WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pundamilia nyererei AFNX00000000.1 (AFNX01) 195 111 12 9 9 48 3 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pundamilia nyererei V28 igkv AFNX01021938.1 2735 CSGQVTVTQPPAVTFTPGSTVTLTCRTNQAVGGCGAGQCMFWYQQKSGQTPKLLIRHVSIRHSGTPTRFSGSGSSSDFSMTISGVQAEDAAVYYCKSVHSGPV
Pundamilia nyererei V27 igkv AFNX01062424.1 1567 SSGQVTVTQPPVVTSTPGTTVTLTCRTSQAVHRWSDGDDAMFWYQQKSGQTPKLLIRYAKKVESETPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSQHNINSAWV
Pundamilia nyererei V26 iglv AFNX01062060.1 1503 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTGSAARWYKQIPGGVPQFVLRFYHSSSSPTYGSGFSAPKFTSTHQSRSDYRLIINNVEEGDSAVYYCQTWDSSAAV
Pundamilia nyererei V25 trav AFNX01060546.1 1484 CKGEDKVIQEQGDVIAAEGDTVTLGCTFETSASYSYLFWYKQELNDFPKYVLQRGTTGTADNAQEFPKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALR
Pundamilia nyererei V24 ighv AFNX01060168.1 1380 VDSIDHIQPSSLVVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFFIWYSGGTYQNDALKNKFSISRDTSAQTVTITGQHLQREDTAVYYC
Pundamilia nyererei V23 igkv AFNX01058809.1 14908 SRGQITVTQPGAVSSAVGTTVSIKCKVSEDVYGSSLLAWYQQKDGGVPKLLIYDADTLESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Pundamilia nyererei V22 igkv AFNX01058476.1 3663 CSGQVTVTQPPVVTFTPGNTVTLTCRTSQAVYRWSDGDEGMYWYQQKSGQTTKLLIRYAKKLQSGTPSRFSGSGSSSDFSMTISGVQTEDAAVYYCQSFHEINSAYV
Pundamilia nyererei V21 igkv AFNX01058476.1 265 SDASSSVTQSPVFKAAALGETVSLSCTASEGVDDDLSWYLQKPGQPPKLLFYKISRSESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGEYRGPV
Pundamilia nyererei V20 ighv AFNX01057957.1 226 VDSQTLTESEPAVKRPGDSHRLTCTASGFTFSSYHMGWVRQAPGKGLEWIAYIYTDSSGIFYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V19 igkv AFNX01055429.1 1301 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTSYAAAWHKQIPGGSPQHVLRMYHSWSSPYYGSGFSAPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCQTWDGSATSGV
Pundamilia nyererei V18 iglv AFNX01055427.1 6627 VSGVTVLTQKPVLSVSKGEAVTMDCNLGTVTNSEARWYKQIPGGVPQYVLKMYHSWSSPTYGSGFSPPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCKTWDSSVNEFV
Pundamilia nyererei V17 iglv AFNX01055426.1 1845 VSGVTVVTQKPVLSVRKGETATMDCNLGTVDNTVFWYKQIPGGVPQHVLRFYHSWGSPNYGSGFSAPKFTSTHQSTKDYRLIIKNVEEGDSAVYYCKTWDNNNAV
Pundamilia nyererei V16 trbv AFNX01037229.1 579 STLSDQVHQNPADMYKNLEETAEITCSHSIDTYNQILWYKQTKSGQLQLLGYMFATSPSVEPGVTVTISGNANKDQTCTLTIKDVFMNSSAVYFCAAR
Pundamilia nyererei V15 trbv AFNX01037228.1 682 SSLSDQVYQNPADMYKEQGQRADITCSHSIDNYDRILWYKQIKGHLQYLGYIVGNLGRPETGANVTIIGNANKDQTCTLTIKDLTLNSSAVYFCAAR
Pundamilia nyererei V14 trbv AFNX01037223.1 1113 ASDTKSLSQTPPSIIRRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFSDSAVYFCAAKRHSAA
Pundamilia nyererei V13 trbv AFNX01037222.1 95 LTDGGEVKQTSILWKNQGDNVSIECSHTYGSSYYYMYWYRQLPGELMKQMVFTTPNSQPDFEPDFRDEKFSAIKTDAHSGTLIVKNLVPGDQGLYFCAVSMHSDT
Pundamilia nyererei V12 trbv AFNX01037221.1 909 ASDTKRANQTPPSIIKRIGESVESEIKCSHSIPGYQVILWYKQDEKGVLQFLGYLNLEFPNIEDDVKGKISFDGDGKKYSNLAISNVSVTDSAVYFCAAS
Pundamilia nyererei V11 iglv AFNX01035159.1 9548 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVNNYVYWYKQIPGGVPQYVLRFYHSWGSPSYGSGFSSPKFTSTHQSTKDYRLIINNVEEGDSAVYYCKTWDSNNAV
Pundamilia nyererei V10 iglv AFNX01035159.1 5895 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTDYVYWYKQIPGGVPQFVLYFRYDSSSPSYGSGFSAPKFTSTHQSKTDYRLIISNVEEGDSAVYYCKTWDGSVREYV
Pundamilia nyererei V9 iglv AFNX01035157.1 1009 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTGSAARWYKQIPGGVPQFVLWFRYDSSSPTYGSGFSFPKFTSTHQSSSDYRLIIKNVEEGDSAVYYCKTWDNSVNEYV
Pundamilia nyererei V8 iglv AFNX01035156.1 2335 VSGVTVLTQKPVLSVRKGDTATMDCNLGTVIDAARWYKQIPGGVPQYVLYFYYSNSGPTYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCQTWDSSVSEYV
Pundamilia nyererei V7 iglv AFNX01035154.1 3386 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTNNVAAWHKQISGGAPQFVLSMYHGWSSPTYGSGFSSPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCQTWDSSANSGV
