WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Orycteropus afer afer ALYB00000000.1 (ALYB01) 155 65 22 9 32 16 3 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Orycteropus afer afer V287 trgv ALYB01224161.1 13496 SQKASNLKMRSVTKETGTSVMITCDILDQKINYIHWYRYQEGKALQRLLYYNFPKKQVVVDSGFRAEKYTAYEGLERSCKFVVRNVEKSDSGVYYCATWD
Orycteropus afer afer V303 trav ALYB01237278.1 17799 TVGQSIQQPTEVMAMEGGSVQVNCTYQISGFNGLSWYQQGDGGAPTFLSYSVLDGLEKQGCFSSFLSRSNAYSYLLLTELRIKDSANYLCAVR
Orycteropus afer afer V304 trav ALYB01237311.1 4989 VGRGEKVEQSPSLLRVQEGESTFSNCTYTDSASVSTSFFWYKQEPGKGPQLLIHIVSTMDKKEDKRLTVLLNKKDKHFSLQIADSLPGDSATYFCATS
Orycteropus afer afer V305 trav ALYB01237323.1 4073 VNSQKMEQSPQALNIQEGEKATLTCNFTSTPTSLQWYRQDPERGLYLLVLIRENEAEKWEGRLRVTFEKTIKQSSLQIPASQPADSATYLCAA
Orycteropus afer afer V306 trav ALYB01237323.1 10233 GTNGDSVTQAEGTVTLLEGASLTLNCTYQTVYSAVLYWYVQYQNSALEVLLKSSSESQEMDKRGFQANHVKSNSSFHLKKLSVQISDSAVYYCVLA
Orycteropus afer afer V307 trav ALYB01237326.1 8686 EARAQSVTQPDVQVSVSEEASLELRCNYSYGGSVYLYWYVKYPNKGLQLLLKYFSGDTLVKGINGFEAEFRKSDSSFNLRKHSAHWKDSAEYFCVVS
Orycteropus afer afer V308 trav ALYB01237330.1 1652 DARAQLVTQPDVQVSVSEGASLELRCNYSYSTTPYLFWYVQYPNQGLQFLLKYISGDNTLVKGINGFEAEFRKSESSFHLRKFFVYWRDSAEYFCVLR
Orycteropus afer afer V309 trav ALYB01237333.1 1461 GVRGVKVEQSHEVLSLPEGTGSTLRCNYSTIVDKVQWFQQNPGGSLISLFVIVSGMKQNGRLKSTINFKELYSTLHITASQMEDSATYLCAVE
Orycteropus afer afer V310 trav ALYB01237333.1 19490 LCRGENVEQHPSTLSVLEGSSSVINCTYSDSTSSYFPWYKQEPGKGPRLIIDIRSNVDKKEDERLTVLLNKKDKHLSLHITASQPGDSAVYFCAAS
Orycteropus afer afer V311 trdv ALYB01237334.1 3788 FNMAQEVTQAQLAMMVQEEEAVTLPCTYDTNEKSFSLFWYKQPSSGEMIFLIRQDSYNEQNATEGRYSLNLQKTAKSIKLAISASQLEDSAVYFCVLRE
Orycteropus afer afer V312 trav ALYB01237334.1 13481 GTSGDSVTQTESQVTVTEAAILTINCTYSAAGYPALFWYVQYPGEELRVLLKATTANKKEKNKGFEATHNKEASSFHLEKASVQVSDSAVYYCAVS
Orycteropus afer afer V313 trav ALYB01237336.1 3236 GVSGNNQVKQSPQSLIILEGENCKLHCNYSVRPFNNLRWYKEDPGRGLVSLIIMTHSESKISKGRYTATLDEAAKYSSLHLTASQLSNSASYICAVG
Orycteropus afer afer V314 trav ALYB01237338.1 6630 APSQQKGIRQAPGALTIPEGATASFNCTYEDSASLYFSWFRQYIGKGPELLMFVYTNEEKNEGRFTIKLNQRSQYVSLLITDSQPSDSATYLCAV
Orycteropus afer afer V315 trav ALYB01237338.1 11867 AQGQQKEVEQSPGSLTIPEGAIASLNCTYKDRASRNFMWYRQYSGKGPELLMSIYSNEDKKEGRFTVQLNKGSQYVSLLITDSQPGDSATYLCAV
Orycteropus afer afer V316 trav ALYB01237338.1 16821 SLSQQKGVKQSPGSLTIPEGAIASFNCTYEGLTFQYFMWYRQHSGKGLELLMTIYSSEDKKGRFTAQHNKGSQYVSLLITDSQPGDSATYLCAG
Orycteropus afer afer V317 trav ALYB01237338.1 22248 AQGQQKGVKQSPASLTIPEGAIASLNCTYEDRYSQNFMWYRQYSGKGPELLMFVYSDEDKKEGRFTGQLNKGSQYVSLLITDSRPGDSATYLCAV
Orycteropus afer afer V318 trav ALYB01237338.1 27028 SPSQQKDLKQSPSSLSILAGATASLNCTYEDRTFQYFMWYRQYSGEGPELLMSIYSSEDKKGRFTALFNKGSQYVSLLITDSQLSDSATYLCAG
Orycteropus afer afer V319 trav ALYB01237338.1 39232 GTTAQLVTQPDLHVTVSEEAPLELKCNYSSSVTPSVFWYVQYPNQGLQLLLKYISGNTVVKGINGFEAEFKKSETSFHLKKLSVHWNDSAKYFCAVS
Orycteropus afer afer V320 trav ALYB01237339.1 7441 RTNGDSVIQAEGPVTLAEGASLTLNCTYQTSYTAFLFWYVQYLNKAPELLLKSSSENPKMDSRGFQADHVKSDSSFHLKKLSVQTSDSAMYYCVLV
