHNAMYWYKLSAKKPPELMFYYYYQALRENMTVPSRFSPECPDNSHLYLHLDALQPEDSATYLCASSQ
Microcebus murinus V1116 trav ABDC03047826.1 1988 TPNLAKTTQPITMESYEGQEVNIPCSHTDIATNEYIFWYKQFTNQGPRFIIRGFKTNVTNEVASLFMPADRKSSTLRLPQAALSDSAVYYCILA