Pundamilia nyererei V6 iglv AFNX01035153.1 921 VSGVTVVTQKPVVSVRKGQTATMDCNLGTVTDSAARWYKQIPGGVPQYVLRFRHDWSSPTYGSGFSSPKFTSTHQSTSDYRLIISNVEEGDSAVYYCQTW
Pundamilia nyererei V5 iglv AFNX01035152.1 469 VSGVTVVTQKPVVSVRKGETATMDCNLGTVTDQSARWYKQTPGGVPQFVLRFYHSNRSPTYGSGFSSPKFTSTHQSSSDYRLIINNVEEGDSAVYYCKTWDSSVKEY
Pundamilia nyererei V4 trbv AFNX01035150.1 25833 IVLTQTPAVHTVSPGQEVVLNCNIERDDGNYVRWYKQVPGTVPQYVLSFHYSDSSPSFGTGFSSDRFNSKSSSDIDYQFIIKRAETGDSAVYYCQTRDDSAS
Pundamilia nyererei V3 trav AFNX01035150.1 24180 VSGVTVLTQKPILSVRKGQTATMDCNLGTVTGSAARWYKQTPGGVPQFVLKFHHSSSSPTYGSGFSAPKFTSTYQSTSDYHLIINNVEEGDSAVYYCQTWDSSVKEYA
Pundamilia nyererei V2 iglv AFNX01035150.1 18488 VSGVTVLTQKPPVVSVRKGQTATMDCNLGTVDNYVCWYKQIPGGVPQYVLDFYHSDSSPTYGSGFSAPKFTSTHQSTTDYSLIINNVEEGDSAVYYCKTYDGSVDEFV
Pundamilia nyererei V1 igkv AFNX01034725.1 120 QITVTQPGAVSSAVGASVNMDCKISHTVINSDSVEWYQHKQGEPPKLLIYWSNRRASGISSRFTGSGSGKDFTLTISGVQAEDAAVYYCKG
Pundamilia nyererei V0 trbv AFNX01022343.1 605 SSSSDQVDQTPADIYTKGEDVKVYCSHSIQSYDEILWYKQSKKQLQYLGYMNIDKGYPETGVNVMIEGNANKGENCTLTIKDLKLSSSGVYFCAAR
Pundamilia nyererei V65 trbv AFNX01022075.1 6516 HSQDVIQYPEISWGFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAVS
Pundamilia nyererei V64 trbv AFNX01022075.1 8554 SSLSDQVFQTPADMYKNQEQTAEINCSHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPEPGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Pundamilia nyererei V63 trbv AFNX01022075.1 10344 VCLGIEVRQFPSGIITDVGSKVEILCSHEKTDYRVMLWYQQPPGETAMKLIGFLQYQVVTFDEDQYKNHFDINGNLGGNTAKNGSLIVKVTQKEHSAVYYCAARE
Pundamilia nyererei V62 trbv AFNX01022075.1 11714 SSLSDQVHQNPANMYKNPEETAEIACSHSIDTYNQILWYKQTKSGQLQLLGYMLGTSSSVEPGVTVTIGGNANKDQICTLIIKELFINSSAVYFCAARFHSAT
Pundamilia nyererei V61 trbv AFNX01022075.1 13705 VCLGVEVGQTPSEFITNVGSRVEIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFQAFTFDQDQYKDHFDFTGDLSGDTAKNGSLIVKVTQHEHSAVYYCAARY
Pundamilia nyererei V60 trbv AFNX01022072.1 59 QASAVIFQQSPPQIVDKNQEIQINCKHNDSSLLIMLWYQQRKENTSMTLIGSGYYQQSQSYEGEFEKQFTVARSSTVEGTLTIKNTDVSHSAVYFCAA
Pundamilia nyererei V59 trbv AFNX01022072.1 916 VSESVLITQWPHYISNPSNGLVKMHCYQNDTDYQYLYWYKQPRGKSFQLIVATVAGISQFEEGFKSGFQAEKNDKQWSLTITSIQEKDEAVYLCAAR
Pundamilia nyererei V58 trbv AFNX01022070.1 1006 FSFSVRIKQDPFINSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELITYSLGEKVWDTEAPFNKSKYSMSRPSLLRSSLQIHSVVAGDSAVYYCVSRR
Pundamilia nyererei V57 trbv AFNX01022068.1 16 LTDGSDVEQTPLLWEREGESATMWCNHTKDATYRYMYWFRQLPGETMTLIVFATTGKKDDEHDYGNFKKDKFSANKPVVESGTFTVKNLKPEDKGWYFCAVS
Pundamilia nyererei V56 trbv AFNX01022068.1 1127 LTDGSDVSQTPLLWKSEGQSATMTCNHTKTFDYSQMYWYQQLPGQKIKQIVFTAPKVQHTYESGFSEEKFPATKISYETGSLTVEKLVPGDSGVYFCAVS
Pundamilia nyererei V55 trbv AFNX01022068.1 2002 HVDGSDVTQTPILWKYQGDSATMSCNHTKGDLYFQMYWYRQLPGETMKLIVFTTRGKKDDDQDFGEFSKEKFSVTKPTADKGTFTVKNLQPNDKGLYFCAVS
Pundamilia nyererei V54 trbv AFNX01022068.1 2954 GADGSDVQQTLSLWDREGKSATMQCNHTKGSDYLWMYWFRQLPGETMTLIVFATTGKKDNEHDYGDFDTEKFSASKTVAETGTFTVNKLEPKDQGWYFCAVS
Pundamilia nyererei V53 trbv AFNX01022066.1 660 VPKSGVHQTPAALIKAPGEEIQIHCNHSNNKLDMIQWYKQSPGKNEMILLGYARFTFTAVEDAFENIYKVTGEGSKLSTFHIPKLRESVDSAMYFCAASA
Pundamilia nyererei V52 trdv AFNX01022066.1 1387 PSLCTRVQQVPSSILGSIHGETRISCNHSESTYNVILWYQKPRGDSALKLIGHLLYGNPTIEDGFQGSFKISGDGSVKSQLEVEKLKSEDSGSYYCAAS
Pundamilia nyererei V51 trbv AFNX01022066.1 2885 LTGGSDVSQTPLLWSTEGQSVTMNCSHTKGVAYRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEEKFPATKTNEQTGSLTVEKLVPGDSGVYFCSVS
Pundamilia nyererei V50 trbv AFNX01022066.1 5374 LTDGSDVEQTPTLWERDGESATMQCNHTKGFTYRYMYWFRQLTGETMTLIVFATTGKKDDEHDYGNFDKDKFSASKPVVESGTFTLKNLKPEDKGWYFCAVS
Pundamilia nyererei V49 trbv AFNX01022065.1 496 SSSSDQVNQTPANIYTTGEEVKIYCSHSIQSYEIILWYKQSEETLQLLGYLRYGTGYPEPGVNVTIDGSANVKENCTLTLKDLKVSSSGVYFCAAS
Pundamilia nyererei V48 trbv AFNX01022062.1 1578 SSSSNKVDQTPANIHTKEKEVKIHCSHHIQNYDTILWYKQSEKQLQLLGYLRYGTSTPETGVNVKIDGSAEKEENCTLTLKDLKVSSSGVYFCAAS