Orycteropus afer afer V321 trav ALYB01237341.1 10531 NTNGDSVTQTEGAVTFSEEGPMILNCTYQSTSSSPFLFWYVQHLNKAPQLLLKSSTESQRTENQGFLANLVKSENSFHLQKRSLQIADSAVYYCALR
Orycteropus afer afer V322 trav ALYB01237342.1 3245 SSGEDQVVQSPQALILQEGDNSSLNCSYSVSSFSSLQWYKEDSGKGPEFLFLLYSVGDEKPNERFRIMLSKKGNSLHITDSNPEDPSTYLCAV
Orycteropus afer afer V323 trav ALYB01237342.1 17082 GTGAQFVTQPDVHVTVSEEAPLELRCNYSSSVPPYLFWYIQHPDQGLQLLLKYTIGNSFVSGIKGFEAEFRKTENSFHLKKPSAHWSDSAEYFCALS
Orycteropus afer afer V324 trav ALYB01237343.1 4562 VRGMQVEQSPPVLSLQEGASYTMRCNFSASVNNVQWFRQNPGGRLLSLFYIASGTKKNGRLSATTVAAERRSSLHISSSQTTDSAIYFCAVEPQCSS
Orycteropus afer afer V325 trdv ALYB01237345.1 8360 SVVAQSVTQVQSATSMPEGAAVTLDCQYETSWTYYHIYWYKQLPSGEIIFLIYQYSENVNAKHGRYAINFQEKAKSISFIVSDLQLEDSARYFCA
Orycteropus afer afer V326 trdv ALYB01237351.1 1079 SILAQSVTQVQSATSMQEGAAVTLDCQYKTSWKLYYIIWYRQLPSGKIMMLIFQYSENVNAKHGRFSINFQKEAKSISLVISDLQLEDSARYFCVLLE
Orycteropus afer afer V327 trdv ALYB01237356.1 7337 SVVAQSVTQVQSATSMPEGAAVTLDCQYETSWTYYHINWYKQLPSGEIIFLIYQYSERPNEKHGRYAINFQKEAKSISLTISALQLEDSARYFCALGE
Orycteropus afer afer V328 trdv ALYB01237358.1 3600 SVVAQSVTQAQSATSMPEGAAVTLDCQYETSWASHYIYWYKQLPTGEIMFLIHQGSYSQNAKLGRYSINFQKEAKSISLIISALQVGDSARYFCALEE
Orycteropus afer afer V329 trdv ALYB01237359.1 742 SIVAQSVTQVQSALSMLEGAAVTLGCQYETSWTYYDINWYKQLPSGEIIFLIYQGSSNPNAKDGRYSINFQKEAKSISLIISALQLEDSARYFCALW
Orycteropus afer afer V330 trav ALYB01237366.1 3854 VSGQEVKQIPQFQLIQEGENFTTYCNSSSTFDSLQWYKQKAGVSPVLLIKLVKAGEVKKQKRLTAQFGTTRKDSSLHITATQAADAGTYFCVL
Orycteropus afer afer V331 trav ALYB01237366.1 14908 ETRAQSVTQPDNHISVSDGAPLELRCNYSSSGVPYIFWYVQYPNKGLQLLLKYFTGDTLVKGIKDFEAEFKKSETSFHLKKHSAHWSDTAEYFCAVR
Orycteropus afer afer V332 trav ALYB01237372.1 5769 IIVEMKVEQSPAVLILQEGRNSSLMCNFSISISSVQWFQQNSGGHLISLFYIASGMKQKGRLKSTVNTKERYSHLYIRDSQPEDSATYFCAVE
Orycteropus afer afer V333 trav ALYB01237373.1 4975 VTGQKEDVVQNPLILNVLERDTAVINCSYKNEAANYFPWYKKEAGKGFNLLIDIRSTVDKKQDGRVTVLLNKIDKRISLHISATQPEDSALYLCAA
Orycteropus afer afer V334 trav ALYB01237376.1 9556 VCSQEVEQSPQSLIIQEGEDLTISCNCSKTVYSLNWYKQKHREGLTLFMTLQKGGEEKSHEKVTAKLDENKQQSSLHITASEPQHSGIYLCAAN
Orycteropus afer afer V335 trav ALYB01237377.1 11014 VSGQQLNQSPQSMSIQEGEDFTMNCNSSSTFNTLLWYKQDPGDGLVLLTTLYKSGELTRSGKLTAQFGGTRKDSLLLISASESDDAGTYFCAG
Orycteropus afer afer V336 trav ALYB01237382.1 10690 SSTAQTVTQSQQQISVQEAESVTLNCTYDTSESNYNLFWYKQPLSGEMIFIIRQEAFRQQNATENRYSVNFQPAAKSFGLRISDSQLGDAVMYFCAFG
Orycteropus afer afer V337 trav ALYB01237386.1 9158 SSMAQTVTQSQQQLSVQEAQSVTLSCTYDISGSNYYLFWYKQPPSGEMIFIIRQEAFIQKNATENRFSVNFQPAAKSFSLRISDSQLGDAAMYFCALND
Orycteropus afer afer V338 trav ALYB01237401.1 22698 GSCRTKIMQSSNMASIIGTDVKFQCQYNIPAESYDSVYWYLQRANQKLTYISHTFQGTVESGRYQLSVDRELSSTNLTIKHVQPRDKAIYYCALQ
Orycteropus afer afer V339 trdv ALYB01237401.1 30529 VSLDIILEPSAKILTVLIGEPATFHCNVTGGDLKNYHMSWYKKNEDNSLILVYRLSNSSNDDLENHFKGKINDLKSQFVLEIQKATTKDVGAYYCASD
Orycteropus afer afer V418 trbv ALYB01329202.1 6173 HPNAGVTQTPKYIVAEMGHAVSMKCEPISGHDTLYWYRQTSARGLELLVYFRSRALIQQDKTLKDRISADMPDGSPSTLRINSSELGDLAVYLCASSL
