WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pteropus alecto ALWS00000000.1 (ALWS01) 49 3 14 3 12 8 4 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pteropus alecto V1 ighv ALWS01001265.1 2977 VHAQVQLVQSGAEVRKPGASVKISCKASGYTFTDYNMHWVRQAPGQGLEWMGDVNPNNGGTDYAQKFKGRVTITADKSTSTAYMELSSLRPEDTATYYCAR
Pteropus alecto V7 iglv ALWS01003970.1 1798 SWAQSVLTQPSSVSGALGQTVTISCTGSSSNIGGYYVGWYQQLPGTAPKTLIYGTSSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDSSLDI
Pteropus alecto V8 iglv ALWS01004940.1 14351 SWAEFVLTQPHSMSGSPGQKAIISCTRSSGSIGGYYVHWYQQRPGSAPNTVIYKDNERPSGVPDRFSGSIDSSSNSAYLTISGLQPEDEADYYCQSYDSNSN
Pteropus alecto V9 ighv ALWS01005253.1 1868 VQCEVQLVESGGDTVRPGGSLRLSCAASGFTFSSHWMNWVRQAPGKGPEWVGWIKNPADGLTAEYAGSVKGRFTISRDDSKNTLYLQMSSLRAEDTAVYYCVR
Pteropus alecto V44 iglv ALWS01018508.1 3502 VGSPPGASSVSGALGQTVTISCAGSSNDIGRYNDVSWYQQRSGTTPKLLIYRVNARPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCCSYRSG
Pteropus alecto V45 iglv ALWS01018508.1 9562 SWAQSALTQPSSVSGALGQTVTISCAGSSNDIGRYNDVSWYQQRSGTTPKLLIYNVNTRPSGIPDRFSGSKSGNTALLIISRLQPEDEADYHCFSYAGS
Pteropus alecto V50 iglv ALWS01021528.1 2395 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWHQQTPGQAPRRLIYNTNNRPSGIPGRFSGSISGSKAALTITGAQPEDESDYYCSLDMGSYT
Pteropus alecto V56 iglv ALWS01024881.1 1661 ADSQTVVTQEPSLSVSLGGTVTLTCGLSSGSVSTSNYPSWYQQTPGRAPRTLNYKINTRPSGVPDRFSVSISENKAALTITGSQPEDEADYYCNIWDGNSKT
Pteropus alecto V57 iglv ALWS01024881.1 7318 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGRYVSWYQQLPGTAPKTLIYDNNQRPSGVPNRFSGSKSGTSAALTISGLQAADEADYYCSAWDNSLNT
Pteropus alecto V97 trbv ALWS01035732.1 570 VRAQTIRQWPPTKVQVVGSPLSLECTVKGTSNPNLYWYRQALGGALQLLFYSYSVNQTKSDAPQNLTASRPQDGLFILSSKKLLLSDSGFYLCAWS
Pteropus alecto V132 iglv ALWS01051426.1 92 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRYGVQWFQQLPRTAPKTLIYRNSNRASGVPDRFSGSRSGNSGSLTISGLQAEDEAEYYCSAWDNSLN
Pteropus alecto V133 igkv ALWS01051495.1 40431 TTGEIVMTQSPASLSLSSRERATFNCRPSQSVSSYLAWYQQKPEEAPRLLIYSASTRATGIPARFSGSGSGTEFTLTISNLEPEDFATYYCQQYYIEY
Pteropus alecto V134 igkv ALWS01051496.1 2352 SNGNIMLTQSPNLLSVSLRESASIICTANQSVSDYLTWYQQKPGQAPKILIYDADNLYSGVSNRFSGIQSGTKFILTISKIEPDDAASYYCQQGYTVP
Pteropus alecto V145 igkv ALWS01054587.1 10831 TRTETIVTQSLALLSAAPGDKVTITCKASQDIDDDMNWYQQKPGETLMLIIREATTRLSGVPSRFTGSGYGTDFTLTINNMETEDAAYYFCQQDDNL
Pteropus alecto V167 iglv ALWS01063271.1 847 SWAQSVLTQPSSVSGALGQSVTISCTGSSSNVGKYDVQWFQQLPGTAPKTLIYYTSSRPSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCETYDSSLS
Pteropus alecto V211 iglv ALWS01082262.1 724 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGNSVQWFQQLTGMAPKTLMYRNSNRALGVPDRYSGSKSGNSGSLTISGLQAVDEADYYCSAWDSSLDA
Pteropus alecto V315 trav ALWS01005413.1 3291 GLRAQSVTQPDYQITVTEGDPLTVKCTYSFSGSPYLFWYVQYPNRGLQFLLKYITGDKLVKGNFGFEAEFDKKQTSFHLKKLSALATDSAVYFCVGS
Pteropus alecto V352 iglv ALWS01024406.1 950 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSYGVEWFQQLPGTAPKTLIYGTSSRPSGISDRFSGSRSGNSASLTIRGLQAEDEADYYCQTYDSSLDA
Pteropus alecto V381 trbv ALWS01035737.1 15376 LMDTEVTQTPKYLVKTMGEKVLIECSQNMGYDRMFWYRQDPGLGLRLLHVSYGVDSKEKGDFPHGYSVSREKKESFPLTLESASTNQTSVYLCAVY
Pteropus alecto V382 trbv ALWS01035737.1 11738 SVFGAVLSQKPSRDICQHGTFTTMQCQADRELNLMFWYRQLPGQSLTLIATANQGSQVTYESGFTKDKFPISRPNLTFSVLTVSNLSPEDSSVYFCSAG
Pteropus alecto V383 trbv ALWS01035738.1 18433 ISDAEVIQTPSHLVKGKGQKAKMDCLPQKGHPVVYWYQQIQNEEFKFLIYFQNEDILDQIELVKKRFSANCSQNSQNSHCSLEIRSSEPGDSALYFCASSQ
Pteropus alecto V384 trbv ALWS01035738.1 14568 SMDAGVTQTPRNRIAKTGSSITLECSQNKGHDYMYWYRQDPGLGLKLIYYSINIENRNKGEASDGYNVSRNEQAKFSLSLTSAVPSQTALYFCASSY
Pteropus alecto V385 trbv ALWS01035738.1 4535 PMEAEVTQTPRHLIAKTKKKLTVNCSQNMNYEVMNWYRQDPGLGLKLIYYSINTDIVNEGEVSDGYKASRKKKENFLLTLESASTNQTSLYLCASSE
Pteropus alecto V386 trbv ALWS01035739.1 5447 HTDAGITQSPRYKVTGTEKKVTLRCQQTENHDYMYWYRQDLGHGLTLIYYSYGTGNIGQGDVPDGYNVSRSDIESFPLTLESATPSQTSVYFCASRE
Pteropus alecto V389 iglv ALWS01036993.1 601 SWAQSVLTQPSSVSRAPGQSVTISCSNIRSSYVNWYQQLPETAPKLLIYDDSDRASGVPDRFSGSKSGSSASLTISGLQAEDEADYYCSAWDSSLSA
Pteropus alecto V410 trdv ALWS01046030.1 7959 TRTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Pteropus alecto V425 trav ALWS01051822.1 27084 GSCRTEITQSSDTVAMTGTDVKFQCQYDIRDGNYDSVYWYLQRTNQRLTYIYHVFQGTVKLEHYQLSVERELSSSTLTILHVQPRDKAIYYCALR
Pteropus alecto V426 trdv ALWS01051822.1 20863 VLLDINLEPDTKTLTVRVGEPVTFFCRVTGADLKSYQMSWYKKNENNSLTLVYKLSNNSDHNLIRSHFKGKIDALKSQYILGIQKATAKDAGIYYCGSN
Pteropus alecto V427 trdv ALWS01051822.1 416 AMSVHVLVPQDQVMTVSVGESVTFRCSMKGESITNFYLSWYRKTQGNTMTFIHREENIYGPGFQDRFRGKIDVSNNQAVLEILKVSEEDGGSYYCASD
Pteropus alecto V428 trav ALWS01051825.1 14001 VSGKNGVEQSPQYLSAQEGEFITINCSYSKGMTTLHWLRQNPGGGIVSLFILSLQMKKEGRISAKINTKESHSSLHITASQPRDSAIYFCAM
Pteropus alecto V429 trav ALWS01051828.1 13489 SSMAQTVTQPQPEMSVQETETVTLACTYDTSESTYYLFWYKQPPSGEMIFIIRQESYKQQNAMHDRFSVNFQKATKHFSLRISDSQLEDAAMYFCAFMK
Pteropus alecto V444 trbv ALWS01059684.1 688 ATDAQVTQLPGHKVTKRGQEVTLSCEPISGHAALYWYRQTWGQGLELLIYFRNQAPVDDKGMPNARFSAVMPSKSNSTLKIQATEPEDSATYLCASSL