Pundamilia nyererei V47 trbv AFNX01022061.1 1676 ASSFSDQVHQTPTNIYTNEDQAKIYCSHSISGYYTILWYKQSEKQLQFLGYMLNDKGNPETGVNVMMDGDANEKKNCTLTIKDLKVSSSGVYFCAAS
Pundamilia nyererei V46 trbv AFNX01022060.1 532 GSSFSDQVHQTPSNIYTKEDAKIYCSHSISGYNRILWYKQSEEQLQFLGYMLYDKGNPEPGVNLTMDGGANQNENCTLTIKDLKVSSSGIYFCAA
Pundamilia nyererei V45 trbv AFNX01022060.1 1889 SSSSDQVDQTPANIHTKEKEVKIYCSHRIQDYNQILWYKQSEKELQLLGYLRYGTGTPEAGVNVKIDGGAEKEENCTLTIKDLKVSSSGVYFCAAS
Pundamilia nyererei V44 trbv AFNX01022060.1 3388 SSFSDQVDQTPANIYTKGEEAKINCSHSVQSFYQILWYQQSNKELQYLGYMYLGKSSVETGVNVTIDGGANKGENCTLTIKDLKLSSSGVYFCAAS
Pundamilia nyererei V43 trbv AFNX01022059.1 2761 SSDSDQVNQTPANIYTNGEEAKIHCSHSISSYNQILWYKQSEKQLLLLGYMYYDKSYPEPGVNVTIDGDARQRKNCILTIKEFELSSSAVYFCAAS
Pundamilia nyererei V42 trbv AFNX01022058.1 322 SSLRDQVHQSPANIYTKGEEAKIYCWHSIPSYDTILWYKKSEKQLHLLGYMYYDNSYPEPGVTITMDGDARQHKNCTLAIKYLKVSSSGVYFCAARYHSA
Pundamilia nyererei V41 trbv AFNX01022058.1 1926 SSDSDQVDQTPADIYAKGEEAKIHCSHSNPNFYTILWYKQSEKQLQLLGYTNYDKSYPEPGVNMTMDGDARQHKNCTLTIKYLKLSSSGVYFCAASYHSA
Pundamilia nyererei V40 trbv AFNX01022058.1 3807 SPASEQVDQNPANIYTKGEDAKIHCSHSIQRYETILWYKQSEKQLQLLGYMNYDKSNPEAGVNVTMDGGAEKDQNCILTIKDIKASGSGVYFCAAR
Pundamilia nyererei V38 trbv AFNX01022057.1 3896 GISLGVQVRQSPSAAIRNAGDDVQLICTHEKTDYRVMLWYQQSPGDTALKLIGYVDYSTIKYEGDFEKYCNITGDLSGNTAKKGSLFIAGLKESEHSAVYYCAAQY
Pundamilia nyererei V37 trbv AFNX01022057.1 6711 SSLNSQIYQTPAQLYISKETEEVKINCSHSIQGYDRILWYRQMNNRHLQFLGYVYGTVDNPEKGLDVKLKGDANKNKTCTLTIEKLGPNSSAVYFCA
Pundamilia nyererei V36 trbv AFNX01022057.1 8714 SSHIDKVQQTPAESFYTSEETVAKIKCVHHIQDYTRIFWYKQSKNNELQLLGYMNVDKEYPETGVNVTMTGRSTKGETCTLTIKGLNPNSSAVYFCVA
Pundamilia nyererei V35 trbv AFNX01022057.1 10089 SSYSDKVYQTPADIYTNGEDAKISCSHNISSYNQILWYKQSKKQLELLGYMVLTGGNPEAGVNVVMEGSASQGKNCTLTIKETKLSSSGVYFCAAS
Pundamilia nyererei V34 trbv AFNX01022057.1 12670 SSLSDQVDQDPADIYTRGEDAKIYCSHSIPSYNQILWYKQLETQLQFLGYMYLNNDNPETGVNVMMNGSARTGEKCTLTIKDIKPSSSGVYFCAAS
Pundamilia nyererei V33 trbv AFNX01022057.1 13999 SSSSDQVDQTPADIYTKGEDVKVYCSHSIQSYDEILWYKQSKKQLQYLGYMNIDKGYPETGVNVMIEGNANKGENCTLTIKDLKLSSSGVYFCAAR
Pundamilia nyererei V32 trdv AFNX01022056.1 1813 FSRGVKIDQLQIIFSREGTKNVTLDCKQDDSQYYYMYWYRQSSSGKLELVTFSPGQNSWNIEAPFEKIKYTMSRPSVLESTLQIHPVDPEDTALYYCASRI
Pundamilia nyererei V31 trav AFNX01022056.1 2999 LTVVVLQSEDQMSDPGRTVTLECKMGSGFSMSSYTMLWYRQNHHGAPVDYLLNEYDKTVGRLKSFIDASKNNFSLQITELHMNDSSTYYCAA
Pundamilia nyererei V30 trbv AFNX01022056.1 4513 QASSVTFQPSHPRIVNETSNVEITCSHDKNDFYLMLWYQQKENGLMSLIGYSYFGNAPVKEEQFDNRFVITRENIQTGALSISSLIVSDSAMYFCAA
Pundamilia nyererei V29 trbv AFNX01022055.1 1327 KVESVTFEQSSAQVVNKGTEELRINCSHDDSNLQVMLWYQHKQSDQAMSLIGYTVLMGEPNYESQFTDRFQIKRDNTVKGSLIIKNLNLSDSAVYFCAA
Pundamilia nyererei V103 ighv AFNX01047361.1 2521 VKCEQLTQSTAVTVQPGQPLTITCQVSYSLSDAWTHWIRQPAGKPLEWISRDTAVKDSLNNKFSAELDSSSNTVTLNGQNLQPEDTAVYYCAREP
Pundamilia nyererei V102 ighv AFNX01047360.1 890 VYSIDLIQADSMIVESGQSLTITCRVSGYSLTDSSYATSWIRQREGKQMDSIFTMWSGGSTANNDALKNKFSYSRDISAQTVTITGQNLQPEDTAVYYCARTLQ
Pundamilia nyererei V101 ighv AFNX01047360.1 890 VYSIDLIQADSMIVESGQSLTITCRVSGYSLTDSSYATSWIRQREGKQMDSIFTMWSGGSTANNDALKNKFSYSRDISAQTVTITGQNLQPEDTAVYYCARTLQ
Pundamilia nyererei V100 ighv AFNX01047360.1 4140 VYCIDLNQPESRVVQPGQSMTITCRVSGYSVTDGSYGTCWIRQREGKQMDWIFCIWYDGSSSKNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCAR
Pundamilia nyererei V99 ighv AFNX01047360.1 7432 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDSSYGTCWVRQRDGKQMDWINCMWYDGSTANNNALKNKFSVSRDTSARTVTIRGQNLQPEDTAVYYCAR
Pundamilia nyererei V98 ighv AFNX01047360.1 10118 VQQWDLDWRSSLETSQSGNTSSCNIEPLWIKLNLRTSVPCLGHIWSGGSTDNNNALKNKFSISRDTSAQTVTITGRNLQPEDTAVYYCA
Pundamilia nyererei V97 ighv AFNX01047358.1 1620 VYGIDLIQADSVIVQPGQSLTITCRVSGYSLTSSSYATNWIRQRDGKQMDWIFTMWSDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCAR
Pundamilia nyererei V96 ighv AFNX01047357.1 1159 ADCQTLTESEPAVKRPGESHRLTCTTSGFNFGGYSMHWIRQAPGKGLEWIAYIRYDSAYIYYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V95 ighv AFNX01047356.1 1224 VYSIDLIQPNSLVVQPGQTLTITCQVSGYSLTDSGYAAAWIRQGEGKSMEWIFQIWSDGSSNKNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARCY
Pundamilia nyererei V94 ighv AFNX01047356.1 2935 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSYGMNWVRQAPGKRLEWIAHIYTDGSRTFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Pundamilia nyererei V93 ighv AFNX01047356.1 5118 VDGQTLTESEPVVKRPGESHTLTCTASGFTFTDYYLVWVRQATGKGLEWLASHYNSANIYYSQSVRGRFTISRDNSKQQVYLQMNSLSTEDSAVYYCTRQ
Pundamilia nyererei V92 ighv AFNX01047355.1 1553 VDGQTLTQSEPVVKRPGESHTLTCTASGFTFSDYWMAWIRQAPGKALEWVASHYNSVNIHYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Pundamilia nyererei V91 ighv AFNX01047354.1 377 VVGQTLTQSEPAIKRPGESHRLTCTASGYNFGDRSLVWVRQAPGKGLEWIAYIYCGDGSTSYSQSVQGRFTISKDNSKQQVYLQMNSLKTEDSSVYYCAR
Pundamilia nyererei V90 ighv AFNX01047351.1 797 VYSIDLIQPDSRMVQPGQSLTVTCQVSGYSLTDDSYATGWIRQREGKAMDWIFYQWGTSGLRQNDALKDKFSYSRDTSARTATITGQNLQTEDTAVYYCV
Pundamilia nyererei V89 ighv AFNX01047351.1 7053 LGGQTLTESGPVVKRPGESHRLTCTASGFTLSSYAMDWIRQVPGKGLEWIAHIWGNGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V88 ighv AFNX01047351.1 10655 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSHWMHWIRQAPGKGLEWIAFIYTDSSGMFYSDSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V87 ighv AFNX01047351.1 12243 VDSQTLTESGPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAHIWGSGSNTYYSQSVQGRFIISRDNSRQQLYLQMNNLKTEDSAVYYCARD
Pundamilia nyererei V86 ighv AFNX01047349.1 1188 VYSIDLIQPDSRMVQPGQSLTVTCQVSGYSLTDDSYATGWIRQREGKAMDWIFHQWGTSGLRQNDALKDKFSYSRDTSARTATITGQNLQTEDTAVYYCVRY
Pundamilia nyererei V85 ighv AFNX01047349.1 2372 IYGQTLTESEPAVISPGDSHRLTCTASGLTFSNSWMSWIRQAPGKGLEWVATIRYDSGEIYHCQSVRGQFTISRDNNRQQLYLQMNSLKTEDSAVYYCAGA
Pundamilia nyererei V84 ighv AFNX01047349.1 3854 VWSDVKLDQSSSELKRTGETVKMSCIVSGYTMTSGYFSWIRQRAGKALEWIGRMNSGSNSASYSSSFQSRFLMTEDVPSSTQYLEIKSLTAEDSAVYFCARQ
Pundamilia nyererei V82 ighv AFNX01047348.1 4228 ACCQSLTSSEPVVSRPGQSVTLSCRVQGIALSWLHWIRQKPGKGLEWIGRIDDGTGTIFAQSLQGQFSITKDTSQKSVNLVVNSLKQEDSAVYYCARE
Pundamilia nyererei V81 ighv AFNX01047348.1 7122 VYSIDLIQPDSRSVQPGQSFSITCQVSGYSMTDNSYATGWIRQREGKAMDWISHQWGGGTLRQNGDLKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Pundamilia nyererei V80 ighv AFNX01047348.1 9331 VDSQTITQSESVVKRPADSHRLTCTGSNIYFSSNWMAWIRQAPGKRLEWVASIRYDSREIYHSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Pundamilia nyererei V79 trav AFNX01046643.1 5725 CKGEDKVIQEQGDAIAAEGDTVTLYCKYETTSAFPYLFWYKQDVNDYPKYVLRRDASGTENAQEFPKNRFDAELNKTSVSLKIQKLQLSDSAVYYCALQ
Pundamilia nyererei V78 trav AFNX01046641.1 385 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVYSLFWYHQKSGSHPQLVMADYSKQTEKLKFIHDKEKQEFHLELSSAAVSDSAVYYCALQ
Pundamilia nyererei V77 trbv AFNX01045725.1 617 LSSKTVHQSPAQMFKVAGKQVLINCNHSNSDFYMIQWYKQSTRRNEMTLIGFARYDSQGVEGPFQALYNVSGDGRSASSLHFLAHGSAIYFCAASE
Pundamilia nyererei V76 trbv AFNX01045724.1 1287 VIWTNDVTQTPTLLLKTGDSAQMYCHHNLHGSYYHMYWFQQLPGESLRLIVHMLPYKAPDFGNFSQEKYSANKIVSESGAFTVKHLEPSDSGVYLCAVS
Pundamilia nyererei V75 trav AFNX01045723.1 4769 CCVGIHQTPPALIKKPDDMVQLVCTHNLTEYRVMLWYQQPAGQTDMKCIGYINYQDVTVEETYKQNFEISGDLSTSDIKNVSLIIRLTGAQDSAVYYCAARF
Pundamilia nyererei V74 trbv AFNX01045722.1 1597 QANCVTFQQPQSRIVNVGERVEIQCSHDDDSLYVMLWYQQRDYGAMSLIGYSYDTNKPDYEPAFQNHIEILRETRVKGALSLPSVKLSHSAVYFCAASTQ
Pundamilia nyererei V73 trbv AFNX01045721.1 11245 FCCSVKIYQPPFTLSREGEKSVTLQCEQDNDEYLYMFWYKHADFRQMQLLTYSINKGIQTTEAPFNETKYFMSRPAVRNSSLHIKRVEPGDSAVYYCASRL
Pundamilia nyererei V72 igkv AFNX01043785.1 6394 SQMFQMFSSVHPESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGQKPKIISHFFKYNVNNSSNEELKNNPRFTLETQDGKYHLTIKDLQVSDSATYYCVYYL
Pundamilia nyererei V71 igkv AFNX01043785.1 19812 SQMFSSEHQESHFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIVSHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSATYYCVQYS
Pundamilia nyererei V70 trbv AFNX01022078.1 838 SSLSDRVHQDPADMYEIQGQTAEITCSHSIDSYNVILWYKQTKNNQLQLLGHVYSTNPSVEPGVTVTIAGNANKDQTCTLTIKDLFMNSSAVYFCAAR
Pundamilia nyererei V69 trbv AFNX01022076.1 226 SSLSDQVIQTPADMYKNHGQRAEINCSHKMTNYDRIFWYKQTENSQLQLLGYMLATRDVLEPGWMVEIKGSANKDQTCTLIIKDLTLNSSAVYFCAAR
Pundamilia nyererei V68 trav AFNX01022075.1 253 VFLGLEVRQSSSDIIANVSSKVQIFCIHDKTDYYVMLWYQRPPGETAMKLIGYLYHKQVTMEDQYKSNFIISGDLTGSTAKNSSLIANAAQQGDSAVYYCAASK
Pundamilia nyererei V67 trgv AFNX01022075.1 1360 VSLGIEVRQSSSDIVAKASDKVQIFCSHDKTDYRMMFWYQQSPGDTAMKLIGFLNYVAVTLEEQYRDLFSITGNLGGDSAKNGSLTIQVKGREHSAVYYCAASK
Pundamilia nyererei V141 ighv AFNX01047397.1 1609 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIGWVRQAPGKGLEWIATDGGSSYKYYSQSVQGRFTVSRDDSRQQLYLQMNSLKTEDSVVYYCA
Pundamilia nyererei V140 ighv AFNX01047396.1 2390 VNSETLTQPASMIVQPGEHLTINCQVSYSLGSYPTAWIRQPAGKALEWIGRARDGYSTYYKDSLKNKFSISLESSSKTVTLRGTNVQPEDTAVYYCARE
Pundamilia nyererei V139 ighv AFNX01047396.1 6014 VWSEIKLEQSPSEVKRPGERVKLSCIISGYTPTDYYLHWIRQRPGRALEWIGRMSTGSNSARYASSFQSRFIMTEEDSSSKQYLEINSLTAEDSAVYFCARE
Pundamilia nyererei V138 ighv AFNX01047392.1 1043 VNGQTLTESEPVVKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGPEWIAFISTSTYSYATSYSQSVQGRFTISREDSSSKVYLQMDSLKTEDTAVYYCARG
Pundamilia nyererei V137 ighv AFNX01047391.1 4359 VDGQTLTQSEPVVKNPGNSHRLTCATSGFTFSNYWMHWIRQAPGKGPEWIAIIRTSSYSYSASYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Pundamilia nyererei V136 ighv AFNX01047391.1 6426 VKCEQLTQPASETVQPGQRLTITCLVSYSVGSYYTAWIRQPAGKGLEWIGMARTGSTTYYKDSLKSKFSISTDSSNNRVTLTGQNMQPEDTAVYYCARE
Pundamilia nyererei V135 ighv AFNX01047391.1 10954 VEGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQATGKGPEWIAFISISTHSYATFYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Pundamilia nyererei V134 ighv AFNX01047391.1 17512 VEGQTLTQSEPDLIKRPGESHRLTCTVSGFTISSYAMVWVRQATGNGLEWIAYIGTLGYPTYYSQSVQGRFTISSDDSSSKLYLQMDSLKTEDTAVYYCARE
Pundamilia nyererei V133 ighv AFNX01047390.1 1317 VNGQTLTESEPAVKQPGQSHRLTCTTSGLSFSSYYMAWIRQAPGKGLEWIARISNGGSSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Pundamilia nyererei V132 ighv AFNX01047387.1 3975 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSHWIHWIRQAPGKGLEWIAADTSSSTNYYSQSVRGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V131 ighv AFNX01047387.1 5630 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFSSWWMAWIRQAPGKGLEWIATDANGGTNYYSQSVQGRFTVSRDNSREQLYLQMSSLKTEDSAVYYCA
Pundamilia nyererei V130 ighv AFNX01047387.1 9544 VKCEHLTQPGAVTVQPGQRLTIICQVSYSVSSYSTAWIRQSAGKNLEWIGQQCHGCTPAYKDSLKNKFSISTDSSSNTVTLNGQNVQPDDTAVYYCARY
Pundamilia nyererei V129 trdv AFNX01047386.1 310 VWCDIRLDQPPSEDKRPGETVKISCVTSGYTMTNNGINWIRQKPGKALEWMGWINTDTTVASYASAFQNRFTFTQDVPSSTQYLEIKSRRGTEDSAVYFCAR
Pundamilia nyererei V128 ighv AFNX01047382.1 4325 VDGQTLTQSEPVTKRPGESHRLTCAASGFTFSSYPMVWVRQAPGKGLEWVAYIGTLGYPTYYSLSVQGRFTISRTYLQMNSLKTEDTAVYYCVRE
Pundamilia nyererei V127 ighv AFNX01047382.1 6211 VDGQTLTESESVFTRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGLEWTAFIETSSNSYATSYSQSVQGRFTISREDSSSKLYLQMNSLKTEDTAVYYCARG
Pundamilia nyererei V126 ighv AFNX01047381.1 345 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGPEWISFIETSTYSYAKSYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Pundamilia nyererei V125 ighv AFNX01047379.1 251 VKCEQLTQPASLTLQPGQRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Pundamilia nyererei V124 ighv AFNX01047378.1 251 VKCEQLTQPASLTLQPGQRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Pundamilia nyererei V123 ighv AFNX01047373.1 800 VKCEQLNQPASMLVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKALEWMSQDTAVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARQ
Pundamilia nyererei V122 ighv AFNX01047372.1 3802 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Pundamilia nyererei V121 ighv AFNX01047372.1 9771 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSREQLYLQMNSLRTEDSAVYYCARE