Orycteropus afer afer V419 trbv ALYB01329202.1 10804 PKDAAVIQNPKYWVTRKGKRVSLGCSQNLGHDTMYWYQQKPSQGPKLLFYYYDTAFNNGTGTSDNFQPSRPNTSFCGLDIHSAGVGDPAVYLCACSR
Orycteropus afer afer V420 trbv ALYB01329204.1 27 SADSGITQTPKYLVLKEGQNVTLGCEQSLGHDAMYWYRQDSGQGLRLVYYSPVKSDIQEGDIAAGYHVSREKKERFLLRVTSAQGQQTALYLCASSL
Orycteropus afer afer V421 trbv ALYB01329205.1 484 PGLGAQVSQYPSRAICNSGASVKIQCHAQDIQAIAVFWYRQLPGQSFILIATSNQGSNATYEQGFTQAKFPISHPNLTFSTLTVTEAQVKDSSVYFCAAS
Orycteropus afer afer V422 trbv ALYB01329210.1 69 SMDTRVTQTPGQLVKGTNQKARMECVPIKGHSYVYWYRQKLGEELKFLIYFNNEDPLDRSGMPKERFSAQCPQNSPCSMEINSTEPEDAAVYFCASSL
Orycteropus afer afer V423 trbv ALYB01329211.1 71 SMDARVTQTPGQLVKGTKQKAKMDCVPITGHKAVYWYRQKPGEELKFLIYFEDREDLDRSGMPKERFSAQCPQNSPCSMEINSTEPEDAAVYFCASSQ
Orycteropus afer afer V424 trbv ALYB01329222.1 1464 SMDARVTQTPRQLVRGTKQKARMDCVPMKGHDYVNWYRQKLGKELEFLIYFNNEKALDTSGMPKERFSAQCPKNSPCSMEINSTEPEDSAVYFCASSL
Orycteropus afer afer V425 trbv ALYB01329234.1 2779 SMSADISQTPRHFVTRTGKKITLECSQTMGHDFMYWYRQDPGKELQLIHYSYGINSTEKGELPSRWTVSRRRTDHFPLELESASPAETASYHCASSI
Orycteropus afer afer V426 trbv ALYB01329234.1 5184 LTDAVVTQSPTHKVLGRGKDVTLECSQDMNHFSMYWYRQDPGHGLRLIYYSSGTGSTENGEVSEGYSVSRKEMRDFALTLGSASPNQSAVYLCASSE
Orycteropus afer afer V427 trbv ALYB01329235.1 5279 LMGAQVTQTPRYLVQRTGKKVLLKCVQNLQHDRMFWYRQDPAMGLRLIHYSYEVGNTEEGDIPDGYNVSRKIQESFPLTLESASLNQSAVYLCASSE
Orycteropus afer afer V428 trbv ALYB01329239.1 886 SGFGVLVSQKPRSGICQHGTSVTIQCQLDREVTAMFWYRQPPGQSLTLIATANQGSEATYESEFTKDKFPISRPNFMFSTLTVSEGSPKDSGVYLCSTG
Orycteropus afer afer V465 iglv ALYB01375421.1 3765 AFSQSQVTQPPSLSASPGTSVRLPCTLSSDISVGGQRIYWFQQKPGSPPRYLLSYYSDSNKHQGSGVPSRFSGAKDASANAGLLLISGLQPEDEADYYCTI
Orycteropus afer afer V466 iglv ALYB01375422.1 1996 SWAQSVLTQPSATSESVGNTVTLSCTGGSSNVGRGDVSWYQQLLESPPKLLIYGSSARPSGVPARFSGSRSGNMATLSISGLQPEDEADYYCSVWDSSIN
Orycteropus afer afer V467 iglv ALYB01375428.1 5109 SWAQTGLTQEASVSGSVGQKVTLSCTGNSNNVGRNNVGWYQQIPGGAPKTVMHGTSRPSGIPARFSGSKSGNTASLTISGLQPEDEADYYCSTWDSSLSA
Orycteropus afer afer V469 iglv ALYB01376030.1 419 SLSQPVLTQPSSLSSSLGTSVKLSCTLSSDFKVGDFWIRWHQQNPGSPPRYLLTFRSDSDKHQGSGVPSRFSGSNDASTNAGILLISNVQPEDEADYYCNTYHG
Orycteropus afer afer V470 iglv ALYB01376032.1 2902 SMTQAGLTQPTSVSKGLGQTATITCTGNNNNVGNQGAGWVQQHGNQAPKAVMKRNNNRPSGVSERFSGSRSGNVATLSISGLQPEDEANYYCAAWDSSLSA
Orycteropus afer afer V471 iglv ALYB01376034.1 168 SWAQGVLTQPSAKSESVGKMVTISCTGGSSNVGRGYPYWFQQLPGSPPKLLIYNGSRPSGVPARFAGSRSGNTATLSISGLQPEDEADYYCATWDSSLR
Orycteropus afer afer V472 iglv ALYB01376042.1 111 SWAQSVLSQPPSVSGNRGQQVTVSCSGGSSNVGRGYPDWFQQFPGNAPKLLIYSGSSRPSGVPTQFSGSSSENTATLSISGLQPEDEADYYCAAWDSSIR
Orycteropus afer afer V473 iglv ALYB01376043.1 845 SLSQPVLTQPPSMSASPGASVRLTCTLSSGFSVGSYYIYWYQQKPGSPPRFLLYYSSSTSLGSGVPSRFSGGKDASANAGLLLISGLQPEDEADYYCMI
Orycteropus afer afer V474 iglv ALYB01376045.1 2050 AHSQPVLTQPPSISASLGTSARLPCTLRSDISVGSYTIYWYQHKSGSLPHCLLYYYTGTNLGSGVPSRFSGFKDATANAAILLISGLQPEDEADYYCKIWYNSA