Pteropus alecto V462 ighv ALWS01068331.1 2079 VLSQVQLQKTGRGLVKPSQTLSLTCAVSGGSVTSSDYWSWIRQHPGKGMEWMGYWTGSTRYNPAFQDRISVTADTSRNQFFPQLNSVTSEDTAMYFCAG
Pteropus alecto V463 trav ALWS01068535.1 12652 VCSDDKAIQSPPSLVVREGDYVTLNCNYEVTNFQSLHWYKQEKKTPTFLFILISSGIDKHSGSLRGTLDKKERLSTLHITATQTRDSATYLCAVE
Pteropus alecto V464 trav ALWS01068540.1 14755 VRSLEVQQSPQSMIIQEGEDVTIMCKPSKTSYSLHWYFQKHEEGPIFLMMLQKGGEEKNRDKIVATFNENKQQSSLNITASQPSHSGTYFCGV
Pteropus alecto V465 trdv ALWS01068540.1 7838 FSMTKRVTQVQTIVTRQKGDAVTMDCTYESKWSNYDLYWYKQPPNGKMVFLIYQHSSSPNAKQDRYSVNLQTAETIISLTISSLQLVDSAKYFCA
Pteropus alecto V466 trav ALWS01068541.1 469 IMGDAKSTQPEAVESTEEKPVNLPCNHPTISGAEYVHWYRQIPGQGPEYVIHSLKGNVSHGMMSLIITTDRKSSTLILAQVTLRDSAIYYCILR
Pteropus alecto V467 trav ALWS01068544.1 11347 IMGDAKSTQPDVVESTEEEPVHLPCNHPTISGTEYIHWYRQIPGQGPEYVIQGLKGNVSHGMTSLIIATDRKSSTLILAQVTLRDSAAYYCILR
Pteropus alecto V468 trdv ALWS01068545.1 348 FSMTERVTQAQTTVIRREGEAVTINCTYETTLSYYDLYWYKQPPSGEMFVIIDQHIFNSNEKGDRYSVNFQKAKKFISLTISSLQLADSAKYFCT
Pteropus alecto V491 trav ALWS01077891.1 4196 SSIAQKVTQGQRAMLVQEKEAVTLDCRYDTSVTSYTLFWYKQPSSGGMIFLIRQDSYSKQNATEGRYSLNFQKAKNSINLVISAAQLEDSALYFCALSE
Pteropus alecto V492 trav ALWS01077896.1 14586 RTRGDSVSQMGGQMTLSEGASLNVSCTYSATGYPILFWYVQYPGEGPQLLLKAQKANEKGRKKGFEATYHREANSFHLEKASVQESESAMYYCALS
Pteropus alecto V561 iglv ALWS01102114.1 1436 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGNNVHWYQHFPGSAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTISGLQAEDEADYYCQTYDDSLDA
Pteropus alecto V585 trav ALWS01146814.1 326 TLSLAKTTQPIFIDSYEGQEVNISCDHTNIVTNEFILWYRQFPNQGPQFLIQGYKTNTANELVSLFIPHDRKSSTLSLPWASLSDTAVYYCIVT
Pteropus alecto V586 iglv ALWS01157700.1 548 ATSQAVVTQEASLSTSPGGTVTLTCGSSAGAVTTSNYASWVQQKPYQVPQGLIGDTSNRVAGVPARFSGSLLGGKAALTITGAQPEDEADYHCAL
Pteropus alecto V588 trav ALWS01160942.1 473 VSSQKVEQNPHSLSIQEGEEAILTCNYTNISPVLLQWYRQDPGRGLVFLLLVRENERKREMGRLRATFDTALKQSSFHITASQSADSATYFCAA
Pteropus alecto V589 trgv ALWS01162330.1 5541 ISGDILITQIITSITKKRGNTAFLECQIKPDILKKNVYIHWYQQKPDQPLKRILYISSNENVVHEQGVSEERYEARKQRSGLLVSLRIHQVNEEDAGLYYCARWD
Pteropus alecto V590 trgv ALWS01162330.1 3769 GDTKVRISQSQLSFTRRTDRTVHIGCKLSGVHLENAIVHWYQQKEGEPLKRILYGSTNNYKQDKPNSRLETDKKDNGNFYLIINNVVKSDEATYYCAYWD
Pteropus alecto V591 trgv ALWS01162331.1 5324 VLGLSKVEQSRISISTEVKKSVDIHCKISSTSFEKDVIFWYWQKPNQALEYLIHVSSTQTPALSRKGGKNNKVEARKNSQILTSILTINFIEKEDAAIYYCAGW
Pteropus alecto V592 trgv ALWS01162334.1 6050 TQVSSNLEGRKISVTRATGMIAVFTCDSLQKSVDYIHWYRYQEGMALQHLLYYHFFSSKVVVEGRISSGKYHAYEGTGRSCKFVLRNLEESDSGVYYCAAWE