Pundamilia nyererei V120 ighv AFNX01047371.1 2867 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKGLEWIAYIYWRDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Pundamilia nyererei V119 ighv AFNX01047371.1 5688 VDGQTLTESEQVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARE
Pundamilia nyererei V118 ighv AFNX01047371.1 6767 VYSIDLIQPDSRIVQPGQSLTITCRVSGYSVTSYATVWVRQREGNPLEWINLIWASGSTANNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARP
Pundamilia nyererei V117 ighv AFNX01047370.1 908 VNCQTLTESEPAVKQPGQSHRLTCTTSGFTLSSHWFSWVRQVPGKELEWIAADTGGSTNYYSQSVRGRFTASRDNSKQQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V116 ighv AFNX01047367.1 4572 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYDMVWIRQAPGKGLEWIAYISNGGSSIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARR
Pundamilia nyererei V114 ighv AFNX01047366.1 1856 VNGQTLTESEPVTKRPGDSHRLTCTVSGFTLGSYAMAWVRQAPGRALEWIAYIGTYSSPIRYSQSVQGRFIISRDDSSSKIYLQMNSLKTEDTAVYYCARR
Pundamilia nyererei V113 ighv AFNX01047366.1 7990 VWSEIKLEQSASEVKRPGERVKMLCTLSGYRLTSYNIHWIQQRPGRALEWIGYMSTGNNSPGYASSFQSRFIITEEDSSSRQYLEITSLTAEDSAVYFCARE
Pundamilia nyererei V112 ighv AFNX01047366.1 10189 VDGQTLTQSEPDLIKRPGESHRLTCTASEFTFRSSCMVWVRQATGKGPEWIAFIETSSFRYSTYYSQSVQGRFTMSRDDSSSKLYLQMNSLKTEDTAVYYCARE
Pundamilia nyererei V111 ighv AFNX01047366.1 11639 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSHLMGWVRQAPGKGLEWVATIDVTSKYYAQSVQGRFTISRDNNRQQVYLDMNTLKTEDSAVYYCA
Pundamilia nyererei V110 ighv AFNX01047366.1 18595 VFGQTLTESEPAVKQPGESHRLTCKASGFTFSSNWMAWVRQAPGKGPEWVSTVRNDGGNSYYAQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V109 ighv AFNX01047366.1 21477 ADSQTLTESEPVIKRLGESHRLTCTASGLTFNSSAMVWVRQAPGKGLEWIAFIETSSYSYSAFYSQSVQGRFTISRDDPSSKLYLQMNSLKTEDTAVYYCARK
Pundamilia nyererei V108 ighv AFNX01047366.1 26456 VWSEIKLEQSPSEVKRPGERVKMSCILSGYSPTSYNIGWIRQRPGRALEWIGYMSTGSNSADYASSFQSRFIITEEDSSRSQYLEIKSLTAEDSAVYFCARI
Pundamilia nyererei V107 ighv AFNX01047365.1 239 VKCEQLTQPASETVQPGQPLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGMAAAGSTTYYKDSLKSKFSISTDSSNNRVTLSGQNMQPEDTAVYYCARL
Pundamilia nyererei V106 ighv AFNX01047364.1 425 VKCEQLTQPASLTVRPGQRLTITCQVSYSVSSYWTHWIRQPAGKGLEWIGEERVGYTTYYKDSLKTKFSISTDSSSNTVTLTGQNVQPEDTAVYYCARE
Pundamilia nyererei V105 ighv AFNX01047364.1 4520 VDGQTLTQSEPVVKNPGNSHRLTCAASGFTFSNYWMHWIRQAPGKGPEWIAIIRTSSYSYSASYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCA
Pundamilia nyererei V179 trav AFNX01047410.1 6838 VEFEQLTQPASVIVQPGQRLTITCQVSYSLSGDWTGRIRQPAGKGLEWIGMKYTGDSRSKDSLKSKFSIDLDTSSNTVTLNQQNMQPEDTAVYHCAR
Pundamilia nyererei V178 ighv AFNX01047407.1 3651 TESQTLTESESVVKRPGDSHRLTCTYSGFSGDIHAAWIRQAAGKGPEWIAWIYYTGSEISYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V177 ighv AFNX01047407.1 5615 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGLLTGWIRQPAGKGLEWIGVKCTGGSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE
Pundamilia nyererei V176 ighv AFNX01047407.1 7510 VKCEQLTQPASVNVQPGQHLTITCQVSYSLSSDWTAWIRQPAGKGPEWIGVKSTGSSHYKDSLKSKFSIDLDTSSNTVTVNGQNIEPEDTAVYYCVRESQ
Pundamilia nyererei V175 ighv AFNX01047406.1 1554 TEGQTLTESESVIKRPGDSHRLTCTYSGFSSNYWNAWIRQAAGKGLEWVATISDSSTYIYYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARD
Pundamilia nyererei V174 ighv AFNX01047406.1 4406 QTLTESESVVKRPGDSHRLTCTYSGLGGDIAAAWVRQAAGKRQEWIALIYSDSITFNSQSFRGRFTISRDNSRKQVYLQMSTLTTEDSAVYYCAREPQ
Pundamilia nyererei V173 ighv AFNX01047406.1 5625 TEGQTLTESESVVKRPGDSHRLTCTYSGFGGDYNNAWIRQAAGKGLEWIAFVSSSSSYIYYSQSVRGRFTISRDNGRKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V172 ighv AFNX01047404.1 2309 VQCEQLTQKASETVQPGQRLTITCQVSYSVTGLWTAWIRQPAGKGLEWIGSRVGATLAYKDSLKNKFSISLDSSINTVTLTGQNLQPEDTAVYYCARD
Pundamilia nyererei V171 ighv AFNX01047404.1 3682 ACAQTLTESEPAIKRPGQSHTLTCTASGLTLSSNYMAWIRQPLGKGLEWIAWHDSCSGSRRFYSQSVQGRFTISRDDNRQLLLLQMNNLKTEDSAVYYCARE