Orycteropus afer afer V475 iglv ALYB01376048.1 2162 SLSQPVLTQAPSASASLGASVKITCTLGSQHSTYTIGWFQQRAGNSPRYVMYVKSDGSHSKGGGIPDCFSGSSSGADRYLTISNVQSEDEADYICGADY
Orycteropus afer afer V476 iglv ALYB01376050.1 874 SWAQTGLTQEASVSGSVGQKVTLTCTGNSNNVGTYNAGWYQQFPGGAPKTVMIGTSHPSGIPARYSGSKSGSTASLTISGLQPEDEADYYCSTWDSSLRA
Orycteropus afer afer V477 iglv ALYB01376050.1 8215 TFSQSLVTQPPSLSASPGTSVRLPCTLRSDISVGGKYIYWFQQKPGSRPRYLLRYKSDSDKHQGSGVPSRFSGAKDASANAGLLLISGLQPEDEADYYCMI
Orycteropus afer afer V478 iglv ALYB01376052.1 842 SWAQSVLSQPPSVSGNPGQQVTVSCTGGSTNIGSYNVHWYQQLPGSAPKLLIYGNNKRPSGIPDRFSGSKSGSSGSLTISGLQPEDEADYYCQSIDSSIGA
Orycteropus afer afer V479 ighv ALYB01377455.1 497 VLSQVTLEESGPGLLKPTQTLSLTCNFSGFSLSTTNIGVGWIRHLPGKAPEWLINIWWNDAKPYNPSLKSRLTISKDTSKNQVFLTMSNMDPADTAVYYCTQA
Orycteropus afer afer V480 ighv ALYB01377461.1 8951 VHCEVQLVESGGGLSQPGGSLRLSCAGSGFTFSSNDMHWVRQAPGKGLQWVASISSSGGSSIYADAVKGQFTISRDNTKNMLDLQMNSLKVEDTAVYYCVK
Orycteropus afer afer V483 iglv ALYB01381699.1 3611 PVASYELTQPPSVSVALGQTASISCGGNNIGSKYAYWYQQKPGQAPVLVIYNDSNRPSGIPDRFSGSNSGNTATLTISRTQAEDEADYYCQVSDSDT
Orycteropus afer afer V484 iglv ALYB01381700.1 2971 LVVSYELTQPHSVSVALGQTARITCGGNNIGGKYTSWYQQKPGQAPVLVIYRDSNRPSGIPDRFSGANSGNTATLTISRAQAEDEADYYCQVWDSSAK
Orycteropus afer afer V485 ighv ALYB01381883.1 875 VQCKVQGVESGGGLSQPGGSLRLSCAASGFTFSRYWMAWIRQAPGQGLYWVGRINPDSSTKNYGESVKCRFTISRDNTKNTLYLQMDNLKVEDTAVYYCAK
Orycteropus afer afer V486 ighv ALYB01381887.1 688 VLSQVTLKESGPGLLKPTQTLSLTCTFSGFSLSTTGMRVSWIRQPPGKALEWLAIIYWDDDKRYNPSLKNRLTVSKDTSKNQVLLTLTNTEPADTAMYYCARG
Orycteropus afer afer V487 ighv ALYB01381891.1 3622 AHSQIQLVQSGAEVKKPGALVKVSCRASGYTFTSYGMHWVRQAPDQALQWMGWINTNTGKPAYAQGFTERYVFSLDASVSTAYLQINNLKSKDTATYYCAR
Orycteropus afer afer V488 ighv ALYB01382130.1 1788 VCAQVQLVQSRAEVKRPGESLKISCKASGYSFTSYWISWVRQMPRKGLEWVGMIDPSDSDTRYSQSFQGQVTISTDNSISTAFLQWSSLKATDTALYYCVR
Orycteropus afer afer V489 ighv ALYB01382130.1 9506 VLSQVTLKESGPGLLKPTQTLSLTCSFSGFSMSTTNMGVGWIRQPPGKALEWLINIWSNDAKYYNPSLKSRLTISKDTSKNQVFLTLTNMDPADTAMYYCAHA
Orycteropus afer afer V490 ighv ALYB01382139.1 7129 VCAQVQLVQSGAEVKRPGESLKISCKASGYSFTSEWISWVWQMPGKGLEWVGEIDPSDSYTRYSPSFQGQVTISTDNSISTAFLQWSSLKATETAVYYCAR
Orycteropus afer afer V491 ighv ALYB01382143.1 1788 VLSQVQLQEVGPGLVQPSQTLSLTCTASGFSLTSHSVHWARQAPGKGLEWVGAIRSNGRTNYNPALASRLSITRDTSKSQVGLKLNSVTDKDTAIYYCAG
Orycteropus afer afer V492 ighv ALYB01383795.1 7128 VQCEVQLVEAGGDVSQPGGSLRLSCAASGSTFSGYRVAWVCQAPGKGLQWVSYIKYDGDKEYYAESVKGRFTVSRDYDKNTLYLHMNSLKVEDIGVYYCAS
Orycteropus afer afer V493 ighv ALYB01383796.1 3498 VQCEVQLVESGGGLSQPGRSLRLSCAASGFTFRDYSMDWVHQAPGKGLQWVAYISSIGGSISYANFVKGRFTISRDNSKNTLYLQMDSLKVEDTALYYCAG
Orycteropus afer afer V494 ighv ALYB01384086.1 2985 AAGGIWGGLSQPGGSLRLSCAASGFTFSSSWTGWIRQSPGQGLYWVARINTESSKTYGSCVKCRFTISRDNAKNMLYLQMESLKVEDTAMYYCTH
Orycteropus afer afer V495 ighv ALYB01384089.1 2723 VQAKEHIVQWGEGTVSPSQTLRLTCATYTLSISEYAVSWIRLRPGKELEWLGVIWANGKTNYSPNLQSRMSISRDTSKNQVFLQLNTVTGEDAGTYYCAQ
Orycteropus afer afer V497 ighv ALYB01385975.1 12440 VQCEVQLVVSGGGLSQPGGSLRLSCAASGFTFSSYAMIWVRQAPGKGLQWVAVISSDGSYIYYADSVKGHFTISRDNAKNTLDLQMNSLKVEDAALYYCVR