Pundamilia nyererei V170 ighv AFNX01047404.1 6369 VKCEQLTQSASVTVQPGHRLTITCQVSYSLSSYWTGWIRQPAGEGLEWIGVKCTGSSYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCASV
Pundamilia nyererei V169 ighv AFNX01047404.1 8506 TEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Pundamilia nyererei V168 ighv AFNX01047404.1 10088 QTLTESEPVIKRAADSHRLTCTYSDFSVHEDNVWIRQAPGNGLEWIAYIIGGGSYIHYSQSVKGRFTISRDNSRQQVYLQMNSLNNEDSAVYYCA
Pundamilia nyererei V167 ighv AFNX01047404.1 11771 VQCEQLTQPAYVTKQPGQRLSITCRVSYSVGGYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNEQNMQPEDTAVYYCARD
Pundamilia nyererei V166 ighv AFNX01047404.1 13769 VDGQTLTESEPAVKRPGQSHRLTCTTSGFTFSSYAMDWVRQAPGKGLEWIAFISTSTYSYVTSYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCA
Pundamilia nyererei V165 ighv AFNX01047404.1 15353 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSSKYYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Pundamilia nyererei V164 ighv AFNX01047404.1 19116 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGGSTKYYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCTRD
Pundamilia nyererei V163 ighv AFNX01047404.1 20655 TEGQTLTESGPVVKRPGDSHRLTCTYSGFSGDIYAVWVRQAAGKGLEWIARISVDSNYISYSQSVRGRFTISRDNSRKQVYLQISSLTTEDSAVYYCARE
Pundamilia nyererei V162 ighv AFNX01047401.1 8767 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSGYWNAWIRQAAGKGLEWISAISDSSTYIYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARD
Pundamilia nyererei V161 ighv AFNX01047401.1 16871 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCSMHWIRQPAGKGLEWMGRVYSDASRTDYSSSLQGRIEVTRDNSNSMTYLRLSNLKPEDSAVYYCA
Pundamilia nyererei V160 ighv AFNX01047401.1 19979 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGYWTAWIRQPAGKGLEWIGMKDTGSSYYKDSLKSKFSIDLDTSSKTVTINGQNMQPEDTAVYYCARG
Pundamilia nyererei V159 ighv AFNX01047401.1 25047 TEGQTLTESESVIKQPGQSHRLTCTYSGFSGDIYAAWIRQAAGKGLEWIAYISSGSSSIFYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V158 ighv AFNX01047401.1 31057 TQGQTLTESESVVKRPGDSHRLTCTYSGFSYDIAAAWIRQAAGKGLEWISLIESGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V157 ighv AFNX01047401.1 33318 TEGQTLTESEPVVKRPGDSHRLTCTYSGFSSDIYANWIRQAAGKRPEWIVYIDPSSGTYYSQSVRGRFTISRDNSKKQVYLQMNSLTSEDSAVYYCAR
Pundamilia nyererei V156 ighv AFNX01047401.1 38045 SEGQTLTESESVIKRPGDSHRLTCTYSGFSGDYSNAWIRQAAGKGLEWIAWISSGSSSIYYSQSFRGRFTISRDNSRKQVYLQMNSLTIEDSAVYYCARE
Pundamilia nyererei V155 ighv AFNX01047401.1 39862 VKCEQLIQTASVTVQPGQRLTITCQVSYSLRSWRTAWIRQPAGKGLEWIGGAHYGHNTYYKDSLKNKFTINLDTSSKTVTLNGQNMQPEDTAVYYCARM
Pundamilia nyererei V154 ighv AFNX01047401.1 43215 LNGQALESIPSTSVLKKPQEAFSLSCRGSGFDFGQHGMHWIRQPAGKTLEWMGVIWYDASKTIYASSVQGRIEITRDNSNSMVHLSLSSLKPEDSAVYYCARK
Pundamilia nyererei V153 ighv AFNX01047401.1 44416 VKCEQLTQPASVTVHPGDRLTITCQTSYSLSSARTFWIRQPAGKELECIGSVHVGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Pundamilia nyererei V152 ighv AFNX01047401.1 50216 VDGQTLTESEPVIKRPGDSHRLTCTASGFTFSSYDMHWVRQTPGKVLEWVAEVSTGSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Pundamilia nyererei V151 trav AFNX01047401.1 51148 GVKCEQLTQPDFLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARDSQ
Pundamilia nyererei V150 ighv AFNX01047400.1 242 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYEMVWVRQAPGKALEWIAHLTQPTGSTKSYSQSVQGRFTISRDNDKQQVYLEMNSLKTEDSAVYYCARR
Pundamilia nyererei V148 ighv AFNX01047400.1 7018 VKCEQLSQPDTVTVQPGQSLTITCRVSYSVGNHHTAWIRQPEGKELEFIQSARVGYSTIYKDSLKNKFSINLDSSSNTVTLNGQNVQLEDTAVYYCARD
Pundamilia nyererei V147 ighv AFNX01047400.1 12029 TEGQTLTESESVVKRPGDSHTLTCTYSGFSSDIDAAWIRQAAGKGLEWIAYRSSGSSYIHYSQSVRGRFTITRDNSRKQVYLQMSSLTTEDSAVYYCARK
Pundamilia nyererei V146 ighv AFNX01047400.1 16054 VKCEQMTHPASVIVQPGQRLTITCQVSYSLGSWRTAWIGQPAGKGLEWIGMKYTGDSVYKDSLKNKFSIDLDTSSKAVTLNGQNMQPEDTAVYYCARESQ
Pundamilia nyererei V145 ighv AFNX01047400.1 20143 SEGQTLTESEPVVKRPGDSHTLTCTYSGFSGDYSNAWIRQAAGKGLEWVAMINSGSGCWYSQSFRGRFTISRDNSRKQVYLEMSSLTTEDSAVYYCARY