Orycteropus afer afer V498 ighv ALYB01386954.1 799 VQCEVQLVESGGGLSQSGGSLRLSCAASGFTFSNNAMSWVCQAPGQGLQWVAYISTGGSIYYADSVKGRFTISRDNAKNTLDLQMDSLKVEDTAMYYCTG
Orycteropus afer afer V499 ighv ALYB01386956.1 572 ALFQVTLEESGPGLLKPTQTLSLTCSFSGFSLSATNIGVGWICQPPGKAPEWLTDIWWDDDKYYNPSLKSRLTISKDTFKNQVFLTMNNMDPADTVVYYCAWA
Orycteropus afer afer V501 ighv ALYB01389224.1 936 VCAQVQLVKSGAEVKRPGESLKISCKASGYSFTGYWISWVRQMPGKGLEWVGAIDPSDSDTRYSPSFQGQVTISTDNSISTAFLQWSSLKATDTAMYYCAR
Orycteropus afer afer V502 ighv ALYB01389231.1 584 FHCEVQLVESRGGLSQPGGSLRLLCAASGFTFSSYSMHWVRQAPGKGLQWVSSIGSSGGVSIYADTVKGRFTISRDNTKNTLDLQMNSLKVEDTAVYYCVK
Orycteropus afer afer V503 ighv ALYB01390860.1 264 VQCEVQLVESGGGLSPPGGSLRLSCTASGFTFSSYWMNWVRYAPGKGMQWVAAINSGGSDISYADSVKGRFTISRDNAKNTLYLQMNSLKAENTAVYYCAT
Orycteropus afer afer V504 ighv ALYB01391794.1 2277 VLSQVQLQESCPGLVKPAQTLSLTCTVSGLSITTSGYCWQWICQPSGKGLQWIGRICASGDTYYSPSLKSRSSISRDTGKNQFSLQLSALTAEDTAMYYCA
Orycteropus afer afer V506 trbv ALYB01396644.1 296 SMDTGITQTPKFLVTSMGNKRSLRCEQSLGHNAMYWYKQVPERPPELMFLYSYKELSANETVPSRFSPENPDSSHLNLHMDALEPGDSAVYLCASSK
Orycteropus afer afer V508 iglv ALYB01399237.1 4564 SLSQSVVTQPPSLSASPGTSVRLPCTLKSDISVDSSLIFWYQQKPGSPPRYLLYYYSDSNKHQGSGVPSRFSGAKDASANAGLLLISGLQPEDDADYYCMT
Orycteropus afer afer V510 ighv ALYB01406403.1 1665 VYAQVQLVQSGEEVKRPGESLKISCKASGYSFTSEWISWVQQIPGKGLECVGDIYPGGSDPRYSPSFQGQVTISRDNSISTTFLRWSSLKATDTAMYYCAR
Orycteropus afer afer V511 trgv ALYB01406750.1 592 GGSVIKLEQPAYILGQKGSSVALQCLVHFQVSYIHWYRNQEGKAPERLLRQAMFKSDVQWDSVLKVDKITAVEAEDGKSCTLWVLKLEKSDEGMYYCAAWD
Orycteropus afer afer V512 trbv ALYB01422761.1 247 SMDTGITQTPKSLVTGMGNKRSLRCEQTLGHNAMYWYKQVLERSPELMFLYSYKEVSANETVPSHFSPEKPDSSHLYLHVDALEPGDSAVYLCASSK
Orycteropus afer afer V513 iglv ALYB01428131.1 970 CADSPSTMSESVGNTVTISCFGDSSNIGSGYADWYQQFPGSLPKVLIYDANNRPSGIPARFSGSRSGNTATLSNSGLQPEDEADYYCAFWDNSIN
Orycteropus afer afer V514 trgv ALYB01433565.1 2221 TCGDILITQPVASITKKKGNTAFLECQVKTNAENKDVYIHWYRQKPDRPIERILYISSNENIVHAQDVSEERYEARKRQNGLSSSLRIHQVVEEDAGIYYCACWN
Orycteropus afer afer V570 igkv ALYB01033428.1 1517 TYGDILMTQSPSYLSGTPGERITITCRTNESIKYTDGKNYLNWYQQKIGPPKQLIYQVSNLRPGVPARFSGSGSDRDFTLTISSIKSEDAGVYYCGQGSFR
Orycteropus afer afer V571 igkv ALYB01033445.1 7679 TRAETLLTQSPELLSATPGDNVAITCKASNDIDDDIHWYQQKPGEAPKLIITYVSTLMSGIPSRFSGSGYGIDFTLTINNIQSEDFAYYFCQQDDNIP
Orycteropus afer afer V572 igkv ALYB01033447.1 2278 TTGQIIMMQSPASLSLSPGESATLTCKASQSVSNNLAWYQQKPGQSPRLLMYSASTRATGIPTRFSGSGSGTDFTLTINRLEPDDFAVYYCQQYNSGN
Orycteropus afer afer V573 igkv ALYB01033457.1 3362 TMGEIMMTQSPASLSLSTGESATLTCRSSQSVSSYLAWYQQKVGQPPRLLIYGTTTRATGIAARFSGRGSGTDFTLTISSLEADDFTVYHCMESSDSWG
Orycteropus afer afer V574 igkv ALYB01033462.1 14633 ASGEVVLTQSPTVLTVPLRESISIICRANEDVSDYLTWYQKKPGQPPKILIYDADNRYSAAPARFSGIQSGKEFILTVSNVEADDAANYYCQQDYKFP
Orycteropus afer afer V575 igkv ALYB01033466.1 28160 SSGDIVMTQTPLTLPIRLGEPATISCKSSQSLVHTDGKTYLNWYQQKPGQAPRLLIYKISNRFTGVPERFSGSGSVTDFSLKISRVEAEDIAVYYCMQNLYYP
Orycteropus afer afer V576 igkv ALYB01033466.1 1424 CRGQIILTQTPETLSATYGAFVSITCRSSSEVGTSMAWYQQKPTEAPRLLIFGASALATGTSARFRGSGSGRDFSLTIQEVNAEDAGVYYCQ
Orycteropus afer afer V577 igkv ALYB01033469.1 12295 SSGDIVMTQTPLTLPIRLGEPATISCKSSQSLVHTDGKTYLHWYQQKPGQAPRLLIYKISNQFTGVPERFSGSGSVTDFTLKISRVETEDVATYYCHQG
Orycteropus afer afer V578 igkv ALYB01033471.1 10031 SSGHIVLTQTPHNLPVTLGETATISCKSSQSLVYSDGKTYLSWYQQKPGKAPHLLIYHVSNRFTGVPDRFSGSGSVTDFTLKISRVEAEDVAVYYCQQS
Orycteropus afer afer V821 trdv ALYB01237407.1 2321 KDTLCNELTQSPPEQTVGSGSEVTLFCTYDLQFSNPDLFWYRMRPDHSFQFILHRDNTRSIDADFTQGQFSVKHSETQKTFHLVISSVRTEDSATYYCAYG
Orycteropus afer afer V841 trbv ALYB01262617.1 411 HSEPRVHQSPRHLVIGMDREVVLRCDPISGHVSLYWYRQTPGKNMELLIYFNDENPSEKSEIFKDRFSAERSGRSFSNLKIQPVQPGDSAVYLCASSE
Orycteropus afer afer V925 ighv ALYB01365524.1 5673 ALSQVQLQQSGPQVVRPSETLTLTCTITGDSVSSSSATWTWIRQSPGRGLEWMGRTYYRSKWYKEYASSFQGRLVINPDISKNQFSLQLSSVTTEDTSEYYCARE
Orycteropus afer afer V926 ighv ALYB01365526.1 2910 VLSEPTLQESGPALVKPSQTLSLICSVSGDSVTSSYYWSWIRQQPGKGLEWMGYWTGSTTYNPAFQGRISIVADTAKNQFSLQLSSMTAEDTAVYYCAK
Orycteropus afer afer V927 ighv ALYB01365528.1 6453 VLSEPILQESGPGLVMPSESLTLICSVYGVYVTSDYAWSWLRQRPGRELEWMGYWSGKAVYNVAFQGRISITDDTTNNQFSLHLSSMTAEDTAMYYCAK
Orycteropus afer afer V928 ighv ALYB01365536.1 3618 VLSEPTLQESGPGMMKPSQTLALTCSVSGFSITTSGYCWDWIRWLPEVGLQWLSRICNDESTGYAPSLKSRLSTSRDTAKNQCSLQLSSVTTEDTAVYYCVRE
Orycteropus afer afer V933 ighv ALYB01374858.1 9906 VCAQGQLVQPGAEVKRPGESLTISCKRSGNANWISWVLQKSGKDLEWMGNIDLSDSETHYGPSFQGQVTISADKSISTAFLQWSSLKVSDTAVYYCAA
Orycteropus afer afer V934 ighv ALYB01374860.1 12823 VHCEVQLVETGGGLSQPWGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVASISSGGGSIYYADSVKGRFTISRDNAKNTLDLQMNSLKVEDTAVYYCAG
Orycteropus afer afer V935 ighv ALYB01374861.1 6363 VQCEVQLVESGGGLSQPGGSLRLSCAASGFTFSSSWMYWVRQTPGKVLQWAAAINSGGSDISYADSVKGRFTISRDNAKNTLYLQMNSLKVEDTALYYCAT
Orycteropus afer afer V936 ighv ALYB01374861.1 4282 VRCEIQLVESGGDVRQPGGSLSLWCKGSGFIFSSYDMDWVRHPPGKGLEWVSGITPGGGAYYSDSVRGRFTISRDNAKNTLYLHMDNLKPEDTALYYCVK
Orycteropus afer afer V937 ighv ALYB01374863.1 1222 VQCEVQLVESGGGLSQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVPSIGSSGGSSIYADAVKGRFTISRDNAKNTLYLQMNSLKVEDTALYYCAK
Orycteropus afer afer V938 ighv ALYB01374865.1 7726 VLCDVQLVKSGGDVRQPGGSLSLSCKASGFTFTDYGMNWVRQAPGKGLEWVALVSQPSGQNQYYSPSVQGRFTIARDNPTSTVSLKMTNLKAEDTAVYYCVR
Orycteropus afer afer V939 ighv ALYB01374865.1 637 VQCEVQLVESGGGMSQPGGSLRLSCAASGLTISGYWMYWVRQAPGKGLQWVSRITSSGNTYYADSVKGRFIISRDNAKNTLYLQMDSLKAEDTAMYYCS
Orycteropus afer afer V940 ighv ALYB01374867.1 8334 VLSEPTLQESGSGLVKPSQTLSVTCSVSGFSITTSGYCWSWIHQPPGKGLQWLSVICYDGGTAYVPSLKSRLSTSRDTSKNQFSLQLSSVTTEDTAVYYCAR
Orycteropus afer afer V941 ighv ALYB01374869.1 3314 VLSQVQLQESGPGLVKPAQTLSLTCTVSGFSITTSGYCWHWIRQPSGKGLQWIGEICASGDTYYSPSLKSRSSISRDTGKNQFSLQLSTLTAEDTAMYYCAR
Orycteropus afer afer V947 ighv ALYB01378743.1 351 VYAQVQLVQSEAEVKRPGKSLKISCKASGYSFTSEWISWVQQIPGKGLEWVGDIYPGGSDPRYSPSFQGQVTISRDNSIRTTFLRWSSLKATDTAMYYCAR