Pundamilia nyererei V144 ighv AFNX01047398.1 3480 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWMHWIRQAPGKGLEWIAADTSSSTNYYSQSVQGRFTVSRDNSRKQLYLQMNSLKTEDSAVYYCARD
Pundamilia nyererei V143 ighv AFNX01047398.1 8970 VDGQTLRESEPVIKRPGESHRLTCTASGFTFSSYRMVWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFIISRDDSSSKLFLQMNSLKTEDTAVYYCARC
Pundamilia nyererei V193 trgv AFNX01054389.1 9250 LVTMAAELIQKDLTLTATPGKKVSFSCGTSQCSGNYVHWYQKKDGDKFRVILHINIRTGEVNSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCSCAQS
Pundamilia nyererei V192 ighv AFNX01051354.1 2867 VTGQSLESVPSSPVVKRPGETLSLSCRGSGSEFTCCAMSWIRQQPGKGLEWIGISFTDTSRNRYVSSLIGRMGVSRNDSNYIVYLRLSNLRPEDSAVYYCARD
Pundamilia nyererei V191 ighv AFNX01051353.1 1304 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKGLEWVAYIEDDSSNIYYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Pundamilia nyererei V190 ighv AFNX01051353.1 3870 LNGQALESIPSTPVLKKPQEALSLSCRGTGFNFGQAGMHWIRHPAGKTLEWMGVIWFDASKTIYASSVQGRVEITRNNSNSMVYLRLSSLKPEDSAVYYCAALTSS
Pundamilia nyererei V189 ighv AFNX01051353.1 5174 VTGQSMESIPSSPVVKQPGETLSLSCRGSGFTFTCCTMNWVRQQPGKALEWIGIGFSSSSSNSYASSLRGRIEVSRDDSNSLTHLRLSNLKPEDSAVYYCA
Pundamilia nyererei V188 ighv AFNX01051351.1 3727 LNGQAMESIPSTPVLKNPHETLSLSCRGSGFNFGSYGMHWIRQPAGKGLEWFGTIWSDASRTEYIASVQGRIEITKDNSNSMTYLRLSNLKPEDSAVYYCAT
Pundamilia nyererei V187 ighv AFNX01051350.1 2064 TEGQTLTESESVIKRPGESHRLTCTYSGFSGDIYAAWVRQAAGKGLEWVAWIRDDSKEIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Pundamilia nyererei V186 ighv AFNX01051350.1 6200 TEGQTLTESESVIKRTGDSHRLTCTYSGLSSDIHAAWIRQAAGKGLEWIAVIWGDSSGSFYSQSVTGRFSISRDNSKKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V185 ighv AFNX01051350.1 7988 TEAQTLTESESVIKRPGESHRLTCTYSGFGWDIHAVWIRQAAGKGPEWVAWIQSDSSNIHYSQSFRGRFTISRDNSRKQLYLQMNSLTTEDSAVYYCAKE
Pundamilia nyererei V184 ighv AFNX01051349.1 788 TEGQTLTQSESVVKRLGDSHRLTCTYSGFSDNIHAAWIRQTAGKGLEWIAWIYYDGSDIHYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCATE
Pundamilia nyererei V183 ighv AFNX01051348.1 903 TESQTLTESESVIKRPGDSHRLTCTYSGFSGNYETAWIRQTAGKGLEWIAYISGGSSYIHYSQSFRGRFTISRDNSRKQVYLQMNSLTSEDSAVYYCAGE
Pundamilia nyererei V182 ighv AFNX01051346.1 523 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQQPGESLEWIGIGYSSSSRNRYVSSLSGRIEISRDDSNSMVHLSLSNLKPEDSAVYYCAK
Pundamilia nyererei V181 ighv AFNX01051343.1 790 VKCAQLTQPASVIVQPGQRLTITCQVSYSLSGDWTAWIRQPAGKGLEWIGMKYTGDSRYKDSLKSKFSIQLDTSSKTVTLNGQNMQPEDTAVYYCARG
Pundamilia nyererei V194 iglv AFNX01055438.1 1274 VSGVTVLTQKPPVLSVRKGETATVDCNLGTVTGSNARWYKQIPGEVPQFVLRFHHSWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Pundamilia nyererei V180 ighv AFNX01047410.1 333 TEGQTLTESESVIKRPGESHRLTCTYSGFSSDHWNAWIRQAAGKGLEWISAISDSSTYIYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Pundamilia nyererei V149 ighv AFNX01047400.1 3566 IDGQTLTESEPVVKRPGESHTLTCTASGFTFRDYQMAWVRQATGKGLEWIALLSSPSGSDKYYSQSVQGRFTISRDNDKQQVYLQMSSLATADSAVYYCAR
Pundamilia nyererei V142 ighv AFNX01047398.1 12758 VKCEQLTQSGPLTLQPGQRLTISCQVTYSISTYWTAWIRQPAGKGLEWVGGSGVGHSTLYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARK
Pundamilia nyererei V115 ighv AFNX01047367.1 6425 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSDYWMHWVRQAPGKGLEWVAGISETSGYIHYSQSVQGRFTISRDNSKQQVYLQMNRLKTEDSAVYYCARQ
Pundamilia nyererei V104 ighv AFNX01047362.1 3117 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIQQRPGRALEWIGRMSTGTNSALYGSSFQSRVIITEEDSSSRQYLEIKSLTAEDSAVYFCAR
Pundamilia nyererei V83 trgv AFNX01047348.1 2870 LHSCSQTLTESEPVIKKHPGDSHKLTCTYAGISDGDAAISWIRQAEGKGLQWVAYISAPGGSTKSYSTSAQNRFTISRDNNVDQVYLHMSSLTTEDSAIYYCART
Pundamilia nyererei V66 trbv AFNX01022075.1 2792 LCLGVEVHQTPVEVFRTRGDEVQLVCSHGKTDYTFMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLSGSKPKNASMFIVDLKPEHSAVYYCAASY
Pundamilia nyererei V39 trbv AFNX01022058.1 5215 SSLSDQVDQTPADIYTKGEEVKINCSHSISSYETILWYKQTEKQLQLLGYMLNDRGYPETGVNVIMDGDARQHKNCILTIKDIKVSSSGVYFCAAR