Orycteropus afer afer V948 ighv ALYB01378746.1 380 VQCEVHLVESGGGLSQPGGSLRLACAASGFTFSDYSMYWVRQAPGKGLQWVSRISSGSGGSTYYADSVKGRFTVSRDNAKNTFYLQMNSLKVEDTAVYYCVA
Orycteropus afer afer V949 ighv ALYB01378763.1 519 VQCEVQLVESGGGLSQPGGSLRLSCAASGFTFSSYAMNWVRQVPGKGLQWVASIGRSGGSSIYADSVKGRFTISRDNAKNMLDLQMNSLKVEDTALYYCAK
Orycteropus afer afer V950 ighv ALYB01378767.1 1588 VQCEVQLVVSGGGVSQPGGSLSLSCATSGFTFSDHYMNWVRQAAGQGLKWVSRISSIGGSTYYADSVKGRVTISTYNAKNTLYLQTNSLRVEDTAVYYCAR
Orycteropus afer afer V951 ighv ALYB01378784.1 1276 FLSQVTLEESDPGLLKPTQTLSLTCTLSGLSLNTKNNGVSWIHQPPGKALEWLTDIWWDNSKYYNPSLKSWLTVSKDTSQNQVFLTLSHTDPADTAMYYCPRG
Orycteropus afer afer V952 ighv ALYB01378788.1 1452 ICAQVQLVQSGAEVKRPGESLKISCKTSGYSFTDYWIHWVWQMPGKGLEWVGDIYPDDSDTSYSPSIQDQVTISTDNSISTAFLQWSSLKATDTAMYYCAR
Orycteropus afer afer V953 ighv ALYB01382430.1 5171 VLSQVTLKESGPGLLKPTQTLSLTCSFSGFSLSTMNIGISWIRQPPGKALERLALIDWDDDKHYNPSLKNRLTISKDTSRNQVLLTLTNTDPADTAMYYCARA
Orycteropus afer afer V954 ighv ALYB01382433.1 2953 VQLVESGGDVRQPGGSLSLSCKASGFTFTDYGMNWVRQAPGQGLEWVALVSQPSGKNQYYSPSVQGRFTIARDNPSSTVSLKMTNLKSEDTAMYYCVR
Orycteropus afer afer V955 ighv ALYB01382441.1 5977 VQCEVQLVESGRGLSQAGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVAVISSDSSYIYYADSVKGRFTISRDNAKNTLYLQMNSLKVEDTALYYCAK
Orycteropus afer afer V956 ighv ALYB01383210.1 3396 VRCEGQLESGEDVRQPGGSLSLWCKGSGFIFSSYDMDWVRHAPGKGLEWVSGITPGGGAYYSDSVRGQSTISRDNAKNTLYLHMDSVKPEDTALYYCVK
Orycteropus afer afer V957 ighv ALYB01384233.1 10455 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSNYCWNWIQQPMGKGLLWIGKICASGNTYYSPSFKSRSSISRDTGKKQFSLQLSSLTAEDTATYYCVR
Orycteropus afer afer V958 ighv ALYB01384279.1 7015 QLVESGGDLRQPGGSLRLSCAVSGFTVSNSYMNCVRQAPGKGLQWVSHVTSSGSTFYADSVKGRFTISRDNAKNTLDLQMNSLKVEDTALYYCAT
Orycteropus afer afer V959 ighv ALYB01384279.1 857 VCAQVQLVQSGAEVKRPGESLKISCKVSGYSFTDYWIIWVRQMPGKGLEWVGDIYPDDSDTRYSPSFQGQVTISLDNSISTAFLQWSSLKAMDTAVYYCAR
Orycteropus afer afer V960 ighv ALYB01384285.1 2683 AAGGVWGRPESAWGSLRLSCSASGFTFSSYWMDWIHQAPGQGLYWGRINRDSSNKNDGDSMKGRFTISRDNAKNMLYLQMDNLKVEDTAVYYCTR
Orycteropus afer afer V961 ighv ALYB01384480.1 10329 ALCDVQLVESGGDVRQPGGSLSLSCKASGFTFTDYGMDWVRQAPGQGLEWVAGVSKPSGKNQWYSPSVQGRFTIARDNPTSTVSLKMTNLKAEDTAVYFCVR
Orycteropus afer afer V962 ighv ALYB01384483.1 3208 VLSQVQLPLQEVGPRLVQPSQTLSLTCTVSGFSLSSYHMHWMRQAPGKVLEWIGLIWSGGSTKYNPALASRLSITKDTSKSQVYLKLNSMTDKDTAIYYCAR
Orycteropus afer afer V963 ighv ALYB01385326.1 439 VRCEGQLVESGRDVRQPGGSLSLWCKGSGFIFSSYDMDWVRHAPGKGLEWVSGITPGGGACYSDSVRGRFTISRDNTKNTLYLHMDSLKQEDTALYYCVK
Orycteropus afer afer V964 ighv ALYB01385664.1 2119 VQCEVQLVESGGGLSQPGESLRLSCAASGFIFSSYWMNWVRQAPRKALQWAAAINSGGSDISYSDSVKGRFIISRDNAKNTLDLQMNSLKAEDTAVYYCAT
Orycteropus afer afer V965 ighv ALYB01385678.1 2557 VQCEVQLVESGGGLSQPGGSLRLSCAASGFTFRSHYMSWVRKAPGKGLQWVASISYNGGSTYYADSMKGRFTISRDNAKNTLYLQMNSLKVEDTAVYYCAK
Orycteropus afer afer V966 trbv ALYB01386012.1 2768 HTGAEVTQEPRHRVTKTGQDVALRCHPISGHNALYWYRQTLGQGLEFLMYFQNKDEADTSGMPKARFSTERPDGSSSTLRIQPVEPGDSAVYLCASSL
Orycteropus afer afer V967 trbv ALYB01386013.1 1165 ALDSAISQNPRHLVTQMGGRVSLYCEQNLGHNAMFWYRQDSTQQLRVMFSYNNRKLIVNESVPGRFSPKSPDQAHLSLHIDALQPGDAAVYLCASS
Orycteropus afer afer V968 iglv ALYB01386076.1 2047 TFAQSVVTQPPSVSASPGASVKLTCTLSSDISVGSYTISWYQQKPGSPPRYLLYYSSSTSLGSGVPSRFSGGKDASANAGLLLISGLQPEDEADYYCMIWYNNV
Orycteropus afer afer V969 iglv ALYB01386081.1 748 TFSQSVLTQPPSLSASLGTSMRLPCTLRSDISVGGQRIYWFQQNPGSPPRYLLSYYSDSDKRQGSGVPSRFSGAKDASANAGLLLVSGLQPEDEADYYCMI
Orycteropus afer afer V972 ighv ALYB01387752.1 431 VCAQVQLVQSGAEVKSPGESLKISCKASGYSFTSYWISWVRQMPGKGLEWVGRIYPDDSDMSYSPSFQGQVSISTDNSISTAFLQWSSLKATDTALYYCAR
Orycteropus afer afer V974 ighv ALYB01388084.1 756 VLSQGQLQEVGPGLGKPLQTLSVTCTVSGFSLTDCDVNWVRQAPGKRLELVGVVWYYGNTKYNPTLASRVSITRDTSKRQVYLQLSSLTAEDTAVYYCAR
Orycteropus afer afer V975 ighv ALYB01388090.1 635 VLSQVQLQEVGPGLVQPSQTLSLTCTVSGFSLSSYGVNWARQAPGKGLEWVGAIWSGGSRNYNPTLASRVIITGDTSKSQVYLKLNSVTDKDKDTYYCAR
Orycteropus afer afer V977 ighv ALYB01389723.1 1959 EAGGVRGRPEPAWGSLRLSCAASGFAFSSYWMQWIRQAPGQELYWVGQINPDSSTKNYGDSVKGRFTISRDNTKNTLYLQMDSLKVKDTAVYYCAK
Orycteropus afer afer V978 trav ALYB01389986.1 1966 GNDGDTVTQTKGQVTLSEGDFLTVNCSYTATQYPALFWYVQYPDKGLQLLLKATKANDKGSNKGFEATYDKQTSSFHLEKASVQVSDSAVYYCALS
Orycteropus afer afer V979 trav ALYB01389993.1 641 GYNGDTVTQTEGQVTLSEGDFLTVNCSYTAIQYPALFWYVQYPDKGLQLLLKAANANDKGSNKGFEATYDKQTSSFHLEKASVQVSDSAVYYCALG
Orycteropus afer afer V981 ighv ALYB01393146.1 1755 VLSQVQLQEVGPGRVQPSQTLSLTCTVSGFSLTGTDVNWGRQAPGKGLEWVGGIWSGGSTYYTPTFASQLSITRDTTKSQVYLKLNSVIDKDTAIYYCAR
Orycteropus afer afer V983 iglv ALYB01400046.1 1722 SGAQDVLTQPFAMSESVGKTVTISCTGGSSNIGRGYTHWFQQFPGSAPKLLICEGGSSPSGAPARFSVSRSGNMATLSISGLQPEDEADYYCAAWDDSIN
Orycteropus afer afer V986 ighv ALYB01407631.1 544 VQCEVQLVESGGGLGQPVGSLRLSCAASGLTFSNHWMVWVCQAPGKGLQWVSTISNDGSSKYYTDSVKGRFTISRDNTKSTVYLQMSSLKAEDTAVYYCT
Orycteropus afer afer V989 ighv ALYB01412932.1 3383 AAGGVWGRPESTWGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVAYIRYNGGTISYADSVKGRFTISRDNPKNMLYLQMNSLQVEDTAVYYCT
Orycteropus afer afer V990 iglv ALYB01413814.1 2636 SLVQFVLTQPSAKSESVGNTVTISCTGGSNNVGRGYTGWLQHFPGSTPKLLIYDDSNRLSGVPARFSGSRSGNTATLSISGLQPEDEADYYCASWDSSIN
Orycteropus afer afer V992 ighv ALYB01425047.1 892 VLSQVTLEESGPELLKPTQTLSLTCTFSGFSLSTSGMRVSWIRQPPGKDLEWLALLFWDDDKRYNPSLKSRLTISKDTSKNQVFVTLNNTGPADTAMYYCARA
Orycteropus afer afer V993 iglv ALYB01426170.1 552 SWAQSVLSQPPSVSGNRGQQVTVSCTGSSTNVGIFGVNWYQQLPGSAPKLLIYGDSKRPSGIPDRFSGSKSGSSGSLTVSGLQPEDEADYYCQSIDSSS
Orycteropus afer afer V994 ighv ALYB01427609.1 1485 VQCGVQLVESGGGLSQPGGSLRLCCAASGFTFSSYWMHWVRQAPGKGLQWVSTIPDDGGSKYYTDSVKGRFTISRDNAKNTLYLQMDSLKVEDTAVYYCAA
Orycteropus afer afer V996 ighv ALYB01429436.1 756 VLSQVQLQESGPGLVKPAQTLPLTCTVSGYSITTSGYCWDWIRQPSGKGLQWIGEIRASGNTYYSPSLKSRSSISRDTGKNQISLQLSSLTVEDTAMYYCA
Orycteropus afer afer V997 ighv ALYB01430012.1 702 VQCEVQLVASGGGLRQPGGSLRLSCAASGFTFSNYNMNWIRQAPGKGLQWVAYISTGGSTKYYTDSVKGRFTISRDNAKNTVYLQMDSLKVEDTAVYYCAR
Orycteropus afer afer V998 ighv ALYB01430254.1 631 VLSQVILKESGPGLLKPSQTLSLTCSFSGFSLSTSNMGVGWNRQPPGKALEWLTHIWWDDAKRYNPSLKSRLTISKDTSKNQVFLTLTNTDPSNTAVYYCARA